Q96PG1 M4A4E_HUMAN
Gene name: MS4A4E
Protein name: Putative membrane-spanning 4-domains subfamily A member 4E
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TCW9 | PROKR1 | 0.90853 | signal transduction GO:0007165 |
| 2 | Q9BYW3 | DEFB126 | 0.70498 | immune system process GO:0002376 reproduction GO:0000003 response to stress GO:0006950 |
| 3 | O60674 | JAK2 | 0.67816 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 4 | Q96C74 | ROPN1L | 0.61396 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 5 | Q9H5Y7 | SLITRK6 | 0.59763 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 6 | Q9Y2H1 | STK38L | 0.59215 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q7LBR1 | CHMP1B | 0.5634 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cell division GO:0051301 ... |
| 8 | Q9NQ25 | SLAMF7 | 0.55815 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
| 9 | Q9UKJ0 | PILRB | 0.55815 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 10 | P03915 | MT-ND5 | 0.53315 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 100 AA: MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLSMGIIMMCVAFSSYEEHPIFVYVAYTIWGSVMYPYQLQQEL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: DDDDDDDDDD.DD.D..................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... ... .... CONSENSUS_MOBI: ................................................... ... .... RICH_[T]: TTmqgmeqTT RICH_[MT]: MTTMqgMeqTT RICH_fLPS_[M]: MttMqgMeqt
120 AA: EQQKVWNYLKNLSWRIMGSYLCFGERSELKPL STMI: DO_DISOPRED3: ......DDD....................... DO_IUPRED2A: ................................ DO_SPOTD: .........................DDDDDDD CONSENSUS: ................................ CONSENSUS_MOBI: ................................