Citrus Sinensis ID: 000162
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1987 | 2.2.26 [Sep-21-2011] | |||||||
| B6SFA4 | 818 | Probable helicase MAGATAM | no | no | 0.133 | 0.323 | 0.370 | 2e-44 | |
| Q00416 | 2231 | Helicase SEN1 OS=Saccharo | yes | no | 0.130 | 0.116 | 0.378 | 3e-42 | |
| O94387 | 1944 | Uncharacterized ATP-depen | yes | no | 0.130 | 0.133 | 0.382 | 5e-42 | |
| Q8BV79 | 2999 | TPR and ankyrin repeat-co | yes | no | 0.229 | 0.152 | 0.295 | 1e-40 | |
| O15050 | 2925 | TPR and ankyrin repeat-co | yes | no | 0.236 | 0.160 | 0.298 | 8e-40 | |
| Q86AS0 | 967 | Probable helicase DDB_G02 | no | no | 0.130 | 0.268 | 0.349 | 8e-38 | |
| Q92355 | 1687 | Helicase sen1 OS=Schizosa | no | no | 0.131 | 0.155 | 0.353 | 3e-37 | |
| P30771 | 971 | ATP-dependent helicase NA | no | no | 0.133 | 0.272 | 0.355 | 4e-37 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.134 | 0.244 | 0.371 | 4e-37 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.133 | 0.211 | 0.358 | 2e-35 |
| >sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 182 bits (463), Expect = 2e-44, Method: Compositional matrix adjust.
Identities = 102/275 (37%), Positives = 156/275 (56%), Gaps = 10/275 (3%)
Query: 7 VVIDEAAQLKESESAIPLQLPCIQHAILVGDEVQLPAMVESSVSGEAYFGRSLFERLSYL 66
V+IDEAAQ E + IPL C Q LVGD QLPA V S+V+ ++ +G S+FERL
Sbjct: 487 VIIDEAAQAVEPATLIPLATRCKQ-VFLVGDPKQLPATVISTVAQDSGYGTSMFERLQKA 545
Query: 67 GHPKHLLSMQYRMHPSISFFPNSYFYENKIRDAPTVRKRSYEKRFLPGPMYGPYSFINVF 126
G+P +L QYRMHP I FP+ FYE + D + ++ + + +GP+ F ++
Sbjct: 546 GYPVKMLKTQYRMHPEIRSFPSKQFYEGALEDGSDIEAQT-TRDWHKYRCFGPFCFFDIH 604
Query: 127 GGREEFIEH-----SCRNMVEVSVVMKILRNLYKAWVESKEKLSIGIVSPYSAQVIAIQE 181
G+E +H S N+ EV V+ I L + E K + I+SPY+ QV ++
Sbjct: 605 EGKES--QHPGATGSRVNLDEVEFVLLIYHRLVTMYPELKSSSQLAIISPYNYQVKTFKD 662
Query: 182 KLGSKYEKIAGFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQRINVALTRAR 241
+ + A V + ++DGFQG E+D+ I S VR+N G IGF S +R+NV +TRA+
Sbjct: 663 RFKEMFGTEAEKVVDINTVDGFQGREKDVAIFSCVRANENGQIGFLSNSRRMNVGITRAK 722
Query: 242 HCLWILGSERTLNHSESVWESLLDDAKARQCFFNI 276
+ ++GS TL S+ +W++L++ A+ R F +
Sbjct: 723 SSVLVVGSAATLK-SDPLWKNLIESAEQRNRLFKV 756
|
Probable helicase that may regulate RNA molecules involved in nucleolar organization and pollen tube guidance. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BV79|TRNK1_MOUSE TPR and ankyrin repeat-containing protein 1 OS=Mus musculus GN=Trank1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|O15050|TRNK1_HUMAN TPR and ankyrin repeat-containing protein 1 OS=Homo sapiens GN=TRANK1 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1987 | ||||||
| 359473525 | 2792 | PREDICTED: uncharacterized protein LOC10 | 0.669 | 0.476 | 0.523 | 0.0 | |
| 255555527 | 2820 | conserved hypothetical protein [Ricinus | 0.672 | 0.473 | 0.526 | 0.0 | |
| 359473527 | 2788 | PREDICTED: uncharacterized protein LOC10 | 0.632 | 0.450 | 0.510 | 0.0 | |
| 356510822 | 2812 | PREDICTED: uncharacterized protein LOC10 | 0.667 | 0.471 | 0.476 | 0.0 | |
| 449445371 | 2710 | PREDICTED: uncharacterized protein LOC10 | 0.659 | 0.483 | 0.464 | 0.0 | |
| 297738288 | 2562 | unnamed protein product [Vitis vinifera] | 0.578 | 0.448 | 0.477 | 0.0 | |
| 359473531 | 2818 | PREDICTED: uncharacterized protein LOC10 | 0.624 | 0.440 | 0.458 | 0.0 | |
| 449526710 | 2474 | PREDICTED: uncharacterized protein LOC10 | 0.535 | 0.430 | 0.515 | 0.0 | |
| 297738290 | 6100 | unnamed protein product [Vitis vinifera] | 0.429 | 0.14 | 0.58 | 0.0 | |
| 224099651 | 1950 | predicted protein [Populus trichocarpa] | 0.315 | 0.321 | 0.659 | 0.0 |
| >gi|359473525|ref|XP_003631315.1| PREDICTED: uncharacterized protein LOC100265010 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1351 bits (3497), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 725/1385 (52%), Positives = 960/1385 (69%), Gaps = 54/1385 (3%)
Query: 589 LRQLFVTKFVLESRNTRNVERQEKGQLSDIFNLSQNFRTHVGVLNLAQSVIELLYRFFPH 648
+R LF +FV+ES + R+ R+EKGQ+S+IF+LSQNFRTH GVL L+QSVI+LLYRFFP
Sbjct: 1428 IRSLFYNEFVMESSDGRD-GRKEKGQISEIFHLSQNFRTHAGVLKLSQSVIDLLYRFFPQ 1486
Query: 649 SVDILKPETSLIYGEPPVLLESGNDENAIIKIFGNSGDAGGNMVGFGAEQVILVRDDCVR 708
S+D+L PETS IYGE PVLLE G DENAII +FGNS + GG+MVGFGAEQVILVRDDC R
Sbjct: 1487 SIDVLSPETSEIYGEAPVLLEPGKDENAIITMFGNSQNIGGSMVGFGAEQVILVRDDCSR 1546
Query: 709 KEISNYVGKQALVLTIVESKGLEFQDVLLYDFFGSSPLKNQWRVVYEYMKEQALLDSTLP 768
KEIS+YVG+QALVLTI+E KGLEFQDVLLY+FFGSSPLKNQWRVVYEYMKEQ LLDST P
Sbjct: 1547 KEISDYVGEQALVLTILECKGLEFQDVLLYNFFGSSPLKNQWRVVYEYMKEQNLLDSTAP 1606
Query: 769 ASFPSFNEAKHNVLCPELKQLYVAITRTRQRLWIWENMEEFSKPMFDYWKKRLLVQVRQL 828
S+PSF++ KHNV+C ELKQLYVAITRTRQRLWI EN+EE SKPMFDYWKK LVQV QL
Sbjct: 1607 RSYPSFSQEKHNVMCSELKQLYVAITRTRQRLWICENIEELSKPMFDYWKKLCLVQVTQL 1666
Query: 829 DDSLAQAMQVASSPEEWKSRGIKLFYENNYEMATICFEKAKDTYWEGRSKATGLKAASDH 888
D+SLA M+VAS+PEEWK+ GIKL E++YEMAT CFE+A+DTYW +KA GLKAA++
Sbjct: 1667 DESLANEMRVASTPEEWKATGIKLLREHHYEMATRCFERAEDTYWARLAKAHGLKAAAEQ 1726
Query: 889 IRSSNPLEANVILREAANIFEAIGKADSAAKCFYDLGEYERAGKIYEERCGKPELEKAGE 948
R NP A+V LR+AA IFE IG+A AAKCF+ L EYERAG+IY E+CG+ ELEKAGE
Sbjct: 1727 KRHLNPEAAHVDLRKAAEIFEEIGEARPAAKCFFQLNEYERAGRIYLEKCGESELEKAGE 1786
Query: 949 CFFLAGQYKHAAEVYARGNFFSECLAVCSRGELFDIGLQYINYWKQHVDTDVGLVRRSKE 1008
CF LA Y+ AAEVYARG+FFSECL+ C++G+ D+GL+YI+YWKQH T +++RSKE
Sbjct: 1787 CFSLAALYELAAEVYARGHFFSECLSACTKGKFLDMGLRYIHYWKQHATTSTFMIKRSKE 1846
Query: 1009 INKVEQDFLQSCALHYYQLNDKKSMMKFVKAFHSMDLMRNFLKSKSCFDELLVLEEEAGN 1068
I K+EQ+FL+SCA HY++L D + MM+FVKAFHSM+ RNFL + C DELL LEEE GN
Sbjct: 1847 IGKIEQEFLESCAHHYHELKDNRKMMEFVKAFHSMESKRNFLTTLDCLDELLRLEEELGN 1906
Query: 1069 FMDAANIARLTGDILLTADLLQKAGNFKEACNLTLNYVLSNSLWSPGSKGWPLKQFTEKK 1128
FM+AANIA+L+G+ILL A++L KAGN+++A L L YV +NSLW+ GS+GWPLKQF +K+
Sbjct: 1907 FMEAANIAKLSGEILLEAEMLGKAGNYRDASTLFLCYVFANSLWASGSRGWPLKQFVKKE 1966
Query: 1129 ELFEKAKSLAKSNSNQFYEFVCTEASILSNDESDLFIMNQQLNASKRHQSICGETLSARK 1188
EL KA+ ++ S QFYEFVC E SILSN+++ LF MNQ L+ S+RH+S+ GE LSARK
Sbjct: 1967 ELLTKARLFSERESKQFYEFVCMEVSILSNEQTSLFEMNQCLSTSQRHKSVRGEILSARK 2026
Query: 1189 ILDCHLKTNSCKYGWEDEFVLDLKAYSEETICRNWVTVQTLVYFWDYWKGMIVNVFEYLG 1248
I+D HL +N+ KY W DE+V DLK +SE + +N ++V+TL+YFW+ WK +VN+FE LG
Sbjct: 2027 IIDAHLNSNTTKYEWTDEWVSDLKQHSEVRLSQNCISVETLLYFWNVWKENVVNIFESLG 2086
Query: 1249 CLK-SQDANDYRSYGDFCLNYLGVWKQYDNLNTIYLLLNSDAEWVSTLDNRHAPRRGKLA 1307
+ +QD +Y SYG+FC NY GV KQ NLN I+ LL DA W+ +D+R R GKL
Sbjct: 2087 LDETTQDVKNYSSYGEFCFNYFGVRKQCKNLNLIHALLIPDANWLRAVDDRFIRRTGKLV 2146
Query: 1308 AINVHQLVSAGRSYWSSELLSVGMKVLGNLEALHKQLSKNSPTVFSQVLHLTCIYEVAKF 1367
++ Q SA RSYWSSELLSVG KVL NLE L+ + S ++F Q L ++EV++F
Sbjct: 2147 YVDADQFASAARSYWSSELLSVGTKVLENLEVLYNYSTWKSLSLFCQSKLLVHMFEVSEF 2206
Query: 1368 LLSSKYLNRRYYDEKILQKFVELSTEHFFDFIFPVDWRESLEMNMITLRGTESYRNIIEE 1427
LL K+L+ RY + LQKF+++ST F IFP+DW++S NM++LR TE RN++EE
Sbjct: 2207 LLKLKFLDLRYNAARTLQKFLDISTRQFCSKIFPLDWKKSSTENMVSLRETELSRNLLEE 2266
Query: 1428 VIFKNIGLKGIPSYGQIGTTVVMILGSGQLGNAVYQRVAKRLDENSPWKEFFESLSWNMG 1487
VI +I +K +YGQIG ILG G+L +Y+++A++ N PWK F ++LS N+G
Sbjct: 2267 VISTSISIKSEFTYGQIGRVASWILGMGKLTTELYEKIAEKFAVNPPWKAFIKNLSGNIG 2326
Query: 1488 SESCQESASYDNSDELKAVSHIWKFYGALVDTYRANWRGEDYITPANFLYLIERLLILLS 1547
S Q+S + S K VS + GAL DTY A W DYI+P FLYL++RLLIL++
Sbjct: 2327 SGFPQDSVPINESR--KHVSLVLTLDGALRDTYNAYWGQSDYISPGYFLYLVDRLLILVT 2384
Query: 1548 SLKGYIFTTKSSFVDWLIYQEGNTISTCSSLTEVQQFFGVVLDFVVTVVQNFIYKEREMI 1607
S +GY FTTKSS+++WLI+QE N+ + Q FG LD+V + Q+ +YK++ +
Sbjct: 2385 SFQGYCFTTKSSYIEWLIFQEWNSFPNPGLVANPQFPFGATLDYVAYIAQDLLYKKQVTV 2444
Query: 1608 EWIQKSHTKNKQYHSLVVLRLVVIISLLHLNFGGHS--LNLLIDLLGMSYIRNKLPWEFY 1665
EWI+KS+ +Y+ L+VLRLV+II LL +N H + +L LL I + LP +F
Sbjct: 2445 EWIRKSNINFNEYYPLLVLRLVIIICLLCVN-AKHEKYVEMLFGLLRRGDITSLLPRDFC 2503
Query: 1666 DALRRRRKRNL----LNVIAEAFKKIGNPLVLVSLGDNCPKFACPDAIFVDM-VTKRKED 1720
D L RRRKRN +NV+AEA +K+ NPLV+V L N + +CPDAIF+DM V + +ED
Sbjct: 2504 DVLWRRRKRNQFDISVNVLAEALRKVDNPLVIVKLQRNSSEVSCPDAIFIDMTVNQCRED 2563
Query: 1721 ILEILFPV-IEASRGHAGAAKMKATNLQSNVLYPDCYEQGKSSSISSSSAPVQDLEITTL 1779
+L +LF I +S ++ ++NL S V +QG L+
Sbjct: 2564 LLRVLFQRNINSSSIELPSSSNASSNLGSGV------DQG--------------LKSQND 2603
Query: 1780 EVKAGDLPVKLKQFWNIFEALEFEDNGIDTKTIVF--KSSTIKEDVKKSIQLLSAALDGC 1837
EV G+ + FW+ +A +D+ + F + +K +V+ +I+L+++ L
Sbjct: 2604 EVIGGNPQNNYEHFWDFLDA-------VDSSAMNFLPNAPRVKVEVENNIRLITSVL-AT 2655
Query: 1838 FQKNSFHGEDKSRWDEAARMLEDLKKLDAALDGVMSDWKHEHLSTLVEIYERLQSSRPKL 1897
F KN GED + E ML+DL++L +AL+ + S + E++ RL S RP++
Sbjct: 2656 FHKNPAEGEDVNLCQELNSMLDDLRQLSSALN------VSNNGSGIGELFIRLNSRRPRV 2709
Query: 1898 EPLLNLLFQQ----YINCKGKSLETGVASAGNVNVENTDSNADECSGSHEGKIIPTSATS 1953
EPLLN LF Q +N + S T + S V+ A+E + E S ++
Sbjct: 2710 EPLLNQLFLQKDSNSVN-EASSSATTIPSGIQNQVDKGTGKAEESEEADEVNTKTPSNSN 2768
Query: 1954 ASEAQ 1958
EA+
Sbjct: 2769 NREAE 2773
