P16104 H2AX_HUMAN
Gene name: H2AX
Protein name: Histone H2AX
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7L7L0 | H2AW | 0.96665 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 2 | Q8IUE6 | H2AC21 | 0.95016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q16777 | H2AC20 | 0.84781 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | Q99878 | H2AC14 | 0.82947 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 5 | Q96KK5 | H2AC12 | 0.76684 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 6 | Q9BTM1 | H2AJ | 0.72993 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | Q6FI13 | H2AC18 | 0.67887 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | O14490 | DLGAP1 | 0.60786 | cell-cell signaling GO:0007267 |
| 9 | Q6PF06 | TRMT10B | 0.5982 | cellular nitrogen compound metabolic process GO:0034641 |
| 10 | O75129 | ASTN2 | 0.59533 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD.........................................................D.D....DD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[AK]: KtggKArAKAK RICH_[GK]: GKtGGKaraK RICH_MOBI_[AG]: GrGktGGkArAkAksrssrA RICH_MOBI_[AK]: KtggKArAKAKsrssrA RICH_MOBI_[AR]: RgktggkARAkAksRssRA RICH_MOBI_[K]: KtggKaraKaK RICH_MOBI_[R]: RgktggkaRakaksRssR RICH_MOBI_[GK]: GrGKtGGKaraKaK RICH_MOBI_[GR]: GRGktGGkaRakaksRssR RICH_MOBI_[KR]: RgKtggKaRaKaKsRssR
120 140 AA: VTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY STMI: DO_DISOPRED3: ....................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ......................DDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..............D...DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................DDDDDDDDDDDDD.......... RICH_[GK]: GpKapsGGKK