Q9BYW3 DB126_HUMAN

Gene name: DEFB126
Protein name: Beta-defensin 126

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96PG1 MS4A4E 0.70498
2 P03915 MT-ND5 0.67267 cellular component assembly GO:0022607
generation of precursor metabolites and energy GO:0006091
protein-containing complex assembly GO:0065003
...
3 Q9Y2H1 STK38L 0.66901 cellular protein modification process GO:0006464
signal transduction GO:0007165
4 O43586 PSTPIP1 0.66741 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
...
5 Q8TCW9 PROKR1 0.66225 signal transduction GO:0007165
6 Q7LBR1 CHMP1B 0.6389 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cell division GO:0051301
...
7 Q9H3Z4 DNAJC5 0.60469 cell death GO:0008219
cell-cell signaling GO:0007267
immune system process GO:0002376
...
8 Q6UXZ3 CD300LD 0.58203 immune system process GO:0002376
9 A0A0U1RQI7 KLF18 0.57582 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q9NUK0 MBNL3 0.57064 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMS
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDD.............................................................DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDD..D...............................................DDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                   ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                              ................................................................................
RICH_[AM]:                                                                                                   AttAtttlMMttAsMs
RICH_[AT]:                                                                                                  TATTATTTlmmTTAsms
RICH_[M]:                                                                                                            MMttasMs
RICH_[T]:                                                                                          TkTTrisTvTaTTaTTTlmmTTasms
RICH_[MT]:                                                                                                TvTaTTaTTTlMMTTasMs
RICH_fLPS_[T]:                                                                                     TkTTrisTvTaTTaTTTlmmTT    
RICH_fLPS_[TM]:                                                                                    TkTTrisTvTaTTaTTTlMMTTasMs
RICH_fLPS_[M]:                                                                                             vtattatttlMMttasMs

                                  
AA:                      SMAPTPVSPTG
STMI:                               
DO_DISOPRED3:            DDDDDDDDDDD
DO_IUPRED2A:             ...DDDDDDDD
DO_SPOTD:                DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDD
CONSENSUS_MOBI:          ...........
RICH_[AM]:               sMA        
RICH_[AT]:               smA        
RICH_[M]:                sM         
RICH_[T]:                smapTpvspT 
RICH_[MT]:               sMapTpvspT 
RICH_fLPS_[TM]:          sMapT      
RICH_fLPS_[M]:           sM