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255555527|ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359473527|ref|XP_002263192.2| PREDICTED: uncharacterized protein LOC100243095 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356510822|ref|XP_003524133.1| PREDICTED: uncharacterized protein LOC100802419 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449445371|ref|XP_004140446.1| PREDICTED: uncharacterized protein LOC101212468 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297738288|emb|CBI27489.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473531|ref|XP_002269567.2| PREDICTED: uncharacterized protein LOC100251075 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449526710|ref|XP_004170356.1| PREDICTED: uncharacterized protein LOC101229717 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297738290|emb|CBI27491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224099651|ref|XP_002311566.1| predicted protein [Populus trichocarpa] gi|222851386|gb|EEE88933.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1987 | ||||||
| TAIR|locus:2018561 | 1050 | AT1G65810 [Arabidopsis thalian | 0.227 | 0.430 | 0.513 | 1.8e-117 | |
| TAIR|locus:2018536 | 1065 | AT1G65780 [Arabidopsis thalian | 0.216 | 0.403 | 0.485 | 4.4e-106 | |
| TAIR|locus:2166173 | 839 | AT5G37150 [Arabidopsis thalian | 0.142 | 0.337 | 0.573 | 5.1e-84 | |
| TAIR|locus:2152627 | 638 | AT5G37030 [Arabidopsis thalian | 0.142 | 0.443 | 0.576 | 6e-83 | |
| TAIR|locus:2173033 | 676 | AT5G52090 [Arabidopsis thalian | 0.142 | 0.418 | 0.566 | 1.6e-82 | |
| TAIR|locus:2166183 | 871 | AT5G37160 [Arabidopsis thalian | 0.140 | 0.321 | 0.556 | 9.5e-80 | |
| TAIR|locus:2135472 | 689 | AT4G05540 [Arabidopsis thalian | 0.128 | 0.371 | 0.613 | 2e-79 | |
| TAIR|locus:2166163 | 692 | AT5G37140 [Arabidopsis thalian | 0.138 | 0.398 | 0.567 | 2.5e-79 | |
| UNIPROTKB|F1NFZ0 | 2477 | TRANK1 "Uncharacterized protei | 0.244 | 0.196 | 0.301 | 3.7e-49 | |
| UNIPROTKB|F1MVI7 | 2871 | TRANK1 "Uncharacterized protei | 0.245 | 0.169 | 0.300 | 9.6e-43 |
| TAIR|locus:2018561 AT1G65810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1144 (407.8 bits), Expect = 1.8e-117, Sum P(3) = 1.8e-117
Identities = 236/460 (51%), Positives = 310/460 (67%)
Query: 4 LKFVVIDEAAQLKESESAIPLQLPCIQHAILVGDEVQLPAMVESSVSGEAYFGRSLFERL 63
++ +VIDEAAQLKE ESAIPLQL +QHAIL+GDE QLPAM++S+++ EA GRSLFERL
Sbjct: 553 IQLLVIDEAAQLKECESAIPLQLRGLQHAILIGDEKQLPAMIKSNIASEADLGRSLFERL 612
Query: 64 SYLGHPKHLLSMQYRMHPSISFFPNSYFYENKIRDAPTVRKRSYEKRFLPGPMYGPYSFI 123
LGH K LL+MQYRMHPSIS FPN FY+ KI DAP+VR RSYEK+FLP MYGPYSFI
Sbjct: 613 VLLGHNKQLLNMQYRMHPSISIFPNREFYDMKILDAPSVRLRSYEKKFLPEKMYGPYSFI 672
Query: 124 NVFGGREEFIE-HSCRNMVEVSVVMKILRNLYKAWVESKEKLSIGIVSPYSAQVIAIQEK 182
N+ GRE+F E +S +N+VEVSVV +I+ LY ++ +S+G++SPY AQV AIQE+
Sbjct: 673 NIAYGREQFGEGYSSKNLVEVSVVAEIVSKLYSVSRKTGRTISVGVISPYKAQVFAIQER 732
Query: 183 LGSKYEKIAGFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQRINVALTRARH 242
+G KY F V V+S+DGFQGGEEDIIIISTVRSN G+IGF S QR NVALTRAR+
Sbjct: 733 IGEKYNTEGTFTVSVRSVDGFQGGEEDIIIISTVRSNGNGAIGFLSNQQRTNVALTRARY 792
Query: 243 CLWILGSERTLNHSESVWESLLDDAKARQCFFNIDEDKDLAKAIXXXXXXXXXXXXXXNP 302
CLWILG+E TL ++ SVW L+DDAKAR CF N +ED+ LA+ I N
Sbjct: 793 CLWILGNEATLTNNRSVWRQLVDDAKARNCFHNAEEDESLAQCIERSTTALDDLNKLQNK 852
Query: 303 GSILFRSERWKVNFSDNFLRSFKKLTSDRTKKSVINLLLKLSSGWRPKRRNVDSVSASSS 362
I F + WKV S FL+S + + K V++ L KLS+G K + + V S
Sbjct: 853 KLISFENSIWKVWLSYEFLKSLETIVDSEINKRVMSFLEKLSNG---KELHQE-VEFESE 908
Query: 363 HIIKQFKVE-GFYIISTTDIVKDVKESQYIQVLKVWDILPLEDVQKLVTRLDNIFVKYTD 421
++++Q + + G +I DI K+ +Q++QVLK+W +LP DV ++ L+ + +YT
Sbjct: 909 NLLRQHEFDDGLSLIWAIDIFKN--NNQHVQVLKIWQVLPSTDVSRVTEHLEKHYRRYTK 966
Query: 422 EFINLCKEKCFEGNLEVPKTWAVTSNIVRFKNLADNESGS 461
I+ C+ C +G+L VP W V SN K++ + S S
Sbjct: 967 GKISRCRYICSQGDLVVPMQWPVDSNSCSKKDIVSDVSRS 1006
|
|
| TAIR|locus:2018536 AT1G65780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166173 AT5G37150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152627 AT5G37030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173033 AT5G52090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166183 AT5G37160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135472 AT4G05540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166163 AT5G37140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NFZ0 TRANK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MVI7 TRANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1987 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 8e-73 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 2e-41 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 5e-39 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 9e-09 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 240 bits (616), Expect = 8e-73
Identities = 85/197 (43%), Positives = 115/197 (58%), Gaps = 6/197 (3%)
Query: 55 FGRSLFERLSYLG-HPKHLLSMQYRMHPSISFFPNSYFYENKIRDAPTVRKRSYEKRFLP 113
RSLFERL G +L QYRMHP IS FP+ FY K++D +V +R F
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 114 GPMYGPYSFINVFGGREEF-IEHSCRNMVEVSVVMKILRNLYKAWVESKEKLSIGIVSPY 172
GP FI+V G EE S N E +V++++ L K+ E + IGI++PY
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLKSGPEKNKD--IGIITPY 118
Query: 173 SAQVIAIQEKLGSKYEKIAGFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQR 232
AQV I++ L K+ ++V ++DGFQG E+D+II STVRSN G IGF S P+R
Sbjct: 119 RAQVRLIKKLLKRKFGG--EPDIEVNTVDGFQGREKDVIIFSTVRSNEKGGIGFLSDPRR 176
Query: 233 INVALTRARHCLWILGS 249
+NVALTRA+ L I+G+
Sbjct: 177 LNVALTRAKRGLIIVGN 193
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1987 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 99.98 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.91 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.91 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.86 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.85 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.85 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 99.8 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 99.77 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.77 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.75 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 99.74 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 99.69 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.68 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.67 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.6 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.57 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.56 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.56 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.55 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.53 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.52 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.45 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.41 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.41 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.39 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.33 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 99.29 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.25 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 99.2 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.19 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.09 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.01 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 98.93 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 98.92 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 98.88 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 98.85 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 98.81 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 98.79 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 98.78 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 98.78 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 98.73 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 98.71 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.71 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.71 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 98.71 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 98.7 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 98.62 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 98.62 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 98.61 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 98.57 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 98.55 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 98.51 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 98.5 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 