Q99879 H2B1M_HUMAN

Gene name: H2BC14
Protein name: Histone H2B type 1-M

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15213 WDR46 0.88111 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
2 Q99877 H2BC15 0.88064 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
3 Q9BRU9 UTP23 0.87635 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 Q15198 PDGFRL 0.87391
5 P24844 MYL9 0.87355 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 Q9NWT1 PAK1IP1 0.86636 anatomical structure development GO:0048856
cell population proliferation GO:0008283
ribosome biogenesis GO:0042254
...
7 Q9Y324 FCF1 0.8658 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 Q8N257 H2BU1 0.86284 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
9 Q9BY42 RTF2 0.85705 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
10 O76021 RSL1D1 0.85619 cell death GO:0008219
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDD.D..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[K]:                     KsapvpKKgsKKainKaqKKdgKKrK                                                                     
RICH_[KP]:                PePvKsaPvPKKgsKKainK                                                                               
RICH_[KR]:                                       KdgKKRKRsR                                                                  
RICH_fLPS_[K]:                      KKgsKKainKaqKKdgKKrK                                                                     
RICH_MOBI_[PV]:           PePVksaPVP                                                                                         
RICH_MOBI_[K]:                KsapvpKKgsKKainKaqKKdgKKrKrsrK                                                                 
RICH_MOBI_[KR]:                                  KdgKKRKRsRK                                                                 
RICH_fLPS_MOBI_[K]:                 KKgsKKainKaqKKdgKKrKrsrK                                                                 

                                          120              
AA:                      LLLPGELAKHAVSEGTKAVTKYTSSK
STMI:                                              
DO_DISOPRED3:            .........................D
DO_IUPRED2A:             .................DDD..DD..
DO_SPOTD:                ....................DDDDDD
CONSENSUS:               ......................DDDD
CONSENSUS_MOBI:          ..........................