Citrus Sinensis ID: 000170
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1950 | 2.2.26 [Sep-21-2011] | |||||||
| Q0P5W1 | 1427 | Vacuolar protein sorting- | yes | no | 0.572 | 0.782 | 0.234 | 4e-91 | |
| Q8N3P4 | 1428 | Vacuolar protein sorting- | yes | no | 0.572 | 0.781 | 0.238 | 4e-88 | |
| P39702 | 1274 | Vacuolar protein sorting- | yes | no | 0.077 | 0.119 | 0.202 | 1e-09 |
| >sp|Q0P5W1|VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus GN=Vps8 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 338 bits (866), Expect = 4e-91, Method: Compositional matrix adjust.
Identities = 325/1387 (23%), Positives = 577/1387 (41%), Gaps = 270/1387 (19%)
Query: 431 ITQTIASQAFRRDHGSPQVLAVHPSFIAVGMSKGAIVVVPGKYSAHHRDSMDSKMMMLGL 490
I+ I S A + D G P +AV S IAVG S G ++ D +
Sbjct: 141 ISAQIVSAADKVDAGLPTAIAV-SSLIAVGTSHGLALI------------FDQNQALRLC 187
Query: 491 LGDRSPA----PVTAMCFNQPGDLLLAGYADGHVTVWDVQRASAAKVITGEHT--SPVVH 544
LG S ++A+ N LL G+A G +T+WD+ + IT H + ++H
Sbjct: 188 LGSTSVGGQYGAISALSINNDCSRLLCGFAKGQITMWDLASGKLLRSITDAHPPGTAILH 247
Query: 545 TLFLGQDSQVTRQFKAVTGDTKGLVQLHSLSVVPLLNRFSIKTQCLLDGQKTGIVLSASP 604
F + A+ D+ G V L+ ++ + +++CL G K
Sbjct: 248 IKFTDDPT------LAICNDSGGSV--FELTFKRVMGVRTCESRCLFSGSK--------- 290
Query: 605 LLFDESCGGAPLSSQGNSTASASSIGSMMGGVVGSDTGWKLFNEGSSLVEEGVVIFVTYQ 664
E C PL S+ + S++ +
Sbjct: 291 ---GEVCCIEPLHSKPELKDHPITQFSLLA-------------------------MASLT 322
Query: 665 TALVVRLTPTLEVYAQIP--RPDGVREGAMPYTAWKCMTTCRSSTTESIPTEAAERVSLL 722
LV+ L P+L+V+ P R D ++P AW +S + + V L
Sbjct: 323 KILVIGLKPSLKVWMTFPYGRMD---PSSVPLLAWH-FVAVNNSVNPMLAFCRGDMVHFL 378
Query: 723 AIAWDRKVQVAKLVKSELKVYGKWSLDSAAIGVAWLDDQMLVVLTLLGQLYLYARDGTVI 782
+ D + + L +Y + L I W++ + +V+L + +L++ R
Sbjct: 379 LVKRDESGAIHVTKQKHLHLY--YDL----INFTWINSRTVVLLDSVEKLHVIDRQTQEE 432
Query: 783 HQTSFAVDGSQGYDLVGYRSYFTNVFGN--------PEKSYHNCVSVRGASIYVLGPMHL 834
+T + Y+ ++S T GN EK+ + +S G I+ LG +
Sbjct: 433 LETMEISEVQLVYNSSHFKSLATG--GNVSQALALVGEKACYQSISSYGGQIFYLGTKSV 490
Query: 835 VVSRLLPWKERIQVLRKAGDWMGALNMAMTLYDGQAHGVIDLPRTLDAVQEAIMPYLVEL 894
V L W+ER+ L K AL +A + ++G+A V+ L + + + +VE+
Sbjct: 491 YVMMLRSWRERMDHLLKQDCLTEALALAWSFHEGKAKAVVGLSGDVSKRKAVVADRMVEI 550
Query: 895 LLSYVDEVFSYISVAFCNQIEKLAQLNNPQSRSSTVHAEIKEQFTRVGGVAVEFCVHINR 954
L Y D P V +++ F V V++C+ + R
Sbjct: 551 LFHYADRALK----------------KCPDQGKIQV---MEQHFQDTVPVIVDYCLLLQR 591
Query: 955 TDILFDDIFSKF-EAVQHRDTFLELLEPYILKDMLGSLPPEIMQALVEHYSSKGWLQRVE 1013
D+LF ++ K E + FLE LEPYIL D L + P++M+ L+ H+ K L+ VE
Sbjct: 592 KDLLFGQMYDKLSENSVAKGVFLECLEPYILSDKLVGITPQVMKDLIVHFQDKKLLENVE 651
Query: 1014 QCVLHMDISSLDFNQVVRLCREHGLHGALVYLFNKGLDDFRAPLEELLVVLR------NS 1067
++HMDI+SLD QVV +C E+ L+ A+VY++N+G+++F +P+E+L V+ +
Sbjct: 652 ALIVHMDITSLDIQQVVLMCWENRLYDAMVYVYNRGMNEFISPMEKLFKVIAPPLNAGKT 711
Query: 1068 ERESAYALGYRMLVYLKYCFKGLAFPPGHGTLPSTRLPSLRAELVQFLLEESDAQNSQAA 1127
+ +G ++LVY+ C G A+P G +P +P ++ ++ +FL+ + S
Sbjct: 712 LTDEQVVMGNKLLVYISCCLAGRAYP--LGDIPEDLVPLVKNQVFEFLIRLHSVEASSE- 768
Query: 1128 SSLLLKGSYLNLYHLLELDTEATLDVLRCAFIEVETPKSDFYACDMADTNAEPNNGNKMV 1187
+ Y + LL DT L+VL F DF +K
Sbjct: 769 -----EEVYPYVRTLLHFDTREFLNVLALTF-------EDF-------------KNDKQA 803
Query: 1188 AEYQNMLVQNTVNALVHILDEDISSTDGSASKDDSGSVEAWPSTKDIGHIFEFIACYVAS 1247
EYQ Q V+ L+ ++ + ++D + S+ +G +F F+A +A
Sbjct: 804 VEYQ----QRIVDILLKVM---VENSDFTPSQ--------------VGCLFTFLARQLAK 842
Query: 1248 GRAT--VSKSVLSQILQYLTSEKNVPQSILSHIETSKRREKQLLALLEAVPETDWNASEV 1305
T V++++ Q+L++L S P H E R++ LL LL+A + S +
Sbjct: 843 PDNTLFVNRTLFDQVLEFLCS----PDDDSRHSE----RQQVLLELLQAGGIVQFEESRL 894
Query: 1306 LHLCENAHFYQVCGLIHTIRYNYLAALDSYMKDVDEPICAFSFIHDTL--LQLTDNEYTA 1363
+ + E A FYQ+C ++ + Y +D Y+ D F++IH+ L + E +
Sbjct: 895 IRMAEKAEFYQICEFMYEREHQYDKIIDCYLHDPLREEEVFNYIHNILSIPGHSAEEKQS 954
Query: 1364 FHSAVISRIPELICLSREATFFLVIDQFNDEASHILSELRSHPKSLFLYLKTVVEVHLHG 1423
++ + EL+ L LV F+++ ++ +L++ LF +L+++++
Sbjct: 955 VWQKAMNHMEELVSLKPCKAAELVATHFSEQIEVVIGQLQNQ-LLLFKFLRSLLD----- 1008
Query: 1424 TLNLSYLRKDDTLDVANCKWVKYQSKGLGAYIERISDLPKFLSSNAVHVTDDMIELYLEL 1483
+G+ E + P H+T E ++EL
Sbjct: 1009 -----------------------PREGVHVNQELLQIPP--------HIT----EQFIEL 1033
Query: 1484 LCRYERDSVLKFLETFDSYRVEYCLRLCQEYGITDAAAFLLERVGDVGSALLLTLSELND 1543
LC++ D V++ L+ + YR+E +++ Q+Y + + A+LLE+ GD A LL L L
Sbjct: 1034 LCQFSPDQVIQTLQVLECYRLEETIQITQKYQLHEVTAYLLEKKGDAHGAFLLLLERLQS 1093
Query: 1544 KFAALETAVGSALPIAVSNGSVSVEHFSTVLNMEEVNDVNNILRACIGLCQRNTPRLNPE 1603
+ + + + G V + + I LCQRN+ LN +
Sbjct: 1094 RLQEMTRQDENTKEDILLKG------------------VEDTMVETIALCQRNSQNLNQQ 1135
Query: 1604 ESEVLWFKLLDSFCEPLMGSFVERASERENHSRMLEESFGSQEDAEACIIKWRISKSHRG 1663
+ E LWF LL++ P ++S S
Sbjct: 1136 QREALWFPLLEAMMTP-----------------------------------QKLSSSAAA 1160
Query: 1664 SHILRKLFSQFIKEIVEGMIGYVHLPTIMSKLLSD--NGSQEFGDFKLTILGMLGTYSFE 1721
H + +++ M ++ LP+I+ ++L D G + G+ + ILGML T+++E
Sbjct: 1161 PHPHCEALKSLTMQVLNSMAAFIALPSILQRILQDPIYGKGKLGEIQGLILGMLDTFNYE 1220
Query: 1722 RRILDTAKSLIEDDTFYTMSVLKKEASHGYAPRSLLCCIC-NCLLTKNSSSFQIRVFNCG 1780
+ +L+T SL+ D +++ L+ S G P+ C IC + + +I VF+CG
Sbjct: 1221 QTLLETTASLLNQDLHWSLCNLRASVSRGLNPKQDYCSICLQQYKRRQEMADEIIVFSCG 1280
Query: 1781 HATHIQC 1787
H H C
Sbjct: 1281 HLYHSFC 1287
|
Mus musculus (taxid: 10090) |
| >sp|Q8N3P4|VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens GN=VPS8 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P39702|VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS8 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1950 | ||||||
| 224128047 | 1976 | predicted protein [Populus trichocarpa] | 0.953 | 0.941 | 0.672 | 0.0 | |
| 296089008 | 1934 | unnamed protein product [Vitis vinifera] | 0.980 | 0.988 | 0.685 | 0.0 | |
| 359489473 | 1979 | PREDICTED: vacuolar protein sorting-asso | 0.978 | 0.964 | 0.673 | 0.0 | |
| 255548033 | 1899 | conserved hypothetical protein [Ricinus | 0.955 | 0.981 | 0.674 | 0.0 | |
| 356560233 | 1880 | PREDICTED: vacuolar protein sorting-asso | 0.953 | 0.989 | 0.619 | 0.0 | |
| 449432994 | 1936 | PREDICTED: vacuolar protein sorting-asso | 0.963 | 0.970 | 0.598 | 0.0 | |
| 449478249 | 1936 | PREDICTED: LOW QUALITY PROTEIN: vacuolar | 0.963 | 0.970 | 0.597 | 0.0 | |
| 356522472 | 1886 | PREDICTED: vacuolar protein sorting-asso | 0.831 | 0.859 | 0.679 | 0.0 | |
| 334186260 | 1913 | transducin family protein / WD-40 repeat | 0.949 | 0.967 | 0.570 | 0.0 | |
| 218189960 | 1926 | hypothetical protein OsI_05666 [Oryza sa | 0.903 | 0.914 | 0.497 | 0.0 |
| >gi|224128047|ref|XP_002320230.1| predicted protein [Populus trichocarpa] gi|222861003|gb|EEE98545.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 2569 bits (6658), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1347/2004 (67%), Positives = 1568/2004 (78%), Gaps = 144/2004 (7%)
Query: 1 MTKELQDTKSLMELDVDSFLNSHLSSDSDDEFNSVPHRTLDEILNDSESSTSPSS----- 55
MTK+L TK MELD+DSFLNSH +SDSD + SVPHRTLDEILNDS+SS+ PSS
Sbjct: 1 MTKKLTSTKLPMELDLDSFLNSHSTSDSDTDNTSVPHRTLDEILNDSDSSSPPSSPPSIK 60
Query: 56 ----PTSSIHHSDTSLAKPQPQGDGVSSQDKPTPKPGSFHRVKSNELSGDPIWRVPPSSS 111
P S + H+ + + Q Q QD+ KP S R+ ++ WR+PP SS
Sbjct: 61 QSDLPPSYLQHAVSLDSSTQSQ----ILQDQL--KPTSLTRITNSP------WRLPPPSS 108
Query: 112 RQLPSLFGGVRSTAKPGAALAAAAAASRSVPTPHAAAIKSRR--AGSGTLLKVLD----- 164
RQLPSLFGGVRS AKPGAALAAAAAASRSVPTPHAAAIKSRR +GSGT +LD
Sbjct: 109 RQLPSLFGGVRSNAKPGAALAAAAAASRSVPTPHAAAIKSRRLSSGSGTFQTILDIAESG 168
Query: 165 ---GDDHEIASVSSNEISVSSEKLEGDAELIGDFQSAQVN--VSGELSSLASSRDVDT-- 217
G DHEI S SSN S+ + + + ++ G FQSA + L SR+ +
Sbjct: 169 SSGGGDHEIVSNSSNGDSIERFQSQSEEKMGGLFQSATAENAIPNTEEDLKISRESEGEP 228
Query: 218 --KLESEVSNVDDE----FLNTSSNLNTDQLIGCSPRVVVKDLNLREKSIIASSDDANDI 271
++E EV DD NT S N+D +LNL DD N
Sbjct: 229 VFQIEGEVRLGDDSGQDMLHNTGSTANSD-----------ANLNL---------DDEN-- 266
Query: 272 DGNRIVAPVTADDDSMFLEVNASTESSVVPLNESDRTGLMEENLEIPTLEMESSDKSMST 331
A V+ D F+EV+ S+E ++ LN D +E ++ E + +++M
Sbjct: 267 -----AACVSKDK---FVEVSDSSEVDIINLNNVD--SFKDEAVKG---EGNNLEENMDE 313
Query: 332 SQDDEVGV---DGSNDASSIDDISELVEERIGQLESEITSRRAEKKVQPSLKPLELAEEL 388
+DD VGV D +DASS+ DISELVEERI QLESE+ S+RAEKK + SLKPLELAEEL
Sbjct: 314 VKDDGVGVFTIDDGDDASSMSDISELVEERIEQLESEMISKRAEKKRKSSLKPLELAEEL 373
Query: 389 EKKQASTGLHWKEGAAAQPMRLEGVRRGSTTLGYFDVDANNTITQTIASQAFRRDHGSPQ 448
EKK A TGLHW+EGAAAQPMRLEGVRRGST+LGYFDVD++N ITQT+ SQ FRRDHGSPQ
Sbjct: 374 EKKMAYTGLHWEEGAAAQPMRLEGVRRGSTSLGYFDVDSHNVITQTVGSQTFRRDHGSPQ 433
Query: 449 VLAVHPSFIAVGMSKGAIVVVPGKYSAHHRDSMDSK----------------MMMLGLLG 492
VLAVH ++IAVGMSKG IVVVP +YS+H+ D+MD+K M+MLGL G
Sbjct: 434 VLAVHLNYIAVGMSKGVIVVVPSRYSSHNDDNMDAKWMSLPFVFLLLLKDGKMLMLGLQG 493
Query: 493 DRSPAPVTAMCFNQPGDLLLAGYADGHVTVWDVQRASAAKVITGEHTSPVVHTLFLGQDS 552
DRS APVT+MCFNQ GD+LLAGY DGH+TVWDVQRASAAKVITGEHT+PVVH FLGQDS
Sbjct: 494 DRSHAPVTSMCFNQQGDMLLAGYGDGHITVWDVQRASAAKVITGEHTAPVVHAFFLGQDS 553
Query: 553 QVTRQFKAVTGDTKGLVQLHSLSVVPLLNRFSIKTQCLLDGQKTGIVLSASPLLFDESCG 612
QVTRQFKAVTGD+KGLV LH+ SVVPLLNRFS KTQCLLDGQ+TG VLSASPLL DESCG
Sbjct: 554 QVTRQFKAVTGDSKGLVLLHAFSVVPLLNRFSFKTQCLLDGQRTGTVLSASPLLLDESCG 613
Query: 613 GAPLSSQGNSTASASSIGSMMGGVVGSDTGWKLFNEGSSLVEEGVVIFVTYQTALVVRLT 672
GA ++QGNS+AS++SI SMMGGVVG D GWKLFNEGSSLVEEGVVIFVT+QTALVVRL+
Sbjct: 614 GALPATQGNSSASSTSISSMMGGVVGGDAGWKLFNEGSSLVEEGVVIFVTHQTALVVRLS 673
Query: 673 PTLEVYAQIPRPDGVREGAMPYTAWKCMTTCRSSTTESIPTEAAERVSLLAIAWDRKVQV 732
P+L+VYAQ+ RPDGVREG+MPYTAWKC T SS+ +++P AERVSLLAIAWDRKVQV
Sbjct: 674 PSLQVYAQLSRPDGVREGSMPYTAWKCTTQSHSSSPDNVPEHVAERVSLLAIAWDRKVQV 733
Query: 733 AKLVKSELKVYGKWSLDSAAIGVAWLDDQMLVVLTLLGQLYLYARDGTVIHQTSFAVDGS 792