98.37 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 98.36 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 98.36 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 98.32 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 98.31 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 98.29 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 98.28 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.26 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 98.24 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 98.19 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.14 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 98.12 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 98.1 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 98.08 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.06 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.02 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.98 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 97.94 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.94 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.87 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.86 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.83 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.82 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 97.77 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 97.76 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.76 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.72 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.7 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.68 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.62 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.62 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 97.6 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.57 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.57 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.56 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 97.54 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 97.54 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.54 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.52 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.51 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.5 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.5 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.42 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.38 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 97.35 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 97.31 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.31 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.29 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.28 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.23 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.21 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 97.12 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 97.11 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.01 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 96.98 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.95 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.95 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 96.88 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 96.83 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.81 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 96.76 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.75 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.74 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 96.74 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 96.74 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 96.71 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 96.71 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.45 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 96.38 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 96.36 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.28 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 96.24 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 96.23 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 96.15 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.11 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.04 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 95.9 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.86 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 95.82 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 95.74 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 95.64 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 95.62 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.61 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 95.58 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 95.43 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 95.38 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 95.3 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.26 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.22 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 95.2 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 95.16 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 95.07 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.02 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 94.93 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.87 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 94.87 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 94.51 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.51 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 94.44 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 94.39 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 94.26 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 94.25 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 94.05 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 93.98 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 93.93 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 93.9 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 93.73 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 93.62 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.61 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 93.58 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 93.57 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 93.47 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 93.43 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 93.38 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 93.31 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 93.3 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 93.1 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 93.08 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 92.86 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 92.85 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 92.85 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 92.85 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.83 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 92.75 | |
| PF05729 | 166 | NACHT: NACHT domain | 92.72 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 92.61 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 92.56 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 92.56 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 92.54 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.46 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 92.32 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 92.32 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 92.31 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 92.3 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 92.29 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 92.16 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 92.05 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.04 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.01 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 91.97 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 91.96 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 91.96 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 91.95 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 91.89 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 91.81 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.77 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 91.69 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 91.67 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 91.63 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 91.57 | |
