Q9NV29 TM100_HUMAN

Gene name: TMEM100
Protein name: Transmembrane protein 100

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- embryo development GO:0009790
- nervous system process GO:0050877
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5VTE0 EEF1A1P5 0.77788 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 Q8NI60 COQ8A 0.77658 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
3 Q9NXB9 ELOVL2 0.74269 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
4 Q9H6D3 XKR8 0.71635 anatomical structure development GO:0048856
cell death GO:0008219
membrane organization GO:0061024
...
5 P55263 ADK 0.71628 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
6 Q9BTE7 DCUN1D5 0.67737 cellular protein modification process GO:0006464
7 P17568 NDUFB7 0.66182 cellular component assembly GO:0022607
generation of precursor metabolites and energy GO:0006091
protein-containing complex assembly GO:0065003
8 Q71UI9 H2AZ2 0.65796 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
9 Q9NVR7 TBCCD1 0.65676 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
10 O43615 TIMM44 0.6264 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...

                                           20                  40                  60                  80                 100
AA:                      MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLL
STMI:                                                                           MMMMMMMMMMMMMMMMMMMMM       MMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD.............................                     .......                 
CONSENSUS_MOBI:          .......................................................                     .......                 
RICH_[AE]:                 EEpikEilgApkAhmAAtmE                                                                              
RICH_[AK]:                     KeilgApKAhmAAtmeKspK                                                                          
RICH_[AM]:                          ApkAhMAAtM                                                                               
RICH_[K]:                      KeilgapKahmaatmeKspK                                                                          

                                          120      
AA:                      ASSALCWKVRQRSKKAKRRESQTALVANQRSLFA
STMI:                    MMMM                              
DO_DISOPRED3:            ........................D.DDD.....
DO_IUPRED2A:             ..................................
DO_SPOTD:                ............DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                   ....................DDDDD.....
CONSENSUS_MOBI:              ..............................