AKLVKSELKVYGKWSLDSAAIGVAWLDD MLVVLTL GQLYL+A+DGTVIHQTSFAVDGS
Sbjct: 734 AKLVKSELKVYGKWSLDSAAIGVAWLDDHMLVVLTLTGQLYLFAKDGTVIHQTSFAVDGS 793
Query: 793 QGYDLVGYRSYFTNVFGNPEKSYHNCVSVRGASIYVLGPMHLVVSRLLPWKERIQVLRKA 852
+G DL Y ++ N++GNPEK+YHNC+ VRGAS+Y+LGP HL+VSRLLPWKERIQVLR+A
Sbjct: 794 RGDDLAAYHTHLINIYGNPEKAYHNCIGVRGASVYILGPTHLIVSRLLPWKERIQVLRRA 853
Query: 853 GDWMGALNMAMTLYDGQAHGVIDLPRTLDAVQEAIMPYLVELLLSYVDEVFSYISVAFCN 912
GDWMGALNMAMTLYDGQAHGV+DLP+++DAV+EAIMPYLVELL+SYVDEVFSYISVAFCN
Sbjct: 854 GDWMGALNMAMTLYDGQAHGVVDLPKSVDAVKEAIMPYLVELLMSYVDEVFSYISVAFCN 913
Query: 913 QIEKLAQLNNPQSRSSTVHAEIKEQFTRVGGVAVEFCVHINRTDILFDDIFSKFEAVQHR 972
QI K Q ++ ++ S++VH+EIKEQFTRVGGVAVEFCVHI RTDILFD+IFSKF VQHR
Sbjct: 914 QIGKAEQQDDSKTGSNSVHSEIKEQFTRVGGVAVEFCVHIQRTDILFDEIFSKFVFVQHR 973
Query: 973 DTFLELLEPYILKDMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVVRL 1032
DTFLELLEPYIL+DMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVVRL
Sbjct: 974 DTFLELLEPYILRDMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVVRL 1033
Query: 1033 CREHGLHGALVYLFNKGLDDFRAPLEELLVVLRNSERESAYALGYRMLVYLKYCFKGLAF 1092
CREHGL+GALVYLFNKGLDDFR PLEELLVV R S++E+A ALGYRMLVYLKYCF GLAF
Sbjct: 1034 CREHGLYGALVYLFNKGLDDFRTPLEELLVVSRTSQQETAAALGYRMLVYLKYCFLGLAF 1093
Query: 1093 PPGHGTLPSTRLPSLRAELVQFLLEESDAQNSQAASSLLLKGSYLNLYHLLELDTEATLD 1152
PPGHG LP TRL SLR ELVQFLLE SDA N QA S KG+YLNLYHLL+LDTEATLD
Sbjct: 1094 PPGHGALPVTRLSSLRTELVQFLLESSDASNPQAVS----KGTYLNLYHLLQLDTEATLD 1149
Query: 1153 VLRCAFIEVETPKSDFYACDMADTNAEPNNGNKMVAEYQNMLVQNTVNALVHILDEDISS 1212
VLRCAF++ E K +F D ADT+ E N ++AE QN+ +QNT+NALV I ++ IS
Sbjct: 1150 VLRCAFLDGENLKREFSMQDGADTSMEAKQENNIMAESQNLWIQNTINALVQITEKHISR 1209
Query: 1213 TDGSASKD-DSGSVEAWPSTKDIGHIFEFIACYVASGRATVSKSVLSQILQYLTSEKNVP 1271
D SA + D+ V+AWPS KD+ ++FEFIA +VA +A VSK VLSQIL+YLTSE VP
Sbjct: 1210 ADESAVDNVDTRFVDAWPSKKDLENLFEFIAYHVACRKAHVSKVVLSQILEYLTSESTVP 1269
Query: 1272 QSILSH-IETSKRREKQLLALLEAVPETDWNASEVLHLCENAHFYQVCGLIHTIRYNYLA 1330
S+ +H IETSK REKQ+LALLE VPETDWN S VL LCE AHF+QVCGLIHTIR+ YLA
Sbjct: 1270 PSVPAHIIETSKEREKQVLALLEVVPETDWNESYVLQLCEKAHFHQVCGLIHTIRHQYLA 1329
Query: 1331 ALDSYMKDVDEPICAFSFIHDTLLQLTDNEYTAFHSAVISRIPELICLSREATFFLVIDQ 1390
ALDSYMKD+DEPI F++I++ L +L+DN+ AF SAVISRIPEL+ LSRE TFFLV D
Sbjct: 1330 ALDSYMKDIDEPIHTFAYINNMLEKLSDNDSGAFRSAVISRIPELLVLSREGTFFLVTDH 1389
Query: 1391 FNDEASHILSELRSHPKSLFLYLKTVVEVHLHGTLNLSYLRKDDTLDVANCKWVKYQSKG 1450
F E+ HILSELRSHP+SLFLYLKTV+EVHL GTL+ S L+K D +DVA+ + VK QSKG
Sbjct: 1390 FRVESPHILSELRSHPQSLFLYLKTVIEVHLSGTLDFSNLKKADDIDVADGRRVKDQSKG 1449
Query: 1451 LGAYIERISDLPKFLSSNAVHVTDDMIELYLELLCRYERDSVLKFLETFDSYRVEYCLRL 1510
L AY+ERISD PKF+ +N VHV DDMIELY ELLC++ER+SVL+FL TFDSYRVE+CLR
Sbjct: 1450 LTAYLERISDFPKFMRNNPVHVNDDMIELYFELLCQFERNSVLRFLGTFDSYRVEHCLRK 1509
Query: 1511 CQEYGITDAAAFLLERVGDVGSALLLTLSELNDKFAALETAVGSALPIAVSNGSVSV--E 1568
CQEYGI DAAAFLLERVGD GSALLLTLS LND F LE+AV S VS+ SVS +
Sbjct: 1510 CQEYGIIDAAAFLLERVGDAGSALLLTLSGLNDNFPELESAVES----VVSDMSVSASSD 1565
Query: 1569 HFSTVLNMEE----------VNDVNNILRACIGLCQRNTPRLNPEESEVLWFKLLDS--- 1615
H+STVL ++E V+++ +IL ACIGLCQRNTPRL PEESE+LWF+LLDS
Sbjct: 1566 HYSTVLKLKEVDRFMEFYDMVDNIRSILNACIGLCQRNTPRLQPEESEMLWFRLLDSTSI 1625
Query: 1616 ------------------FCEPLMGSFVE-RASERENHSRMLEESFGSQEDAEACIIKWR 1656
FC PLM S+ + RAS+ +N+ +L E GSQED A +IKW+
Sbjct: 1626 KKSKSLVTMQNINKLSMMFCVPLMDSYSDRRASKAKNYGGVLGEVLGSQEDDGAWVIKWK 1685
Query: 1657 ISKSHRGSHILRKLFSQFIKEIVEGMIGYVHLPTIMSKLLSDNGSQEFGDFKLTILGMLG 1716
IS+S +G+H LRKLFS FIKEIVEGMIGY+ LPTIMSKLLSDNGSQEFGDFK+TILGMLG
Sbjct: 1686 ISRSCKGAHSLRKLFSMFIKEIVEGMIGYIRLPTIMSKLLSDNGSQEFGDFKITILGMLG 1745
Query: 1717 TYSFERRILDTAKSLIEDDTFYTMSVLKKEASHGYAPRSLLCCICNCLLTKNSSSFQIRV 1776
TY FERRILDTAKSLIEDDTFYTMS+LKK ASHGYAPRS +CCICNC L KN SSF+IRV
Sbjct: 1746 TYGFERRILDTAKSLIEDDTFYTMSLLKKGASHGYAPRSTVCCICNCPLAKN-SSFRIRV 1804
Query: 1777 FNCGHATHIQCELLENESSSKSNLSGCPLCMPKKNTQR-SRNKTVLAESGLVSKFSSRPQ 1835
F+CGHATH+ CE LENESSS+ +LSGCP+CMPKKNTQR +RNK+ L E+GLV+K S+RP+
Sbjct: 1805 FSCGHATHLDCE-LENESSSRGHLSGCPVCMPKKNTQRGARNKSALPENGLVNKVSARPR 1863
Query: 1836 QSLGTT-LHSHESDTSDYSNGIQQLSRFEILNNLRKDQRVVQIENMPQLRLAPPAIYHEK 1894
++ GT+ LH HE D + S G+QQ+SRFEIL++L+KD+++VQIE+MPQLRLAPPA+YHEK
Sbjct: 1864 RAHGTSILHPHE-DLLENSYGLQQISRFEILSSLQKDKKLVQIESMPQLRLAPPAVYHEK 1922
Query: 1895 VKKGTDLLMGESSRGLLETEKASK 1918
VKKG DLL GESS L E EK K
Sbjct: 1923 VKKGPDLLTGESSSALAEVEKPGK 1946
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296089008|emb|CBI38711.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489473|ref|XP_002267626.2| PREDICTED: vacuolar protein sorting-associated protein 8 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255548033|ref|XP_002515073.1| conserved hypothetical protein [Ricinus communis] gi|223545553|gb|EEF47057.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356560233|ref|XP_003548398.1| PREDICTED: vacuolar protein sorting-associated protein 8 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449432994|ref|XP_004134283.1| PREDICTED: vacuolar protein sorting-associated protein 8 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449478249|ref|XP_004155263.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated protein 8 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356522472|ref|XP_003529870.1| PREDICTED: vacuolar protein sorting-associated protein 8 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|334186260|ref|NP_567189.6| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|332656536|gb|AEE81936.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|218189960|gb|EEC72387.1| hypothetical protein OsI_05666 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1950 | ||||||
| DICTYBASE|DDB_G0291606 | 1751 | vps8 "WD40 repeat-containing p | 0.227 | 0.252 | 0.298 | 2.1e-92 | |
| UNIPROTKB|E1BPY6 | 1428 | VPS8 "Uncharacterized protein" | 0.115 | 0.157 | 0.315 | 9.8e-75 | |
| ZFIN|ZDB-GENE-060503-348 | 1412 | vps8 "vacuolar protein sorting | 0.125 | 0.172 | 0.312 | 2.7e-74 | |
| MGI|MGI:2146407 | 1427 | Vps8 "vacuolar protein sorting | 0.115 | 0.157 | 0.340 | 1.2e-73 | |
| UNIPROTKB|C9JJN9 | 1428 | VPS8 "Vacuolar protein sorting | 0.115 | 0.157 | 0.323 | 1.2e-73 | |
| UNIPROTKB|Q8N3P4 | 1428 | VPS8 "Vacuolar protein sorting | 0.115 | 0.157 | 0.323 | 1.6e-73 | |
| UNIPROTKB|J9P2S0 | 1426 | VPS8 "Uncharacterized protein" | 0.115 | 0.157 | 0.327 | 1.9e-73 | |
| UNIPROTKB|F1PI72 | 1431 | VPS8 "Uncharacterized protein" | 0.115 | 0.157 | 0.327 | 5e-73 | |
| UNIPROTKB|F1NZZ7 | 1323 | VPS8 "Uncharacterized protein" | 0.115 | 0.170 | 0.344 | 1.1e-68 | |
| RGD|1309443 | 1352 | Vps8 "vacuolar protein sorting | 0.115 | 0.166 | 0.331 | 1.3e-62 |
| DICTYBASE|DDB_G0291606 vps8 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 532 (192.3 bits), Expect = 2.1e-92, Sum P(5) = 2.1e-92
Identities = 149/500 (29%), Positives = 252/500 (50%)
Query: 685 DGVREGAMPYTAWKCMTTCRSSTTESIPTEAAERVSLLAIAWDRKVQVAKLVKS------ 738
+G GA+PY +W+ + RS + P E +LAI W +Q+ ++V +
Sbjct: 510 EGGSGGALPYLSWRRVIYNRS-LGHTKPLEP-----ILAIGWGTSIQLLQIVTAPNDFKF 563
Query: 739 ---ELKVYGKWSLDSAAIGVAWLDDQMXXXXXXXXXXXXXARDGTVIHQTSFAVDGSQGY 795
E V + D G+ WLD Q ++D + FA++ +
Sbjct: 564 QAPEFIVVANYQTDHTICGLEWLDSQ--------TILFQNSKDELRVFDP-FALEEVESV 614
Query: 796 DLVGYRSYFTNVF-GNPEKSYHNCVSVRGASIYVLGPMHLVVSRLLPWKERIQVLRKAGD 854
++ + + + G S+H+ + + IY LG L + +L W ER+ +L G
Sbjct: 615 NIKSMQLIHHSKYQGISVYSFHSSIKTLKSRIYFLGLNGLFTAHILTWIERLSILTTNGQ 674
Query: 855 WMGALNMAMTLYDGQAHGVIDLP-RTLDAVQEAIMPYLVELLLSYVDEVFSYISVAFCNQ 913
W AL +A+ Y+G+A L T+D+ + +VE++ + +F+ Q
Sbjct: 675 WFEALCLALDFYEGKAKACTGLSSNTVDS-KYITSEKIVEIISNLCQSIFNI------TQ 727
Query: 914 IEKLAQLNN-PQSRSSTVHAEIK--EQFTRVGGVAVEFCVHINRTDILFDDIFSKFEAVQ 970
E LA + P+S + I+ + ++ +++EFC+ I RTD+LF ++F+ F
Sbjct: 728 PELLAGKSLIPKSYYQQMDPRIEYLNIYQQLALISIEFCIAIKRTDLLFGEVFNYFFDND 787
Query: 971 HRDTFLELLEPYILKDMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVV 1030
+ L+ LEPYIL D L L PE+MQ ++ +Y G L R EQCVLH+DISS+DF+Q V
Sbjct: 788 MKSCILDFLEPYILNDRLTHLNPEVMQYMMTYYQDLGILVRAEQCVLHLDISSIDFHQTV 847
Query: 1031 RLCREHGLHGALVYLFNKGLDDFRAPLEELLVV------LRNSERE---SAYALGYRMLV 1081
LCR+HGL+ AL+YL+NKGL+D+ P+E+++ V L N E ++ ++ R+L+
Sbjct: 848 VLCRKHGLYSALIYLYNKGLNDYITPMEDMMEVVIKPNNLNNQPTEMDKNSKSVAQRLLL 907
Query: 1082 YLKYCFKGLAFPPGHGTLPSTRLPSLRAELVQFL-LEESDAQNSQAASSLLLKGSYLNLY 1140
YL+ G +FP G + +R+ SL++E+ ++L L D + Y +Y
Sbjct: 908 YLQLSLSGKSFPSG--LIAPSRVLSLKSEIYEYLFLWNIDPDDPTP---------YPRIY 956
Query: 1141 HLLELDTEATLDVLRCAFIE 1160
+LL++DT L +L F +
Sbjct: 957 NLLKMDTTELLKILSLGFYD 976
|
|
| UNIPROTKB|E1BPY6 VPS8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-348 vps8 "vacuolar protein sorting 8 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2146407 Vps8 "vacuolar protein sorting 8 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JJN9 VPS8 "Vacuolar protein sorting-associated protein 8 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N3P4 VPS8 "Vacuolar protein sorting-associated protein 8 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2S0 VPS8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PI72 VPS8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZZ7 VPS8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1309443 Vps8 "vacuolar protein sorting 8 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1950 | |||
| pfam12816 | 193 | pfam12816, Vps8, Golgi CORVET complex core vacuola | 6e-68 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 7e-05 | |
