Q96C74 ROP1L_HUMAN
Gene name: ROPN1L
Protein name: Ropporin-1-like protein
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- reproduction GO:0000003
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96PG1 | MS4A4E | 0.61396 | |
| 2 | Q8TCW9 | PROKR1 | 0.58835 | signal transduction GO:0007165 |
| 3 | Q9Y2H1 | STK38L | 0.55155 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 4 | Q7LBR1 | CHMP1B | 0.48067 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cell division GO:0051301 ... |
| 5 | Q9BYW3 | DEFB126 | 0.41672 | immune system process GO:0002376 reproduction GO:0000003 response to stress GO:0006950 |
| 6 | O60674 | JAK2 | 0.40841 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 7 | Q92878 | RAD50 | 0.29536 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | P03915 | MT-ND5 | 0.27412 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 ... |
| 9 | P04921 | GYPC | 0.26846 | immune system process GO:0002376 |
| 10 | Q9H5Y7 | SLITRK6 | 0.26116 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
20 40 60 80 100 AA: MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQK STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: ........................................................DDDDDDDDDDDDDD.............................. DO_SPOTD: DDDDD..................................................DDDDDDDDDDDDDDD.............................. CONSENSUS: DDDD....................................................DDDDDDDDDDDDDD.............................. CONSENSUS_MOBI: .................................................................................................... RICH_[MT]: MeMpTaTqkT
120 140 160 180 200 AA: WKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: RKNGMIGLSDFFFPKRKLLESIENSEDVGH STMI: DO_DISOPRED3: ....................DDDDDDDDDD DO_IUPRED2A: .............................D DO_SPOTD: ................DDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDD CONSENSUS_MOBI: ..............................