Q8IUE6 H2A2B_HUMAN
Gene name: H2AC21
Protein name: Histone H2A type 2-B
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7L7L0 | H2AW | 0.98061 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 2 | P16104 | H2AX | 0.95016 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | Q16777 | H2AC20 | 0.87551 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | Q99878 | H2AC14 | 0.86974 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 5 | Q96KK5 | H2AC12 | 0.77626 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 6 | Q9BTM1 | H2AJ | 0.76211 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | Q6FI13 | H2AC18 | 0.68721 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | Q8IV32 | CCDC71 | 0.64362 | |
| 9 | Q92522 | H1-10 | 0.63393 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | O14490 | DLGAP1 | 0.62763 | cell-cell signaling GO:0007267 |
20 40 60 80 100 AA: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD..D......................................................D.D...DDD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[AK]: KqggKArAKAK RICH_[K]: KqggKaraKaK RICH_[GK]: GrGKqGGKaraKaK RICH_MOBI_[AG]: GrGkqGGkArAkAksrssrA RICH_MOBI_[AK]: KqggKArAKAKsrssrA RICH_MOBI_[AR]: RgkqggkARAkAksRssRA RICH_MOBI_[K]: KqggKaraKaK RICH_MOBI_[R]: RgkqggkaRakaksRssR RICH_MOBI_[GK]: GrGKqGGKaraKaK RICH_MOBI_[GR]: GRGkqGGkaRakaksRssR RICH_MOBI_[KR]: RgKqggKaRaKaKsRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESHKPGKNK STMI: DO_DISOPRED3: ....................DDDDDDDDDD DO_IUPRED2A: ..................DDDDDDDDDDDD DO_SPOTD: ..................DDDDDDDDDDDD CONSENSUS: ..................DDDDDDDDDDDD CONSENSUS_MOBI: .............................. RICH_[K]: KKteshKpgK