Q99879 H2B1M_HUMAN
Gene name: H2BC14
Protein name: Histone H2B type 1-M
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O15213 | WDR46 | 0.88111 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
2 | Q99877 | H2BC15 | 0.88064 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
3 | Q9BRU9 | UTP23 | 0.87635 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
4 | Q15198 | PDGFRL | 0.87391 | |
5 | P24844 | MYL9 | 0.87355 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
6 | Q9NWT1 | PAK1IP1 | 0.86636 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 ribosome biogenesis GO:0042254 ... |
7 | Q9Y324 | FCF1 | 0.8658 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
8 | Q8N257 | H2BU1 | 0.86284 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
9 | Q9BY42 | RTF2 | 0.85705 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
10 | O76021 | RSL1D1 | 0.85619 | cell death GO:0008219 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDD.D.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[K]: KsapvpKKgsKKainKaqKKdgKKrK RICH_[KP]: PePvKsaPvPKKgsKKainK RICH_[KR]: KdgKKRKRsR RICH_fLPS_[K]: KKgsKKainKaqKKdgKKrK RICH_MOBI_[PV]: PePVksaPVP RICH_MOBI_[K]: KsapvpKKgsKKainKaqKKdgKKrKrsrK RICH_MOBI_[KR]: KdgKKRKRsRK RICH_fLPS_MOBI_[K]: KKgsKKainKaqKKdgKKrKrsrK
120 AA: LLLPGELAKHAVSEGTKAVTKYTSSK STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .................DDD..DD.. DO_SPOTD: ....................DDDDDD CONSENSUS: ......................DDDD CONSENSUS_MOBI: ..........................