Q9UBX0 HESX1_HUMAN

Gene name: HESX1
Protein name: Homeobox expressed in ES cells 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13670 PMS2P11 0.76822 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
2 Q9NY64 SLC2A8 0.76822 carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
membrane organization GO:0061024
...
3 Q96LW7 CARD19 0.76822 signal transduction GO:0007165
4 Q9BZR9 TRIM8 0.72221 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q8N5N4 C3orf22 0.67981
6 O75147 OBSL1 0.67313 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
7 H3BNL1 C3orf84 0.67155
8 Q9BQI0 AIF1L 0.667 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
9 Q9UJ71 CD207 0.64397 immune system process GO:0002376
response to stress GO:0006950
transport GO:0006810
...
10 O95140 MFN2 0.6392 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDD.................................DD.........DD.D.........DDDDDDD.........D..............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD.D.D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[P]:                                                                              PnPPsgisfPsvvdhPmP                    
RICH_[EY]:                                                                                               EEraskYEnYfsasE     

                                          120                 140                 160                 180               
AA:                      RELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
STMI:                                                                                                         
DO_DISOPRED3:            DD..........................................................DDDDD......DDDDDDD...DDDD
DO_IUPRED2A:             .....................................................................................
DO_SPOTD:                DDDDDDDDD...................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD..........................................................DDDDD......DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................................................................