| KOG2280 | 829 | consensus Vacuolar assembly/sorting protein VPS16 | 91.51 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 91.49 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 91.47 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 91.44 | |
| PRK06526 | 254 | transposase; Provisional | 91.37 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 91.33 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 91.16 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 91.15 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 91.12 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 91.12 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.11 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 91.01 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 90.92 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 90.88 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 90.85 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 90.77 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 90.66 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 90.62 | |
| PRK03839 | 180 | putative kinase; Provisional | 90.56 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 90.55 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 90.49 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 90.46 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 90.34 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 90.33 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 90.31 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 90.3 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 90.29 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 90.25 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 90.11 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 90.11 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 89.97 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 89.83 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 89.62 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 89.59 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 89.52 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 89.39 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 89.37 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 89.34 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 89.27 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 89.26 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.24 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 89.23 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 89.21 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 89.16 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 89.13 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 89.01 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 88.98 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 88.95 | |
| PLN02200 | 234 | adenylate kinase family protein | 88.94 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 88.93 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 88.86 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 88.75 | |
| PRK12377 | 248 | putative replication protein; Provisional | 88.74 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 88.7 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 88.68 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 88.67 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 88.61 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 88.55 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 88.52 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 88.48 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 88.46 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 88.43 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 88.41 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 88.41 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 88.27 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 88.25 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 88.23 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 88.21 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 88.18 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 88.15 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 88.15 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 88.04 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 88.02 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 87.99 | |
| PRK06217 | 183 | hypothetical protein; Validated | 87.99 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 87.99 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 87.95 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 87.94 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 87.92 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 87.85 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 87.79 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 87.78 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 87.72 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 87.69 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 87.67 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 87.66 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 87.65 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 87.64 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 87.62 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 87.6 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 87.55 | |
| PRK08181 | 269 | transposase; Validated | 87.5 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 87.49 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 87.36 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 87.36 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 87.35 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 87.34 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 87.29 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 87.28 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 87.28 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 87.26 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 87.13 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 87.1 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 87.08 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 86.97 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 86.91 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 86.88 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 86.88 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 86.86 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 86.78 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 86.72 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 86.68 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 86.67 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 86.6 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 86.58 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 86.55 | |
| PF04097 | 613 | Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 | 86.55 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 86.53 | |
| PF13173 | 128 | AAA_14: AAA domain | 86.5 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 86.48 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 86.47 | |
| PRK07667 | 193 | uridine kinase; Provisional | 86.45 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 86.36 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 86.34 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 86.24 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 86.14 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 86.01 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 86.0 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 85.97 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 85.97 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 85.93 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 85.92 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 85.86 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 85.8 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 85.8 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 85.8 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 85.79 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 85.79 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 85.77 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 85.73 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 85.71 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 85.71 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 85.7 | |