| pfam00637 | 143 | pfam00637, Clathrin, Region in Clathrin and VPS | 2e-04 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 3e-04 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.002 |
| >gnl|CDD|221788 pfam12816, Vps8, Golgi CORVET complex core vacuolar protein 8 | Back alignment and domain information |
|---|
Score = 226 bits (579), Expect = 6e-68
Identities = 78/193 (40%), Positives = 119/193 (61%), Gaps = 8/193 (4%)
Query: 973 DTFLELLEPYILKDMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVVRL 1032
FLE+LEPYIL + SLPPE+++AL+E+Y+SKG L+R+E+ + H+DIS+LD +QVV+L
Sbjct: 2 GIFLEVLEPYILDGRIRSLPPEVVKALIEYYASKGNLERLEELICHLDISTLDIDQVVKL 61
Query: 1033 CREHGLHGALVYLFNKGLDDFRAPLEELLVVLRNSERESA------YALGYRMLVYLKYC 1086
C++HGL+ AL+Y++N+ L+D+ PL ELL ++RN + + A Y++ YL Y
Sbjct: 62 CKKHGLYDALIYVWNRALNDYVTPLVELLKLIRNLPNKGSILDDDEVANAYKIFPYLSYI 121
Query: 1087 FKGLAFPPGHGTLPSTRLPSLRAELVQFLLEESDAQNSQAASSLLLKG-SYLNLYHLLEL 1145
G +P G +P +AEL +FL + + LL ++ L LL+
Sbjct: 122 LTGRQYPTGEA-IPEDEALRAKAELYRFLFSGTSIPWPPGSGKKLLTEPAFPYLRLLLKF 180
Query: 1146 DTEATLDVLRCAF 1158
DTE+ L VL AF
Sbjct: 181 DTESFLSVLNEAF 193
|
Vps8 is one of the Golgi complex components necessary for vacuolar sorting. Eukaryotic cells contain a highly dynamic endo-membrane system, in which individual organelles keep their identity despite continuous vesicle generation and fusion. Vesicles that bud from a donor membrane are targeted and delivered to each individual organelle, where they release their cargo after fusion with the acceptor membrane. Vps8 is the core component of the endosomal tethering complex CORVET (class C core vacuole/endosome tethering). Vps8 co-operates with Vps21-GTP to mediate endosomal clustering in a reaction that is dependent on Vps3. Vps8 is the only CORVET subunit that is enriched on late endosomes, suggesting that it is a marker for the maturation of late endosomes. Late endosomes form intralumenal vesicles, and the resulting multivesicular bodies fuse with the vacuole to release their cargoes. Length = 193 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1950 | |||
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 100.0 | |
| PF12816 | 196 | Vps8: Golgi CORVET complex core vacuolar protein 8 | 100.0 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 100.0 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 99.94 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.42 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 99.42 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.33 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.33 | |
| KOG2063 | 877 | consensus Vacuolar assembly/sorting proteins VPS39 | 99.32 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.32 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.25 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.24 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 99.18 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.18 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.16 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.16 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 99.13 | |
| PTZ00421 | 493 | coronin; Provisional | 99.12 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.11 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.09 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.08 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.08 | |
| PTZ00420 | 568 | coronin; Provisional | 99.07 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.06 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.04 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.01 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 98.99 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 98.99 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 98.98 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 98.97 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 98.95 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 98.94 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 98.94 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 98.94 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 98.93 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 98.93 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 98.93 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 98.9 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 98.88 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 98.88 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 98.88 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 98.87 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 98.86 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 98.86 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 98.85 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 98.83 | |
| PTZ00421 | 493 | coronin; Provisional | 98.83 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 98.82 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 98.81 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 98.8 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 98.79 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 98.79 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 98.78 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 98.74 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 98.71 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 98.7 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 98.69 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 98.69 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 98.68 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 98.67 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 98.67 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 98.64 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 98.64 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 98.61 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 98.61 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 98.6 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 98.59 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 98.59 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 98.58 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 98.58 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 98.58 | |
| PTZ00420 | 568 | coronin; Provisional | 98.56 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 98.55 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 98.55 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 98.54 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 98.54 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 98.54 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 98.54 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 98.51 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.5 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 98.5 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 98.49 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 98.48 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 98.47 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 98.46 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 98.46 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 98.45 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 98.44 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 98.44 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 98.39 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 98.37 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 98.36 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 98.35 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 98.34 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 98.33 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 98.32 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 98.31 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 98.31 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 98.3 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 98.29 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 98.29 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 98.28 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.28 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 98.28 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 98.27 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 98.27 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 98.26 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 98.23 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 98.23 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 98.21 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 98.21 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 98.2 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 98.19 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 98.17 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 98.17 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 98.15 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 98.12 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 98.1 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 98.1 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 98.09 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 98.07 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 98.07 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 98.06 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 