Q8N4C0 CI062_HUMAN
Gene name: C9orf62
Protein name: Putative uncharacterized protein C9orf62
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRX2 | MRPL17 | 0.81373 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q8N7P3 | CLDN22 | 0.73715 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 3 | P16415 | ZNF823 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q9BWL3 | C1orf43 | 0.68045 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 5 | A8K554 | ZNF815P | 0.62773 | |
| 6 | Q9H9Q4 | NHEJ1 | 0.62116 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q15935 | ZNF77 | 0.60921 | |
| 8 | Q86XU0 | ZNF677 | 0.60584 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q7Z5A9 | TAFA1 | 0.56362 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 10 | P16473 | TSHR | 0.54619 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
20 40 60 80 100 AA: MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGCSVDRTAGRPVLGWRLRNSLTGQEGRQHLHL STMI: DO_DISOPRED3: DDDDDDDD.................................................DDD..DDD................................... DO_IUPRED2A: DD........................DDDDDDDD...................DDDDDDDDDDDDDDDDDDD.......................DDD.D DO_SPOTD: DDDDDDDD...........................................DDDDDDDDDDDDDDDDDDDDDDDDDD.............DDDD...... CONSENSUS: DDDDDDDD.............................................DDDDDDDDDDDDDDDDDDD............................ CONSENSUS_MOBI: .................................................................................................... RICH_[HQ]: QarHgHdaapssgQQ
120 140 AA: SGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQWGWFLSSLFLKIF STMI: DO_DISOPRED3: .................................................... DO_IUPRED2A: D................................................... DO_SPOTD: ...................................................D CONSENSUS: .................................................... CONSENSUS_MOBI: ....................................................