| KOG2280 | 829 | consensus Vacuolar assembly/sorting protein VPS16 | 85.69 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 85.62 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 85.57 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 85.46 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 85.41 | |
| PLN02422 | 232 | dephospho-CoA kinase | 85.37 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 85.35 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 85.3 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 85.28 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 85.27 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 85.24 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 85.21 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 85.2 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 85.12 | |
| PRK06620 | 214 | hypothetical protein; Validated | 85.09 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 85.09 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 85.06 | |
| PRK13695 | 174 | putative NTPase; Provisional | 85.01 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 85.0 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 84.96 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 84.88 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 84.76 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 84.72 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 84.68 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 84.65 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 84.62 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 84.5 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 84.41 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 84.32 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 84.31 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 84.21 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 84.14 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 84.09 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 84.08 | |
| PRK06696 | 223 | uridine kinase; Validated | 83.85 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 83.78 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 83.7 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 83.63 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 83.62 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 83.6 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 83.6 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 83.57 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 83.38 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 83.33 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 83.33 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 83.31 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 83.23 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 83.21 | |
| PHA02244 | 383 | ATPase-like protein | 83.21 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 83.2 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 83.16 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 83.15 | |
| PLN02674 | 244 | adenylate kinase | 83.07 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 83.0 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 82.96 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 82.96 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 82.94 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 82.93 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 82.9 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 82.81 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 82.78 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 82.77 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 82.76 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 82.7 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 82.69 | |
| KOG3079 | 195 | consensus Uridylate kinase/adenylate kinase [Nucle | 82.69 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 82.57 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 82.56 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 82.55 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 82.55 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 82.51 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 82.47 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 82.44 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 82.41 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 82.4 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 82.25 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 82.17 | |
| PRK13764 | 602 | ATPase; Provisional | 82.12 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 82.1 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 82.03 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 82.0 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 81.88 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 81.81 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 81.74 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 81.73 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 81.73 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 81.67 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 81.59 | |
| PLN02459 | 261 | probable adenylate kinase | 81.5 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 81.39 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 81.28 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 81.21 | |
| PF02689 | 818 | Herpes_Helicase: Helicase; InterPro: IPR003840 Thi | 81.18 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 81.11 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 81.06 | |
| PRK08116 | 268 | hypothetical protein; Validated | 81.05 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 81.03 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 81.02 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 80.97 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 80.92 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 80.89 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 80.78 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 80.77 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 80.67 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 80.64 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 80.6 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 80.6 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 80.56 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 80.53 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 80.43 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 80.41 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 80.41 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 80.39 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 80.31 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 80.25 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 80.22 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 80.22 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 80.16 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 80.15 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 80.14 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 80.12 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 80.08 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 80.03 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 80.03 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-51 Score=491.93 Aligned_cols=270 Identities=37% Similarity=0.515 Sum_probs=241.1
Q ss_pred CCCcEEEEecCCCCChhhHhhhccCCCcceEEEEecCCCCCcccccccccccccCccHHHHHHhCCCCceecccccCCCc
Q 000162 2 EQLKFVVIDEAAQLKESESAIPLQLPCIQHAILVGDEVQLPAMVESSVSGEAYFGRSLFERLSYLGHPKHLLSMQYRMHP 81 (1987)
Q Consensus 2 ~~fDlVIIDEASQ~~E~e~LipL~l~~~krlILVGD~kQLpPiV~s~~~~~~gl~~SLFeRL~~~g~p~~~L~~QYRmhP 81 (1987)
.+|..|+||||.|++||++++||.+ +++++||||||+||+|+++.+.+..+++.+|||+||+..|+.+++|.+||||||
T Consensus 567 ~kfr~VLiDEaTQatEpe~LiPlvl-G~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP 645 (935)
T KOG1802|consen 567 FKFRTVLIDEATQATEPECLIPLVL-GAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHP 645 (935)
T ss_pred ccccEEEEecccccCCcchhhhhhh-cceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeCh
Confidence 3689999999999999999999987 789999999999999999999999999999999999999999999999999999
Q ss_pred cccccccccccCCccccCccccccccccccCCCCCCC-CeEEEEeCCCcccc--cccccCCHHHHHHHHHHHHHHHHHhh
Q 000162 82 SISFFPNSYFYENKIRDAPTVRKRSYEKRFLPGPMYG-PYSFINVFGGREEF--IEHSCRNMVEVSVVMKILRNLYKAWV 158 (1987)
Q Consensus 82 ~Is~f~s~~FY~g~L~~~~~v~~~~~~~~~l~~p~~~-pl~fidV~~g~E~~--~~~S~~N~~Ea~~V~~lV~~L~~~~~ 158 (1987)
.|++|||..||+|.|.++-....+......+|.|... |+.|... .|.|+. .|+|+.|..||..+.++++.|++.+.