98.05 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 98.04 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 98.04 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 98.03 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.99 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 97.99 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 97.97 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 97.96 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 97.95 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 97.94 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 97.94 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 97.93 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 97.92 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 97.9 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 97.89 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 97.86 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 97.85 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 97.84 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 97.83 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 97.83 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 97.82 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 97.82 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 97.81 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 97.81 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 97.81 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 97.8 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 97.8 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 97.79 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 97.79 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 97.78 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 97.78 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 97.77 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 97.77 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 97.76 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 97.75 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 97.75 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 97.73 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 97.72 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 97.68 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 97.66 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 97.66 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 97.66 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 97.66 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 97.64 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 97.63 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 97.63 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 97.62 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 97.59 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 97.57 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.56 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 97.54 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 97.53 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 97.51 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 97.5 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 97.48 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 97.45 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 97.44 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 97.43 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 97.41 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 97.4 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 97.36 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 97.34 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 97.31 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 97.3 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 97.27 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 97.23 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 97.22 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 97.2 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 97.19 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 97.18 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 97.17 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 97.15 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 97.12 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 97.12 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 97.02 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 97.01 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 97.01 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 96.96 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 96.92 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 96.9 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 96.88 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.84 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 96.83 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 96.83 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 96.82 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 96.81 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 96.81 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 96.77 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 96.76 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 96.76 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 96.75 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 96.72 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 96.69 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 96.69 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 96.68 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 96.66 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 96.62 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 96.59 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 96.57 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 96.49 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 96.45 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 96.39 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.39 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 96.36 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 96.26 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 96.18 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 96.12 | |
| PF08596 | 395 | Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; | 96.08 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 96.08 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.08 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 96.08 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 96.04 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 95.86 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 95.83 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 95.78 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 95.7 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 95.69 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 95.69 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 95.53 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 95.47 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 95.46 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 95.41 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 95.38 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 95.34 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 95.34 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 95.15 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 95.12 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 95.11 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 94.99 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 94.97 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 94.94 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 94.94 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.9 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.73 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 94.68 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 94.65 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 94.61 | |
