Q96MX0 CKLF3_HUMAN
Gene name: CMTM3
Protein name: CKLF-like MARVEL transmembrane domain-containing protein 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HA65 | TBC1D17 | 0.74155 | catabolic process GO:0009056 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9UGQ3 | SLC2A6 | 0.74037 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q9H6T0 | ESRP2 | 0.72432 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q7Z5R6 | APBB1IP | 0.7161 | cell adhesion GO:0007155 immune system process GO:0002376 signal transduction GO:0007165 |
| 5 | Q2I0M4 | LRRC26 | 0.7104 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q9UJJ7 | RPUSD1 | 0.71037 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 7 | A0A0U1RRE5 | NBDY | 0.70305 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | P20809 | IL11 | 0.69968 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | A0A1B0GUX0 | ATP6V1FNB | 0.6994 | |
| 10 | A0A1B0GUC4 | MYOCOS | 0.69463 |
20 40 60 80 100 AA: MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYVASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPM STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... ................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD.......................................... ................ RICH_[P]: PPdPdPdPdPePaggsrPgPavP RICH_[DP]: PPDPDPDPDPePaggsrPgP RICH_[GP]: PdPdPePaGGsrPGPavPG RICH_fLPS_[P]: mwPPdPdPdPdPePaggsrPgPavP RICH_fLPS_[D]: wppDpDpDpD RICH_fLPS_[PD]: wPPDPDPDPDPeP RICH_MOBI_[P]: PPdPdPdPdPePaggsrP RICH_MOBI_[DP]: PPDPDPDPDPePaggsrP RICH_fLPS_MOBI_[P]: mwPPdPdPdPdPePa
120 140 160 180 AA: MDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSDSD STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................................................................DDDDDDDDDDDDDDD DO_SPOTD: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......... .......DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......... ............................... RICH_[D]: DsaDettahkteeensDsDsD RICH_[E]: EttahktEEE RICH_[DE]: DsaDEttahktEEEnsDsDsD RICH_[ET]: ETTahkTEEE