T Consensus 646 ~lSefpsn~fY~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~-~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv 724 (935)
T KOG1802|consen 646 ALSEFPSNMFYEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVC-YGQEEISASGTSFLNRTEAANCEKIITKLLKSGV 724 (935)
T ss_pred hhhhcchhhhccchhhcCcchhhhccCCCCCCCCCCCCccceEEe-ccceeeeccccceecHHHHHHHHHHHHHHHHcCC
Confidence 9999999999999999998877776665555544333 5555555 777765 78999999999999999999999875
Q ss_pred cccCCccEEEEccCHHHHHHHHHHhhhhhhccc--CccEEEeccCCCCCcccCEEEEEecccCCCCcccCCCCCCceEEe
Q 000162 159 ESKEKLSIGIVSPYSAQVIAIQEKLGSKYEKIA--GFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQRINVA 236 (1987)
Q Consensus 159 ~~~~~~sIgIITPY~aQv~~Ir~~L~~~~~~~~--~~~V~V~TVD~fQG~E~DVVIlS~Vrsn~~~~iGFL~d~nRLNVA 236 (1987)
.+..|||||||.+|+.+|-+.++..-.... ...|.|.|||+|||+|+|+||+||||++....|||+.|++|+|||
T Consensus 725 ---~~~qIGVITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVa 801 (935)
T KOG1802|consen 725 ---KPSQIGVITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVA 801 (935)
T ss_pred ---CHHHeeeecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhh
Confidence 678999999999999999998864321111 135799999999999999999999999999999999999999999
Q ss_pred cccccccEEEEcchhhhccCchHHHHHHHHHHhcCceeccC
Q 000162 237 LTRARHCLWILGSERTLNHSESVWESLLDDAKARQCFFNID 277 (1987)
Q Consensus 237 LTRAK~~LiIVGn~~~L~~s~~~W~~Ll~~ak~r~c~~~a~ 277 (1987)
+||||++|+||||+..|.++ ++|.+++.++++++|++..+
T Consensus 802 LTRaK~glvivGN~~~L~k~-~LW~~li~h~~eke~l~eg~ 841 (935)
T KOG1802|consen 802 LTRAKYGLVIVGNPKVLRKH-PLWGHLITHYKEKEVLVEGP 841 (935)
T ss_pred hhhcccceEEecCHHHhhhc-hHHHHHHHHhhcccceeecc
Confidence 99999999999999999995 99999999999999999865
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1987 | ||||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 4e-38 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 5e-36 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 6e-36 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 7e-36 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 4e-26 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 4e-26 |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
|
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
Score = 333 bits (855), Expect = 2e-97
Identities = 99/279 (35%), Positives = 149/279 (53%), Gaps = 11/279 (3%)
Query: 7 VVIDEAAQLKESESAIPLQLPCIQHAILVGDEVQLPAMVESSVSGEAYFGRSLFERLSYL 66
V+IDE+ Q E E IP+ + ILVGD QL ++ + +A +SLFERL L
Sbjct: 521 VLIDESTQASEPECLIPIVKGA-KQVILVGDHQQLGPVILERKAADAGLKQSLFERLISL 579
Query: 67 GHPKHLLSMQYRMHPSISFFPNSYFYENKIRDAPTVRKRSYEKRFLPGPMYG-PYSFINV 125
GH L +QYRM+P +S FP++ FYE +++ T+ +R+ P P+ G P F
Sbjct: 580 GHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVTIEQRTVPNSKFPWPIRGIPMMFWAN 639
Query: 126 FGGREEFIE--HSCRNMVEVSVVMKILRNLYKAWVESKEKLSIGIVSPYSAQVIAIQEKL 183
+ GREE S N +E +I+ L++ V+ + IG+++PY Q I + +
Sbjct: 640 Y-GREEISANGTSFLNRIEAMNCERIITKLFRDGVKPE---QIGVITPYEGQRAYILQYM 695
Query: 184 GSKYE--KIAGFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQRINVALTRAR 241
K V+V S+D FQG E+D II+S VR+N +IGF P+R+NV LTRA+
Sbjct: 696 QMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRANEQQAIGFLRDPRRLNVGLTRAK 755
Query: 242 HCLWILGSERTLNHSESVWESLLDDAKARQCFFNIDEDK 280
+ L ILG+ R+L + +W LL + + C D
Sbjct: 756 YGLVILGNPRSLARNT-LWNHLLIHFREKGCLVEGTLDN 793
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1987 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.85 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.67 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.64 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.58 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.53 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.52 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 99.48 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.46 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.37 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.33 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 99.32 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.29 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.28 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 99.25 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 99.2 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.14 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 99.13 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.08 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 98.97 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 98.85 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.84 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 98.83 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.52 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.5 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.47 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.47 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 98.38 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.36 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.36 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.33 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.28 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 98.27 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.26 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.24 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.24 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 98.23 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.23 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.23 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.2 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.13 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.08 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.05 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.02 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 98.01 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.98 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.97 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.96 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.95 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.95 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 97.92 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.92 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.92 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.89 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.89 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.86 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.85 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.85 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.84 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.8 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.79 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.77 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.76 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.76 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.73 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.63 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.62 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.6 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.57 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.55 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.52 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.51 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.51 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.49 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.45 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.45 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.45 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.4 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.37 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.33 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.3 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.28 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.25 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.24 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.24 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.15 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.02 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.01 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.99 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.99 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.96 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.94 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.94 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.84 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.79 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.78 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.73 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.73 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 96.69 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.61 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 96.49 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.45 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.44 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.39 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.32 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.31 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.28 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.26 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.26 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.22 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.21 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.15 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.14 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.05 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.05 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.02 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.0 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 95.86 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.84 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.84 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.84 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 95.75 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.73 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.71 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.71 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.69 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 95.65 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.64 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.6 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.36 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.23 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.21 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.05 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.01 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 94.88 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.79 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.76 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.73 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 94.73 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.69 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.68 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 94.68 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.61 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.59 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 94.57 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.52 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.51 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 94.5 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 94.36 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.35 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 94.31 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 94.29 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.19 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.13 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 94.0 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 93.98 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 93.88 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.82 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 93.75 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 93.69 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 93.5 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 93.48 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 93.38 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.3 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 93.23 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 93.21 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 92.98 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.98 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 92.95 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 92.91 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 92.86 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.84 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 92.84 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 92.8 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 92.79 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 92.77 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 92.76 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 92.69 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 92.6 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 92.54 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 92.52 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 92.51 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 92.44 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.42 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 92.35 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 92.25 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.22 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 92.21 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 92.14 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 92.11 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 92.03 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 91.99 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 91.94 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.88 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 91.85 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.85 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.81 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 91.79 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 91.79 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 91.75 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 91.73 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 91.7 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 91.69 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 91.65 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 91.61 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 91.56 | |