| PF10366 | 108 | Vps39_1: Vacuolar sorting protein 39 domain 1; Int | 94.44 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 94.38 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 94.29 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 94.28 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 94.27 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 94.26 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 94.19 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 94.18 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 93.91 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 93.9 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 93.82 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 93.8 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 93.79 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 93.73 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 93.54 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 93.47 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 93.3 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 93.25 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 93.2 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 93.18 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 93.17 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 93.13 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 93.09 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 93.07 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 93.05 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 92.93 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 92.61 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 92.25 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 92.08 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 91.98 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 91.92 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 91.91 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 91.84 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 91.8 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 91.73 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 91.71 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 91.68 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 90.94 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 90.92 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 90.92 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 90.9 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 90.79 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 90.69 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 90.66 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 90.63 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 90.53 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 90.5 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 90.26 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 90.0 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 89.61 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 89.56 | |
| PF12816 | 196 | Vps8: Golgi CORVET complex core vacuolar protein 8 | 89.53 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.53 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 89.51 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 89.38 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 89.06 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 88.39 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 87.93 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 87.71 | |
| PF12341 | 27 | DUF3639: Protein of unknown function (DUF3639) ; I | 87.41 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 87.36 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 87.18 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 87.1 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 86.97 | |
| PF08596 | 395 | Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; | 86.93 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 86.36 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 86.3 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 86.23 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 85.9 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 85.8 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 85.58 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 85.43 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 85.35 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 84.85 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 84.81 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 84.76 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 84.71 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 84.64 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 84.41 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.33 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 83.91 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 83.75 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 82.51 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 82.41 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.39 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 82.04 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 81.8 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 81.44 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 80.67 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 80.59 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 80.53 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 80.45 |
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-95 Score=909.58 Aligned_cols=1112 Identities=23% Similarity=0.299 Sum_probs=784.0
Q ss_pred HHHHhhhhhhhhhHhhhhccCCCCChhhHHHHHHHhhhccCCCccccccCccccccccccCcceeeeEEecCChhHHHHh
Q 000170 356 EERIGQLESEITSRRAEKKVQPSLKPLELAEELEKKQASTGLHWKEGAAAQPMRLEGVRRGSTTLGYFDVDANNTITQTI 435 (1950)
Q Consensus 356 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iS~~i 435 (1950)
|+|.+..+++++.+++-.+.. .-... -.+..++|||++|++ .|+ -+..+.++...+.-..+|..+
T Consensus 2 ese~g~~~~~l~n~~~~~~ed-l~d~e--------~~~~p~~d~e~a~d~-----fG~-v~~~t~~~~~~~ds~~~s~~~ 66 (1206)
T KOG2079|consen 2 ESEYGRSSLKLKNGDDTRTED-LSDSE--------DSVNPSFDNEFASDT-----FGI-VAIHTSNRPFRQDSMSISDGI 66 (1206)
T ss_pred chhhhcchhhhhcCcccchhh-hhhhh--------hcCCchhhhhhhhcc-----ccc-ccccCCCCCCCcccccccccc
Confidence 556666666666655544422 11122 223448999998876 555 455555555555555555555
Q ss_pred hhccccccCCCcE--------------EEEEcCCEEEEEeCCCcEEEEeCCCCCCccCcccceeeeecccCCCCCCCeEE
Q 000170 436 ASQAFRRDHGSPQ--------------VLAVHPSFIAVGMSKGAIVVVPGKYSAHHRDSMDSKMMMLGLLGDRSPAPVTA 501 (1950)
Q Consensus 436 ~s~~f~~~~G~pt--------------~ia~s~~~IAvGts~G~I~vfd~k~~~~~~d~~~~k~~~l~~~~~~h~~~Vts 501 (1950)
.++.+.+.+|.+. +.++-+.+||+||++|+|+.+|+.++ +++..+++..+++|||
T Consensus 67 ~~~~~i~~H~q~~~l~~~~e~~~~~v~s~a~~~~~ivi~Ts~ghvl~~d~~~n-----------L~~~~~ne~v~~~Vts 135 (1206)
T KOG2079|consen 67 SSQFFIRRHGQPQVLAVHLEDIAAGVISSAIVVVPIVIGTSHGHVLLSDMTGN-----------LGPLHQNERVQGPVTS 135 (1206)
T ss_pred ccceeeccccchhhhHhhccCCCcceeeeeeeeeeEEEEcCchhhhhhhhhcc-----------cchhhcCCccCCccee
Confidence 5554444444432 23333467999999999999998542 1222355667899999
Q ss_pred EEEcCCCCEEEEecCCCcEEEEECCCCceeeeeccCcCCCeEEEEEecCCCccCCceEEEEecCCceEEEEccccccccc
Q 000170 502 MCFNQPGDLLLAGYADGHVTVWDVQRASAAKVITGEHTSPVVHTLFLGQDSQVTRQFKAVTGDTKGLVQLHSLSVVPLLN 581 (1950)
Q Consensus 502 LafS~DG~~LasG~~dG~I~lWDl~~g~~l~tl~~~H~~~I~~v~F~~d~~~~~~~~~~vssD~~G~V~~h~ft~~rl~~ 581 (1950)
+|||.||++|+.|+.+|.|.+||+.+++.++.+. .|+.++++|-|++-. ++...++++|.+|.+|.|.|+ .++++
T Consensus 136 vafn~dg~~l~~G~~~G~V~v~D~~~~k~l~~i~-e~~ap~t~vi~v~~t---~~nS~llt~D~~Gsf~~lv~n-k~~L~ 210 (1206)
T KOG2079|consen 136 VAFNQDGSLLLAGLGDGHVTVWDMHRAKILKVIT-EHGAPVTGVIFVGRT---SQNSKLLTSDTGGSFWKLVFN-KALLN 210 (1206)
T ss_pred eEecCCCceeccccCCCcEEEEEccCCcceeeee-ecCCccceEEEEEEe---CCCcEEEEccCCCceEEEEec-hhhhc
Confidence 9999999999999999999999999999999886 666555555444321 134589999999999999998 44889
Q ss_pred ceeeeEEeecCCCccccEEEeecccccccCCCCCCCCCCCCcccccccccccccccccCCcccccccCCCcccccEEEEE
Q 000170 582 RFSIKTQCLLDGQKTGIVLSASPLLFDESCGGAPLSSQGNSTASASSIGSMMGGVVGSDTGWKLFNEGSSLVEEGVVIFV 661 (1950)
Q Consensus 582 ~~t~~s~~ll~g~~~g~Vla~spLp~~~~~gs~~~~~~gn~~~~t~~~~~~~~~vv~~~s~~k~~~~~~s~~~~glVAl~ 661 (1950)
+++++++|+++| ..|+|++.+|+|. +.+|. .+.+.| ++|++.
T Consensus 211 ~~~~kskcl~sg-~~g~Vis~s~i~~-e~l~~---------------------------~~v~hf---------~~v~L~ 252 (1206)
T KOG2079|consen 211 MNTDKSKCLLSG-KNGEVISASPISD-ENLGS---------------------------LLVSHF---------GFVSLV 252 (1206)
T ss_pred ccchHHHHhhcC-CCCceEecccCCc-chhhh---------------------------hheeee---------eEEEee
Confidence 999999999999 9999999999983 22221 111222 678999
Q ss_pred eccEEEEEEeccCceeeeeccCCCCCCCCCCCccccceeecccCCCCCCCcccccccceeEEEEEcCeeEEEEeeecc--
Q 000170 662 TYQTALVVRLTPTLEVYAQIPRPDGVREGAMPYTAWKCMTTCRSSTTESIPTEAAERVSLLAIAWDRKVQVAKLVKSE-- 739 (1950)
Q Consensus 662 T~~~~~IV~l~P~~~v~~k~~rP~~v~~~slp~laW~~~~~~~~~~~~~~~~~~~~~~~~LA~aWgn~l~vl~~~k~~-- 739 (1950)
++++ ||.+.| .+-++ .+|+ ++++.++|....+.-. .......++.|+++||++.|+.+..++
T Consensus 253 p~~s--Ivt~fP-i~f~~--q~pP----a~v~~~~~~s~~ins~-------~ts~e~~~~ia~s~nNkL~v~sI~~sn~~ 316 (1206)
T KOG2079|consen 253 PLSS--IVTLFP-IKFMY--QKPP----AGVVGSGSHSKLINSD-------STSVEEDVVIAASYNNKLVVKSIPNSNFY 316 (1206)
T ss_pred cccc--eeeecc-eEEEE--ecCC----Cceeccccceeeeecc-------ccccccceEEEEEeCCeEEEEEEecccce
Confidence 9888 999999 44444 4453 5677778877654311 111235579999999999998875443
Q ss_pred --eeEeeEEeccccceeeeeccCCeEEEEeecCeEEEEecCCeEEEEeccccCCCCccccccccc-cccc--ccCCC---
Q 000170 740 --LKVYGKWSLDSAAIGVAWLDDQMLVVLTLLGQLYLYARDGTVIHQTSFAVDGSQGYDLVGYRS-YFTN--VFGNP--- 811 (1950)
Q Consensus 740 --~~~~~~~~~~~~I~~l~WLs~~iL~vLt~s~~L~l~d~~~~~i~~t~~~~D~s~~~Dll~~~~-~f~~--~~~n~--- 811 (1950)
+....+-++..+|.+++|+.+..++.+..-..++.+|...-++.......|. -+++.. ++++ ++|++
T Consensus 317 ~ql~~~~~~efa~Silsi~W~~s~~i~~ld~~~~l~~vd~~kl~i~~~~~I~d~-----~Lv~~~~~~ks~At~g~vs~a 391 (1206)
T KOG2079|consen 317 AQLQPRREGEFAGSILSIHWRRSTGISILDNFSKLAEVDVSKLVIAWDRDIQDA-----KLVKSKYDIKSLATGGLVSPA 391 (1206)
T ss_pred EEEeeccccccccchhheeeeccccccccchhhhhcccchhhhhhhhhchhhhh-----ccCCCchhhhhhhcccccchH
Confidence 3456677899999999999999998888888888777533222221111121 233333 3333 45543
Q ss_pred -----cccccceeeeeC---cEEEEecCCcEEEE-EecCHHHHHHHHHHcCCHHHHHHHHHHhhcCccccccCCCCCHHH
Q 000170 812 -----EKSYHNCVSVRG---ASIYVLGPMHLVVS-RLLPWKERIQVLRKAGDWMGALNMAMTLYDGQAHGVIDLPRTLDA 882 (1950)
Q Consensus 812 -----~~af~nSv~~~~---~~iflLg~~~l~vg-~llsW~drI~~Lv~~gd~~eAL~LA~~~Y~G~~~~ligLP~d~~~ 882 (1950)
..+|+++|..+. |++|+++...+++. +..+|.+|....+....|.+++++++.||..-. +-|+-.-.
