Q99622 C10_HUMAN

Gene name: C12orf57
Protein name: Protein C10

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IWX5 SGPP2 0.91037 biosynthetic process GO:0009058
cell population proliferation GO:0008283
small molecule metabolic process GO:0044281
2 Q02978 SLC25A11 0.79262 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
3 Q96FZ5 CMTM7 0.78273 anatomical structure development GO:0048856
cell differentiation GO:0030154
immune system process GO:0002376
4 Q9NWH2 TMEM242 0.75258
5 Q6UW01 CBLN3 0.73994
6 P37287 PIGA 0.73279 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 A6NFF2 NAP1L6P 0.7313 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
8 O95295 SNAPIN 0.7282 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
9 Q5T6F0 DCAF12 0.71758 cellular protein modification process GO:0006464
10 Q9Y664 KPTN 0.70711 cytoskeleton organization GO:0007010
response to stress GO:0006950
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDD............................................................................................
DO_IUPRED2A:             ...................................DDDDD............................................................
DO_SPOTD:                DDDDDDDDD...........................................................................................
CONSENSUS:               DDDDDDDD............................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120              
AA:                      KLKALFLPPMTLPPHGPAAGGSVAAS
STMI:                                              
DO_DISOPRED3:            ............DDDDDDDDDDDDDD
DO_IUPRED2A:             ................DDDDDDDD..
DO_SPOTD:                .........DDDDDDDDDDDDDDDDD
CONSENSUS:               ............DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................
RICH_[AG]:                              GpAAGGsvAA