| 2qx5_A | 661 | Nucleoporin NIC96; mRNA transport, nuclear pore co | 91.34 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 91.33 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 91.28 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 91.25 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 91.21 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 91.18 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 91.18 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 91.17 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 91.15 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 91.14 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.13 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.09 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 91.06 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 91.03 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 91.03 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 91.01 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 90.97 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 90.91 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 90.89 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 90.85 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 90.81 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 90.74 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.74 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 90.74 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 90.63 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 90.6 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 90.6 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 90.6 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 90.59 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 90.58 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.56 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 90.54 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 90.52 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 90.5 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 90.42 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 90.41 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 90.4 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 90.36 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 90.36 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 90.22 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.19 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 90.13 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 90.13 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 90.11 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.09 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 90.08 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 90.03 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 90.0 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 89.92 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 89.87 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 89.78 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 89.77 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 89.64 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 89.6 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 89.56 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 89.53 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 89.46 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 89.45 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 89.44 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 89.41 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 89.39 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 89.38 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 89.31 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 89.28 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.21 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 89.19 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 89.14 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 89.13 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 89.05 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 88.96 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 88.92 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 88.88 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 88.87 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 88.8 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 88.69 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 88.67 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 88.66 | |
| 2pm7_A | 399 | Protein WEB1, protein transport protein SEC31; bet | 88.59 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 88.56 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 88.53 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 88.48 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 88.44 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 88.41 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 88.4 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 88.31 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 88.22 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 88.19 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 88.18 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 88.16 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 88.15 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 88.15 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.12 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 88.1 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 88.03 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 87.95 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 87.95 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 87.95 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 87.88 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 87.87 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 87.86 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 87.81 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 87.81 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 87.74 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 87.64 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 87.61 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 87.6 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 87.59 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 87.52 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 87.52 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 87.51 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 87.5 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 87.44 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 87.43 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 87.35 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 87.25 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 87.24 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.22 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 87.06 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 87.01 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.95 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 86.93 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 86.9 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 86.87 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 86.86 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 86.84 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 86.73 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 86.62 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 86.61 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 86.58 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 86.56 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.54 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 86.5 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 86.5 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 86.49 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 86.47 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 86.46 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 86.42 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 86.27 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 86.24 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 86.08 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 85.9 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 85.85 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 85.84 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 85.56 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 85.51 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 85.43 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 85.33 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 85.31 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 85.28 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 85.09 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 85.07 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 85.0 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 84.94 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 84.93 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 84.91 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 84.83 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 84.81 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 84.78 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 84.77 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 84.72 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 84.71 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 84.67 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 84.66 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 84.65 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 84.3 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 84.23 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 84.2 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 84.12 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 84.1 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 84.01 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 83.95 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 83.83 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 83.83 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 83.82 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 83.81 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 83.73 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 83.69 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 83.62 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 83.53 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 83.44 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 83.42 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 83.33 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 83.22 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 83.22 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 83.1 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 83.03 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 82.95 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 82.81 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 82.72 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 82.69 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 82.62 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 82.57 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 82.51 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 82.37 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 82.32 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 82.31 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 82.18 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 82.13 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 82.07 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 82.04 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 81.92 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 81.85 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 81.82 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 81.7 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 81.7 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 81.67 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 81.43 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 81.3 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 81.3 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 81.26 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 80.98 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 80.73 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 80.73 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 80.72 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 80.69 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 80.63 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 80.59 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 80.44 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 80.41 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 80.38 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 80.27 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 80.08 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 80.04 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.7e-46 Score=483.12 Aligned_cols=265 Identities=32% Similarity=0.400 Sum_probs=226.8
Q ss_pred CCCcEEEEecCCCCChhhHhhhccCCCcceEEEEecCCCCCcccccccccccccCccHHHHHHhC--CCCceecccccCC
Q 000162 2 EQLKFVVIDEAAQLKESESAIPLQLPCIQHAILVGDEVQLPAMVESSVSGEAYFGRSLFERLSYL--GHPKHLLSMQYRM 79 (1987)
Q Consensus 2 ~~fDlVIIDEASQ~~E~e~LipL~l~~~krlILVGD~kQLpPiV~s~~~~~~gl~~SLFeRL~~~--g~p~~~L~~QYRm 79 (1987)
..||+||||||+|++||++++|+. +++++||||||+||||++.+..+...+++.|+|+|+... +.+..+|++||||
T Consensus 365 ~~Fd~vIIDEAsQ~~e~~~lipL~--~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~L~~qYRm 442 (646)
T 4b3f_X 365 SYFDVVVIDECAQALEASCWIPLL--KARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRTLTVQYRM 442 (646)
T ss_dssp TCCSEEEETTGGGSCHHHHTTTGG--GSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEECCEESSS
T ss_pred ccCCEEEEcCccccchHHHHhhcc--ccceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeeecccccCC
Confidence 369999999999999999999985 468999999999999999998888899999999999864 4456789999999
Q ss_pred CccccccccccccCCccccCccccccccccc---cCCCCCCCCeEEEEeCCC----cccccccccCCHHHHHHHHHHHHH
Q 000162 80 HPSISFFPNSYFYENKIRDAPTVRKRSYEKR---FLPGPMYGPYSFINVFGG----REEFIEHSCRNMVEVSVVMKILRN 152 (1987)
Q Consensus 80 hP~Is~f~s~~FY~g~L~~~~~v~~~~~~~~---~l~~p~~~pl~fidV~~g----~E~~~~~S~~N~~Ea~~V~~lV~~ 152 (1987)
||+|+.|+|..||+|.|.+++.+..+..... ........|+.|+++.+. .+...+.|+.|..||..|..++..