T Consensus 392 ~~~i~s~~c~s~Vts~t~~~g~llvl~e~~~~llq~y~~w~ern~f~~~~~~~~dv~ql~~~~y~~~l----k~~~k~~~ 467 (1206)
T KOG2079|consen 392 FGVIGSFACYSVVTSRTGLKGHLLVLTEDGLVLLQPYCPWDERNNFSVAGLSGNDVIQLHTYFYTNSL----KRLRKAYH 467 (1206)
T ss_pred HHHHhhhhheeeeecccccccceeeeehhhHHHhccccchhhhhhhhhcccchhHHHHHHHHHHHHHH----hhHHHhhh
Confidence 456777776555 49999999887654 499999999999999999999999999998632 22211111
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhhhHHHhhhHhhhhhcCCCCCccchhHHHHHHHHHHHHHHHHHHHhhcCCccchHHHH
Q 000170 883 VQEAIMPYLVELLLSYVDEVFSYISVAFCNQIEKLAQLNNPQSRSSTVHAEIKEQFTRVGGVAVEFCVHINRTDILFDDI 962 (1950)
Q Consensus 883 rr~~l~~~l~eil~~~i~~~fs~lsla~~~~~~k~~~~~~~~~~~~~l~~~~~e~~~~l~~~~iefCl~i~~~D~LF~~i 962 (1950)
.++++.....+ |+ +.. ...++.+.++.|.-|+..+..|+|+++.
T Consensus 468 a~ea~~~~t~~----~l---------------~~v-----------------~~vls~~l~~vi~~~it~~sLdll~~~~ 511 (1206)
T KOG2079|consen 468 ASEAVSGLTVY----YL---------------GVV-----------------HRVLSRLLPTVISKLITERSLDLLREQD 511 (1206)
T ss_pred hhhhHHHHHHH----HH---------------HHH-----------------HHHHHHHHHHHHHHhhhcchhHHHHHhH
Confidence 11222111100 00 000 0123455667888999999999999999
Q ss_pred HHHHHhcCchhhHHHhhHHHHhcCCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHhccCCCCCCHHHHHHHHHHhcccchh
Q 000170 963 FSKFEAVQHRDTFLELLEPYILKDMLGSLPPEIMQALVEHYSSKGWLQRVEQCVLHMDISSLDFNQVVRLCREHGLHGAL 1042 (1950)
Q Consensus 963 f~~f~~~~~~~iFle~LEp~IL~g~I~~lPP~I~q~lv~~y~~~g~l~~lE~~Il~LD~~sLDidqvi~LC~e~~LydaL 1042 (1950)
|+.+.. ....+|+|.|-.+|+.++|+++||.+.+.+++||.+.. +..+|++|++++++|||.|+++++|++|+|||++
T Consensus 512 we~l~~-~s~~vfle~l~e~V~~~tvtsisPvl~~sL~dy~~e~~-l~~ie~lIv~le~~sLDld~vlki~kq~~lfd~l 589 (1206)
T KOG2079|consen 512 WEGLFN-MSMSVFLEHLHEVVLLKTVTSISPVLAPSLADYLLEEE-LKYIENLIVTLEPSSLDLDVVLKICKQYNLFDGL 589 (1206)
T ss_pred HHhhcc-hhHHHHHHHHHHHHHhcccCCCChHHHHHHHHHHHhcC-HHHHHhheeecCcccccHHHHHHHHHHhCCcceE
Confidence 998764 45699999999999999999999999999999998876 9999999999999999999999999999999999
Q ss_pred hHHhhcccCCchhHHHHHHHHHhhhhh-hhhhhhhhhHHHHHHHHhccccCCCCCCCCCCCchhHHHHHHHHHhcccccc
Q 000170 1043 VYLFNKGLDDFRAPLEELLVVLRNSER-ESAYALGYRMLVYLKYCFKGLAFPPGHGTLPSTRLPSLRAELVQFLLEESDA 1121 (1950)
Q Consensus 1043 IYI~n~~l~DYvTPL~eLl~~i~~~~~-~~~~~~g~Kll~YLs~~LtGr~yP~g~~~ip~~~~~~aK~~I~~~Lfs~~~~ 1121 (1950)
|||||++||||.|||++||..+++... ......|+++|+|++||||||.||-| .+|.+.+.+++++++.+.|++...
T Consensus 590 iYv~~kafNDY~tplvell~~~~~difs~sEq~~gn~~f~yvs~cLTG~~YP~~--~~~ie~~~~V~~el~r~cfS~v~~ 667 (1206)
T KOG2079|consen 590 IYVNNKAFNDYDTPLVELLSRISNDIFSPSEQRLGNTIFVYVSYCLTGRFYPFG--LHPIEEQGSVSHELLRNCFSSVTT 667 (1206)
T ss_pred EEEeeehhcccccHHHHHHHHhhccccCCccccCCceEEEeeehhhcccccccc--cCchHhhchhhHHHHHHHhhcCCc
Confidence 999999999999999999999987532 23467889999999999999999954 689999999999999999988666
Q ss_pred ccchhhccccccCCChHHHHHHhcCHHHHHHHHHHhhccCCCCCCccccccccCCCCCCCCCCccchhhcccchhHHHHH
Q 000170 1122 QNSQAASSLLLKGSYLNLYHLLELDTEATLDVLRCAFIEVETPKSDFYACDMADTNAEPNNGNKMVAEYQNMLVQNTVNA 1201 (1950)
Q Consensus 1122 ~~~~~~~~~~~e~~yPyLr~LLkfD~~~fL~vL~~aF~Ed~f~n~d~~~~ds~~~~~e~~~~~~~~~~~~~i~RQ~IVd~ 1201 (1950)
.++ .+++++|||||+|||+||..||+||+.||+ .++|+.|. .-++||+||+.
T Consensus 668 k~~-----~e~e~~fPYlrllLk~d~~~flnvls~afd-~~~Fsldn----------------------~lv~rq~iI~~ 719 (1206)
T KOG2079|consen 668 KGN-----PEEEPAFPYLRLLLKSDPSRFLNVLSEAFD-ASLFSLDN----------------------ELVSRQYIIDL 719 (1206)
T ss_pred CCC-----CccCcccHHHHHHHhhCHHHHHHHHHHHhh-hhhhccch----------------------hhhhHHHHHHH
Confidence 442 368899999999999999999999999994 45444221 24579999999
Q ss_pred HHHHhhcccccCCCCCCCCCCCCCCCCCCcccchhhhhhHHhhh--cCCCCCCCHHHHHHHHHHHhcCCCCCccchhhhh
Q 000170 1202 LVHILDEDISSTDGSASKDDSGSVEAWPSTKDIGHIFEFIACYV--ASGRATVSKSVLSQILQYLTSEKNVPQSILSHIE 1279 (1950)
Q Consensus 1202 LLdIm~~~~~~~~g~~~~~~~~d~~f~Ps~~d~~~L~~FIA~~l--ar~~i~Ls~svL~~IL~~L~~~~~~~~~~~~d~~ 1279 (1950)
|+++|+.. + ...+++++|||..+ .||.+.++.+-|++++..||++- +
T Consensus 720 L~~~mk~e-----~----------------s~~~~~lifiaq~~s~yrqli~~s~shlq~~vitlcss~--~-------- 768 (1206)
T KOG2079|consen 720 LLDAMKDE-----G----------------SIRVLVLIFIAQSISKYRQLIKVSNSHLQCVVITLCSSR--V-------- 768 (1206)
T ss_pred HHHHhccc-----c----------------cchhhhHHHHHHHhhhhhHHhhhhHHHHHHHHHhhccCc--c--------
Confidence 99999974 1 13578889999988 45788999999999999999542 2
Q ss_pred hhHHHHH---HHHHHhhcCCCCCCChHHHHHHHHhhhHHHHHHHHHHHcCCHHHHHHHHHhccCC--cchhHHHHHHHHh
Q 000170 1280 TSKRREK---QLLALLEAVPETDWNASEVLHLCENAHFYQVCGLIHTIRYNYLAALDSYMKDVDE--PICAFSFIHDTLL 1354 (1950)
Q Consensus 1280 ~~e~RE~---aL~~LLs~y~~~d~d~d~lL~L~e~A~FyrVL~~LY~~~~qY~~aL~~yL~D~d~--~~~VF~yI~~~L~ 1354 (1950)
+..||. +++.+|..|...+. +..+..|++++||.|+.+||.+.++|+.+|++||+..++ ...-|-++.+.+.
