Q8N814 YG045_HUMAN

Protein name: Putative uncharacterized protein FLJ40140

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DJI9 SAA2 0.89443
2 Q7Z601 GPR142 0.8918
3 Q6XR72 SLC30A10 0.86874 biosynthetic process GO:0009058
cell death GO:0008219
cellular protein modification process GO:0006464
...
4 Q9H6U8 ALG9 0.83498 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
5 Q8NA29 MFSD2A 0.77807 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 O15514 POLR2D 0.77611 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q8WWI5 SLC44A1 0.76657 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
8 Q8IXL7 MSRB3 0.76053 response to stress GO:0006950
9 Q4G0W2 DUSP28 0.72032
10 Q5BJD5 TMEM41B 0.69941 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular component assembly GO:0022607

                                           20                  40                  60                  80                 100
AA:                      MGWVIPEWPGAQSCPTAAQVAQPVPFMCNAPASPINDKEKDKAGGRLPSGSEPRARAFCEAGADGEQGDPSPADTIKANQGHIPAAPGETGSVICWCDQS
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             DDD..DDDD..DDDDDD.............DDD.DDDDDDDDDDDDDDDD...D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDDD...........................
CONSENSUS:               DDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDD...........................
CONSENSUS_MOBI:          ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
RICH_MOBI_[AG]:                                                    AGGrlpsGseprArAfceAGA                                     

                                          120   
AA:                      VAPPRPAGLSVSGRQSYLVGCFRWVLTFFFSVFYLTP
STMI:                                                         
DO_DISOPRED3:            .....................................
DO_IUPRED2A:             .....................................
DO_SPOTD:                .....................................
CONSENSUS:               .....................................
CONSENSUS_MOBI:          .....................................