Q8NG41 NPB_HUMAN

Gene name: NPB
Protein name: Neuropeptide B

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UPM9 B9D1 0.71027 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q9UM00 TMCO1 0.71027 homeostatic process GO:0042592
response to stress GO:0006950
signal transduction GO:0007165
...
3 Q9NZH0 GPRC5B 0.71027 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q4G0W2 DUSP28 0.70364
5 Q8IXL7 MSRB3 0.70359 response to stress GO:0006950
6 O15514 POLR2D 0.70284 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q5T6F0 DCAF12 0.70255 cellular protein modification process GO:0006464
8 Q6XR72 SLC30A10 0.68766 biosynthetic process GO:0009058
cell death GO:0008219
cellular protein modification process GO:0006464
...
9 Q92925 SMARCD2 0.67321 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
10 Q6P582 MZT2A 0.6569

                                           20                  40                  60                  80                 100
AA:                      MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDDDDDDDDD....................
DO_IUPRED2A:             ......................................................DDDDDDDDDDDDDDDDDDDD..........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................
CONSENSUS:                                       ..............................DDDDDDDDDDDDDDDDDDDDDD........................
CONSENSUS_MOBI:                                  .............................DDDDDDDDDDDDDDDDDDDD...........................
RICH_[AG]:                                                                           GAeppGGAGA                              
RICH_[GP]:                                                                        PyrGaePPGGaGasP                            
RICH_MOBI_[AG]:                                                                      GAeppGGAGA                              

                                          120               
AA:                      PDGRGTYQCKANVFLSLRAADCLAA
STMI:                                             
DO_DISOPRED3:            ........................D
DO_IUPRED2A:             .........................
DO_SPOTD:                ......................DDD
CONSENSUS:               ........................D
CONSENSUS_MOBI:          .........................