T Consensus 769 -hs~rEn~~~alesll~lyh~~~d--e~~il~a~~~~~y~Vl~hi~~k~~kyed~l~~iLe~n~ek~~~~~fvs~e~e~l 845 (1206)
T KOG2079|consen 769 -HSIRENSQIALESLLPLYHSRTD--ENFILEAKEKNFYKVLFHIYKKENKYEDALSLILETNDEKEYNTDFVSIEDEIL 845 (1206)
T ss_pred -cchhHHHHHHHHhhccceeccCh--HHHHHHhhhcccceeHHHHHhhhhhHHHHHHHHHHhhhhhccccceEeeehhhh
Confidence 123555 67777777865543 344667899999999999999999999999999994432 2345777765532
Q ss_pred hcChhHHHHHHHHHHHHHHHHHhcCHHHHHHHHHhhcccchHHHHHhhccCChhHHHhhHHHHHhhccccccccccccCC
Q 000170 1355 QLTDNEYTAFHSAVISRIPELICLSREATFFLVIDQFNDEASHILSELRSHPKSLFLYLKTVVEVHLHGTLNLSYLRKDD 1434 (1950)
Q Consensus 1355 ~ls~~q~~~l~~aI~~~i~~Lv~id~~~Ta~Ll~e~f~~~~~~IL~~L~~~p~lqf~YL~~Lle~~~~g~ld~s~l~~~~ 1434 (1950)
......++ -...|.++..++...+++++++|+++.+..+...|.......|..|
T Consensus 846 ---~~~~~~fr--~l~~i~e~fti~~~~~~rlli~hc~d~fa~~~~n~~re~l~v~l~l--------------------- 899 (1206)
T KOG2079|consen 846 ---KKCPPGFR--ELGKITEVFTIFDLLLSRLLIEHCVDIFADFDYNLHREILEVKLEL--------------------- 899 (1206)
T ss_pred ---ccCCcchH--HHHHHHhhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH---------------------
Confidence 11111222 2345666678899999999999999976666655543222111111
Q ss_pred cccccccccccccccchhhHHHHhhcCcccccCCCccccHHHHHHHHHHHhhcCch--HHHHH---HhhCCCCCHHHHHH
Q 000170 1435 TLDVANCKWVKYQSKGLGAYIERISDLPKFLSSNAVHVTDDMIELYLELLCRYERD--SVLKF---LETFDSYRVEYCLR 1509 (1950)
Q Consensus 1435 ~~d~~~g~~~~~~~~~l~~Yle~L~~~p~~~~~~~~~~~~~l~elYIeLLCqydP~--~Vl~f---Lqt~~~Y~Le~aL~ 1509 (1950)
..+|++++++.|.+. ..++..+.|+-+||+|++.|+ .++.| |+....++ .+|.
T Consensus 900 ----------------~~k~l~Klfs~~si~----neLd~~l~el~~E~~ckwm~sre~Il~f~~~v~~nag~~--~~l~ 957 (1206)
T KOG2079|consen 900 ----------------TQKYLDKLFSTPSIN----NELDKRLRELHIELNCKWMSSREMILWFNGTVLSNAGSL--QILD 957 (1206)
T ss_pred ----------------HHHHHHHHcCCcchh----HHHHHHHHHHHHHHHhccccchhHHHHHHHHHHhccchH--HHHH
Confidence 125777887777653 156788999999999997765 36777 45444554 4555
Q ss_pred HHHhc--CCchHHHHHHHHhCCHHHHHHHHHHHHhhHHHHHHHhhhccccccccCCCcccccccccchhhhhhhHHHHHH
Q 000170 1510 LCQEY--GITDAAAFLLERVGDVGSALLLTLSELNDKFAALETAVGSALPIAVSNGSVSVEHFSTVLNMEEVNDVNNILR 1587 (1950)
Q Consensus 1510 iCee~--~i~DA~ayLLeR~Gd~~eAL~liL~~L~~~l~~L~~~v~~~ls~~~s~~~~~~e~~~~~~~~~e~~~l~~~l~ 1587 (1950)
+...+ -...+.+++++..-++.+|+.+....+...=+. + + + ......
T Consensus 958 ll~~~s~h~~r~vI~e~l~~~~~a~af~l~feel~~nk~~--------------------~--n-------i--~s~~~~ 1006 (1206)
T KOG2079|consen 958 LLNQDSNHEARAVIHERLESFNLAVAFLLSFEELCLNKGK--------------------T--N-------I--SSLLES 1006 (1206)
T ss_pred HHhcChHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhcCc--------------------h--h-------H--HHHHHH
Confidence 55544 455667777788888888888877665431000 0 0 0 011223
Q ss_pred HHHHHhhhcCCC-CCccchhHhHHHHHHHhccccccchhhhhhhhhhhhhhhhhhcCccchhHHHHHHhhccccccchhH
Q 000170 1588 ACIGLCQRNTPR-LNPEESEVLWFKLLDSFCEPLMGSFVERASERENHSRMLEESFGSQEDAEACIIKWRISKSHRGSHI 1666 (1950)
Q Consensus 1588 ~AI~lCqr~s~~-L~~ee~e~LWf~LLd~~i~pl~~~l~~k~s~~~~~~~~l~e~~~~~~~~~~~~~~~~i~~s~~~~~~ 1666 (1950)
.-+.+|-+++.. ...+.-+.||+.|++.+-. ++.... +.+. +.
T Consensus 1007 ~tms~~d~~ss~t~ts~r~erl~~~l~t~v~~--fee~~e-----~~~~-----------------------------ks 1050 (1206)
T KOG2079|consen 1007 LTMSFDDCNSSGTETSSRWERLITFLITLVGK--FEEHDE-----DLCN-----------------------------KS 1050 (1206)
T ss_pred HHHHHhhhhccCCccHHHHHHHHHHHHHHhcc--chhhhH-----HHHH-----------------------------HH
Confidence 445555554432 2223346777777776422 111110 0011 23
Q ss_pred HHHHHHHHHHHHHHhhccCCChHHHHHHHhc--CCCCcchhhHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000170 1667 LRKLFSQFIKEIVEGMIGYVHLPTIMSKLLS--DNGSQEFGDFKLTILGMLGTYSFERRILDTAKSLIEDDTFYTMSVLK 1744 (1950)
Q Consensus 1667 lr~lls~~i~~lLe~m~~~V~lp~IL~kIls--~~~s~~~~dfR~iL~~mL~sY~yE~~IL~~a~~Lle~Dl~~~l~~l~ 1744 (1950)
++..+.+++... . ..-|.+++. ++..++|+|+|+.|.+||++|.+|.++++...+++.........++.
T Consensus 1051 l~~~~lqlv~t~---~------~~~~~~lLe~~~nv~~tf~D~kqlLl~~~~s~~~e~el~~~s~kii~~~~l~l~~~~r 1121 (1206)
T KOG2079|consen 1051 LQEAFLQLVRTK---S------SSQMSSLLEHQDNVLMTFQDLKQLLLNVFNSYKLERELSELSQKIIEDSSLDLVQQYR 1121 (1206)
T ss_pred HHHHHHHHHHhc---c------HHHHHHHHcCCccceeehhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHH
Confidence 333332322211 1 111344443 35678999999999999999999999999999999776556666665
Q ss_pred HHhc-CccccCCCcccccccccccCCCCCeEEEecCCCcccccccc
Q 000170 1745 KEAS-HGYAPRSLLCCICNCLLTKNSSSFQIRVFNCGHATHIQCEL 1789 (1950)
Q Consensus 1745 r~~~-rG~~p~s~~C~iC~k~L~~~~~~~~ivVF~CGHafH~~CL~ 1789 (1950)
.... +||..+...|.+|++++|.. ....+.-.|||.-|..|..
T Consensus 1122 ~~~shr~~~iht~~c~~c~q~~~~h--~~~~~Fl~wgh~qh~qc~~ 1165 (1206)
T KOG2079|consen 1122 KFLSHRGWSIHTDDCEICGQKIWAH--LDPLLFLAWGHVQHHQCMI 1165 (1206)
T ss_pred HHhhccCceecCcchHhhhhhhhcc--CcchheeeccchhhHHHHH
Confidence 5555 89999999999999999932 2334444499999999974
|
|
| >PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1950 | |||
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.5 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.5 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.48 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.48 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.43 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.43 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.4 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.4 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.4 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.39 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.38 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.37 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.37 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.36 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.35 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.35 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.34 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.34 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.33 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.33 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.33 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.32 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.32 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.32 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.3 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.3 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.29 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.29 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.29 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.29 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.28 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.28 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.28 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.27 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.27 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.27 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.27 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.27 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.26 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.25 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.25 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.25 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.24 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.24 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.24 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.24 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.23 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.23 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.23 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.22 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.22 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.21 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.21 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.21 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.21 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.21 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.2 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.2 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.19 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.19 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.19 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.19 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.18 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.17 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.17 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.17 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.17 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.16 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.16 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.15 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.15 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.14 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.14 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.13 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.12 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.12 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.12 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.11 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.11 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.11 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.09 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.09 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.09 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.08 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.08 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.08 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.08 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.07 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.07 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.06 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.06 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.05 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.05 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.03 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.02 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.02 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.02 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.01 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 98.99 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.99 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.99 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.97 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.97 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.95 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.95 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 98.92 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 98.92 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 98.92 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.9 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.89 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.89 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 98.89 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.87 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.85 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.84 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 98.84 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 98.83 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 98.82 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 98.82 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 98.81 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 98.75 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.73 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 98.68 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 98.63 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 98.55 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.54 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 98.5 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.5 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 98.35 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 98.32 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 98.24 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.21 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 97.97 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.95 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 97.86 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.74 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.68 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.68 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 97.62 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 97.59 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.58 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.57 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 97.56 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 97.55 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.46 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.44 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 97.4 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.4 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 97.38 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 97.37 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.36 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.34 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 97.3 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 97.29 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 97.29 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 97.26 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.23 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 97.22 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.17 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 97.17 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 97.13 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 97.08 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 97.08 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.84 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.81 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 96.77 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.64 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 96.47 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.46 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 96.45 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 96.41 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 96.33 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 96.3 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 96.21 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 96.15 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 96.15 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 96.1 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 96.08 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 96.05 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 95.98 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 95.95 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 95.91 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 95.87 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 95.85 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 95.85 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 95.78 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 95.69 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 95.65 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 95.52 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 95.45 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 95.4 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 95.37 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 95.36 