Q9NV29 TM100_HUMAN
Gene name: TMEM100
Protein name: Transmembrane protein 100
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- embryo development GO:0009790
- nervous system process GO:0050877
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5VTE0 | EEF1A1P5 | 0.77788 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q8NI60 | COQ8A | 0.77658 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 3 | Q9NXB9 | ELOVL2 | 0.74269 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q9H6D3 | XKR8 | 0.71635 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 5 | P55263 | ADK | 0.71628 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 6 | Q9BTE7 | DCUN1D5 | 0.67737 | cellular protein modification process GO:0006464 |
| 7 | P17568 | NDUFB7 | 0.66182 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 8 | Q71UI9 | H2AZ2 | 0.65796 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 9 | Q9NVR7 | TBCCD1 | 0.65676 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 |
| 10 | O43615 | TIMM44 | 0.6264 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD............................. ....... CONSENSUS_MOBI: ....................................................... ....... RICH_[AE]: EEpikEilgApkAhmAAtmE RICH_[AK]: KeilgApKAhmAAtmeKspK RICH_[AM]: ApkAhMAAtM RICH_[K]: KeilgapKahmaatmeKspK
120 AA: ASSALCWKVRQRSKKAKRRESQTALVANQRSLFA STMI: MMMM DO_DISOPRED3: ........................D.DDD..... DO_IUPRED2A: .................................. DO_SPOTD: ............DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDD..... CONSENSUS_MOBI: ..............................