T Consensus 443 hp~I~~f~n~~fY~g~L~~~~~~~~~~~~~lp~~~~~~~~~~p~~f~d~~g~~~~~~~~~~~~s~~N~~EA~~V~~~v~~ 522 (646)
T 4b3f_X 443 HQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDTAGCGLFELEEEDEQSKGNPGEVRLVSLHIQA 522 (646)
T ss_dssp CHHHHHHHHHHHSTTCCEECTTTTTCCGGGSTTCCCCTTTTCSEEEEECTTSSCCCCC-----CCCCHHHHHHHHHHHHH
T ss_pred cHHHHhhhHHhhcCCccccCcchhhhhhccccccccccccCCceEEEecCCCccccccccCCccccCHHHHHHHHHHHHH
Confidence 9999999999999999998887655432211 111122348999999543 223367899999999999999999
Q ss_pred HHHHhhcccCCccEEEEccCHHHHHHHHHHhhhhhhcccCccEEEeccCCCCCcccCEEEEEecccCCCCcccCCCCCCc
Q 000162 153 LYKAWVESKEKLSIGIVSPYSAQVIAIQEKLGSKYEKIAGFAVKVKSIDGFQGGEEDIIIISTVRSNNTGSIGFASTPQR 232 (1987)
Q Consensus 153 L~~~~~~~~~~~sIgIITPY~aQv~~Ir~~L~~~~~~~~~~~V~V~TVD~fQG~E~DVVIlS~Vrsn~~~~iGFL~d~nR 232 (1987)
|++.+. ++.+|||||||++|+.+|++.|.+.+ ..++|+|||+|||+|+|+||+|+||++..+.+||+.|+||
T Consensus 523 L~~~gv---~~~dIgVItpYraQ~~~l~~~l~~~~-----~~i~v~TVd~fQG~E~dvII~S~vrsn~~~~iGFl~~~rR 594 (646)
T 4b3f_X 523 LVDAGV---PARDIAVVSPYNLQVDLLRQSLVHRH-----PELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRR 594 (646)
T ss_dssp HHHHTC---CGGGEEEEESCHHHHHHHHHHHTTTC-----TTCEEEEGGGGTTCCEEEEEEECCCCCTTCCCCSTTCHHH
T ss_pred HHhcCC---CcCcEEEECCCHHHHHHHHHHHHHhC-----CCCEECChhhcccccCCEEEEEeccCCCCCCccccCCcCc
Confidence 998764 56799999999999999999997643 3589999999999999999999999999999999999999
Q ss_pred eEEecccccccEEEEcchhhhccCchHHHHHHHHHHhcCceeccC
Q 000162 233 INVALTRARHCLWILGSERTLNHSESVWESLLDDAKARQCFFNID 277 (1987)
Q Consensus 233 LNVALTRAK~~LiIVGn~~~L~~s~~~W~~Ll~~ak~r~c~~~a~ 277 (1987)
+|||+||||++||||||..+|.++ +.|+.++++++++|++..+-
T Consensus 595 lNVAlTRAk~~liivGn~~~l~~~-~~~~~li~~~~~~g~~~~~~ 638 (646)
T 4b3f_X 595 INVAVTRARRHVAVICDSRTVNNH-AFLKTLVEYFTQHGEVRTAF 638 (646)
T ss_dssp HHHHHHTEEEEEEEEECHHHHTTS-HHHHHHHHHHHHSSEEEEGG
T ss_pred EEeEhhhhhCeEEEEEchHHhcCC-HHHHHHHHHHHHCCCEeeHH
Confidence 999999999999999999999875 89999999999999998753
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1987 | ||||
| d1w36b2 | 395 | c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta | 0.001 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 0.001 |
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 395 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V beta chain (RecB), N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 41.5 bits (96), Expect = 0.001
Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
Query: 704 DDCVRKEISNYVGKQALVLTIVESKGLEFQDVLLYDFFGSSPLKNQWRVVYEYMKEQALL 763
+ ++ ++TI +SKGLE+ V L ++ + ++ +A+L
Sbjct: 236 NASSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFI--TNFRVQEQAFYHDRHSFEAVL 293
Query: 764 DSTLPASFPSFNEAKHNVLCPELKQLYVAITRTRQRLWIW 803
D L A+ S + A+ L +L+ LYVA+TR+ +
Sbjct: 294 D--LNAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLG 331
|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1987 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.64 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.85 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 98.65 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.61 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.59 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.58 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.58 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.5 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.39 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.25 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.22 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 98.05 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.98 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.91 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.86 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.63 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.6 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.46 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.13 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.0 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.96 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 96.9 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.89 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 96.89 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 96.82 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.65 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.4 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.31 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.24 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 96.23 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.06 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.01 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 95.99 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.94 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.92 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 95.88 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.86 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.62 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.61 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 95.61 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 95.47 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.44 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.06 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.01 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.01 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.99 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.98 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 94.8 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.79 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.72 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.63 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 94.58 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.56 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.46 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.42 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 94.39 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 94.24 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.23 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.12 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.08 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.06 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.05 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 93.98 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.88 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 93.83 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 93.81 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.8 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 93.8 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 93.74 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 93.72 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 93.67 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 93.56 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 93.45 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.43 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.41 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.41 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.39 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.35 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 93.3 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 93.29 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.28 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.21 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.2 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.17 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.98 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 92.97 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 92.81 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.55 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.51 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.29 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.18 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 92.15 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 92.15 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.07 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 91.9 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.78 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.59 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 91.46 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 91.4 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.31 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 91.2 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 90.98 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.98 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 90.73 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 90.57 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.51 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.29 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 89.97 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 89.86 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 89.75 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 89.57 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.44 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 89.14 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.05 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 88.83 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 88.82 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 88.41 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.21 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 87.8 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 87.39 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 87.04 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 87.0 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 86.89 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 86.74 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 86.58 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 86.52 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 86.38 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.26 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 85.9 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 85.87 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 85.44 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 85.23 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 85.13 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 85.02 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 84.46 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 84.31 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 83.91 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 83.91 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 83.78 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 83.74 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 83.66 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 83.51 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 83.44 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 83.3 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 83.29 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 83.18 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.1 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 82.7 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 82.63 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 82.55 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 82.37 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 82.27 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 82.21 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 82.19 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 82.03 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 81.77 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 81.2 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 81.16 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 80.57 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 80.25 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 80.06 |
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|