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 95.34 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 95.33 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.32 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 95.3 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 95.26 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 95.21 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 95.11 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 95.04 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 94.94 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 94.9 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 94.88 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 94.77 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 94.62 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 94.53 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 94.52 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 94.48 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 94.47 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 94.44 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 94.41 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 94.37 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 94.33 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 94.2 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 94.15 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 94.13 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 94.1 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 93.97 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 93.93 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 93.89 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 93.82 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 93.62 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 93.59 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 93.58 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 93.5 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 93.45 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 93.41 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 93.4 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 93.39 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 93.35 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 93.28 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 93.22 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 93.21 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 93.19 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 93.13 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 93.07 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 93.06 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 93.04 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 92.8 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 92.78 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 92.61 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 92.53 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 92.26 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 92.19 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 91.75 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 91.3 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 91.06 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 90.94 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 90.91 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 90.9 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 90.71 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 90.61 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 89.92 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 89.76 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 89.67 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 89.55 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 89.42 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 88.8 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 88.66 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 88.6 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 88.47 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 88.36 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 88.36 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 87.97 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 87.77 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 87.65 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 87.64 | |
| 3lvg_A | 624 | Clathrin heavy chain 1; SELF assembly, coated PIT, | 87.08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 86.83 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 86.77 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 86.3 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 86.26 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 85.6 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 85.21 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 84.78 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 84.58 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 83.97 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 83.4 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 83.21 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 83.1 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 82.99 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 82.88 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 82.8 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 82.7 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 80.98 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 80.44 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 80.1 |
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
Probab=99.50 E-value=4.8e-12 Score=150.62 Aligned_cols=144 Identities=13% Similarity=0.095 Sum_probs=107.0
Q ss_pred cccccCCCcEEEEEcC---CEEEEEeCCCcEEEEeCCCCCCccCcccceeeeecccCCCCCCCeEEEEEcCCCCEEEEec
Q 000170 439 AFRRDHGSPQVLAVHP---SFIAVGMSKGAIVVVPGKYSAHHRDSMDSKMMMLGLLGDRSPAPVTAMCFNQPGDLLLAGY 515 (1950)
Q Consensus 439 ~f~~~~G~pt~ia~s~---~~IAvGts~G~I~vfd~k~~~~~~d~~~~k~~~l~~~~~~h~~~VtsLafS~DG~~LasG~ 515 (1950)
.++.+.|.++++++++ ++||+|+.||+|++||+... +......+ ....+|.++|++++|++||++|++|+
T Consensus 12 ~l~gH~~~V~~l~~~~~~~~~l~s~s~D~~v~~W~~~~~----~~~~~~~~---~~~~~h~~~v~~~~~s~dg~~l~s~s 84 (319)
T 3frx_A 12 TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGD----DQKFGVPV---RSFKGHSHIVQDCTLTADGAYALSAS 84 (319)
T ss_dssp EECCCSSCEEEEEECSSCTTEEEEEETTSEEEEEEEEEE----TTEEEEEE---EEEECCSSCEEEEEECTTSSEEEEEE
T ss_pred EEccccceEEEEEccCCCccEEEEecCCccEEEecCCCC----Cccccccc---eEEeCCcccEEEEEECCCCCEEEEEe
Confidence 4566788899999974 68999999999999997321 00001111 12346899999999999999999999
Q ss_pred CCCcEEEEECCCCceeeeeccCcCCCeEEEEEecCCCccCCceEEEEecCCceEEEEcccccccccceeeeEEeecCCCc
Q 000170 516 ADGHVTVWDVQRASAAKVITGEHTSPVVHTLFLGQDSQVTRQFKAVTGDTKGLVQLHSLSVVPLLNRFSIKTQCLLDGQK 595 (1950)
Q Consensus 516 ~dG~I~lWDl~~g~~l~tl~~~H~~~I~~v~F~~d~~~~~~~~~~vssD~~G~V~~h~ft~~rl~~~~t~~s~~ll~g~~ 595 (1950)
.||+|++||+.++++++++. +|..+|.+++|.++ +. .++++..+|. +++|+. ...+...+.| |
T Consensus 85 ~D~~v~~wd~~~~~~~~~~~-~h~~~v~~~~~~~~-----~~-~l~s~s~D~~--------i~vwd~-~~~~~~~~~~-h 147 (319)
T 3frx_A 85 WDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKK-----AS-MIISGSRDKT--------IKVWTI-KGQCLATLLG-H 147 (319)
T ss_dssp TTSEEEEEETTTTEEEEEEE-CCSSCEEEEEECTT-----SC-EEEEEETTSC--------EEEEET-TSCEEEEECC-C
T ss_pred CCCEEEEEECCCCCeeEEEc-cCCCcEEEEEEcCC-----CC-EEEEEeCCCe--------EEEEEC-CCCeEEEEec-c
Confidence 99999999999999999886 99999999999986 33 4455555554 445543 2344556667 8
Q ss_pred cccEEEeeccc
Q 000170 596 TGIVLSASPLL 606 (1950)
Q Consensus 596 ~g~Vla~spLp 606 (1950)
.+.|.++...|
T Consensus 148 ~~~v~~~~~~~ 158 (319)
T 3frx_A 148 NDWVSQVRVVP 158 (319)
T ss_dssp SSCEEEEEECC
T ss_pred CCcEEEEEEcc
Confidence 88886555544
|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1950 | ||||
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-06 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 4e-06 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 8e-06 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 1e-04 | |
| d1b89a_ | 336 | a.118.1.3 (A:) Clathrin heavy chain proximal leg s | 1e-04 | |
| d1b89a_ | 336 | a.118.1.3 (A:) Clathrin heavy chain proximal leg s | 0.003 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 2e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 3e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 5e-04 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 0.002 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 0.004 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Score = 49.3 bits (116), Expect = 2e-06
Identities = 24/104 (23%), Positives = 39/104 (37%), Gaps = 14/104 (13%)
Query: 442 RDHGSP-QVLAVHPS--FIAVGMSKGAIVVVPGKYSAHHRDSMDSKMMMLGLLGDRSPAP 498
H S + P+ A G + + ++
Sbjct: 223 TGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNII----------CG 272
Query: 499 VTAMCFNQPGDLLLAGYADGHVTVWDVQRASAAKVITGEHTSPV 542
+T++ F++ G LLLAGY D + VWD +A A V+ G H + V
Sbjct: 273 ITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAG-HDNRV 315
|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1950 | |||
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.45 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.42 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.36 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 99.32 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.28 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.24 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.22 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.21 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.21 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.17 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.15 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.12 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.11 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.1 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.08 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.07 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.03 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.02 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.01 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.01 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.0 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.94 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.94 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 98.87 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 98.86 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.84 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.66 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.64 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.58 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.53 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.53 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.23 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.22 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.1 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.06 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.98 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.88 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.88 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.8 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.67 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 97.49 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.45 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.21 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 97.14 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 97.03 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 96.73 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 96.62 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 96.38 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 96.38 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 96.23 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 95.97 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 95.86 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 95.76 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 95.67 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.37 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.18 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 95.08 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 94.61 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.36 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 94.21 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 94.08 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 94.0 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 92.77 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 92.36 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 91.37 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 90.96 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 90.08 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 88.78 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 88.6 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 86.7 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 86.22 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 85.49 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 85.17 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 84.91 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 84.58 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 82.83 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 80.26 |
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Actin interacting protein 1 species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=99.45 E-value=9.1e-12 Score=145.13 Aligned_cols=142 Identities=13% Similarity=0.126 Sum_probs=106.9
Q ss_pred ccccCCCcEEEEEcC--CEEEEEeCCCcEEEEeCCCCCCccCcccceeeeecccCCCCCCCeEEEEEcCCCCEEEEecCC
Q 000170 440 FRRDHGSPQVLAVHP--SFIAVGMSKGAIVVVPGKYSAHHRDSMDSKMMMLGLLGDRSPAPVTAMCFNQPGDLLLAGYAD 517 (1950)
Q Consensus 440 f~~~~G~pt~ia~s~--~~IAvGts~G~I~vfd~k~~~~~~d~~~~k~~~l~~~~~~h~~~VtsLafS~DG~~LasG~~d 517 (1950)
|..+.+.++|+++++ ++||+|+.||.|++||...+ ...... ....|.++|++|+|++||++|++|+.+
T Consensus 54 ~~~H~~~v~~~~~sp~g~~latg~~dg~i~iwd~~~~------~~~~~~----~~~~~~~~v~~v~~s~d~~~l~~~~~~ 123 (311)
T d1nr0a1 54 YTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQT------THILKT----TIPVFSGPVKDISWDSESKRIAAVGEG 123 (311)
T ss_dssp ECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESSST------TCCEEE----EEECSSSCEEEEEECTTSCEEEEEECC
T ss_pred EcCCCCCEEEEEEeCCCCeEeccccCceEeeeeeecc------cccccc----ccccccCcccccccccccccccccccc
Confidence 455667899999875 89999999999999998532 111111 224578999999999999999999865
Q ss_pred --CcEEEEECCCCceeeeeccCcCCCeEEEEEecCCCccCCceEEEEecCCceEEEEcccccccccceeeeEEeecCCCc
Q 000170 518 --GHVTVWDVQRASAAKVITGEHTSPVVHTLFLGQDSQVTRQFKAVTGDTKGLVQLHSLSVVPLLNRFSIKTQCLLDGQK 595 (1950)
Q Consensus 518 --G~I~lWDl~~g~~l~tl~~~H~~~I~~v~F~~d~~~~~~~~~~vssD~~G~V~~h~ft~~rl~~~~t~~s~~ll~g~~ 595 (1950)
+.+++||+.+++..+++. +|...|++|+|+++ +...++++..+|.|..+.+ .+.+....+.+ |
T Consensus 124 ~~~~~~v~~~~~~~~~~~l~-~h~~~v~~v~~~~~-----~~~~l~sgs~d~~i~i~d~--------~~~~~~~~~~~-~ 188 (311)
T d1nr0a1 124 RERFGHVFLFDTGTSNGNLT-GQARAMNSVDFKPS-----RPFRIISGSDDNTVAIFEG--------PPFKFKSTFGE-H 188 (311)
T ss_dssp SSCSEEEEETTTCCBCBCCC-CCSSCEEEEEECSS-----SSCEEEEEETTSCEEEEET--------TTBEEEEEECC-C
T ss_pred cccccccccccccccccccc-cccccccccccccc-----ceeeecccccccccccccc--------ccccccccccc-c
Confidence 459999999999988886 99999999999986 4456666666665555543 34555666667 7
Q ss_pred cccEEEeeccc
Q 000170 596 TGIVLSASPLL 606 (1950)
Q Consensus 596 ~g~Vla~spLp 606 (1950)
.+.|.++...|
T Consensus 189 ~~~i~~v~~~p 199 (311)
T d1nr0a1 189 TKFVHSVRYNP 199 (311)
T ss_dssp SSCEEEEEECT
T ss_pred cccccccccCc
Confidence 77786655543
|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|