Citrus Sinensis ID: 000224


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830---
MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
cHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccEEEEEEEcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEEcccccEEEEEccccEEccccEEEEEccccccHHHHHHHHHcccccccEEEEEEcccccccHHHHHcccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHccccccccccHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHcccEEEEEccEEEEEccHHHHHHcccccEEEEEEcccccHHHHHHHHHHHccccEEEEEcccEEEEEccccccccHHHHHHHHHHcccccccccccccccccccccccEEEcccccHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHcccHHHccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccEEEEEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEEcEEEEEccccccccccccccEEEEEccccEEEEcccccccHHHHHHHHHcccccccEEEEEEcccccccHHHHccccccccccccccccccHHHHHHHHHHcccccHHcHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHccccEEEEccEEEEcccHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccEEEEEccHHHHHHHHHHccccccHHHHHHcccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHcccccccEEHEEccccccccEEEEcccccccEEEEEEccccEEEEcccccccccccccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEccccccEEEEEcEEEEcccccEEEEEccccccHHHHHHHHcccccccccEEEEEccccHHcHHHHHHHcccccccccHHcHccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHcHEEEEEEEEccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcHEEEEEcccEEEcccHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHccccEEEHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccHHHHEEEEcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEccHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHcccccccEEEEcHHHHHHccccccccccccEEEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEcEEEEEccccccccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccEEEEEEccEEEEEHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHEEEEccEEEEcccHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccEcHccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHHHEEEEEEEEccc
MGTAKRHLKAMLRKnwllkvrhpfvtaAEILLPTVVMLLLIAVRTrvdtrihpaqpyirkdmfveigkgvspNFVQALELMLAKGeylafapdteeTRTMINLMSIKFPKLKLVSRIYKDELELETYIRsdlygtcsqvkdclnpkikgavvfhdqgpelfdYSIRLnhtwafsgfpdvktimdtngpylndlelgvniiptmqysfsGFLTLQQVLDSFIIFAAQqtganvatenveippsnlsgthlslkqpwtlyspsnirmvpfptreytddEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITActmdslfkysdktvVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSflgaffpyytvndeaVPMVLKVIASLLSPtafalgsvnfadyerahvglrwsnmwrassgVNFLVCLLMMLLDTLLYGVIGLyldkvlpkengvryRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYAtkrgnccavnslqLTLYENQILALLghngagksTTISMLvglippttgdalvfgkNITADMDEIRKglgvcpqydilfpeLTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIaligdskvvildeptsgmdpysmRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGslkccgsslflkhqygvgyTLTLvksapdasaaADIVYRHIPsalcvsevgteitfklplassssFESMFREIESCIRKSVSkveadatedtdylgiesFGISVTTLEEVFLRVAgcnldesecisqrnnlvtldyvsaesddqapkrisncklfgnykWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCtcciisrsmFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFlklkphpdmlsvtfttsnfnpllsggggggpipfdlswpianEVSKYIQggwiqrfkqssyrfpnAEKALADAvdaagptlgPVLLSMSEYLMSSFNESYQSRYGaivmddqnddgslGFTVLhnsscqhagptFINVMNTAILRLAtgnrnmtirtrnhplpttqsqqlqrhdldaFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLdqfvgrgcllPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNffrlspgfcfaDGLASLALLRQGmkdktsdgvfdwnVTSASICYLGCESICYFLLTLGlellpshkwTLMTIKEWWKgtrhrlcntpssylepllqsssesdtldlnedidvqvernrvlsgsvdNAIIYLRNLrkvypggkrsdaKVAVHSLTFSVqagecfgflgtngagktttlsmisgeeyptdgtafifgkdirsdpKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLlkhakkpsftlsggnkrKLSVAIAMigdppivildepstgmdpiAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGimvggqlrcigspqhlktRFGNflelevkptevssvdLEDLCQIIQERVFDIPSQRRSLLDDLEVCIggidsissenATAAEISLSQEMLLIVGRWLGNEERIKTLissssspdrifgEQLSEQLVrdgtdgsctlrFVSSFIFIFSGLILSVIQKSNW
MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTrvdtrihpaqpyiRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLmsikfpklklVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLdmkqqevdGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMvdevgladkVNIVVRALSGGMKRKLSLGIALIGDSKVVILDeptsgmdpysmrLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKlplassssfESMFREIESCIrksvskveadatedtdylgIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVsaesddqapkrisncklfGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHplpttqsqqlqRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDIDVqvernrvlsgsvdnaiiyLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLlkhakkpsftlsggnkRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQErvfdipsqrrSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTlissssspdriFGEQLSEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFlvcllmmlldtllYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQlikkikkgriillTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIfllvgllflklkPHPDMLSVTFTTSNFNPLLSggggggPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNaekaladavdaaGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDafsvsiiisiafsfipasfavaiVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
********KAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIP**NLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVSA*******KRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTT*****************FDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTI*****************HDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYL*****************DIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLI****************QLVRDGTDGSCTLRFVSSFIFIFSGLILSVI*****
*GTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKS**********************************************DGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGC************************************LFGNYKWV***********************NFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTP***********************DVQVERNRV***SVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLL**********************************************FVSSFIFIFSGLILSVIQKSN*
MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPL********QRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
*GTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKK**********************************************VDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGC**************************************************************************CTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPL*************EDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWL************************SEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRKDMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVKTIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKVIASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNLVTLDYVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDAFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGTDGSCTLRFVSSFIFIFSGLILSVIQKSNW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1833 2.2.26 [Sep-21-2011]
Q84M241882 ABC transporter A family yes no 0.969 0.944 0.730 0.0
Q997581704 ATP-binding cassette sub- yes no 0.831 0.894 0.323 0.0
Q8R4201704 ATP-binding cassette sub- yes no 0.832 0.895 0.320 0.0
Q54BT51702 ABC transporter A family yes no 0.806 0.868 0.282 1e-153
P343581704 ABC transporter ced-7 OS= no no 0.843 0.907 0.264 1e-125
O954772261 ATP-binding cassette sub- no no 0.411 0.333 0.331 1e-121
P412332261 ATP-binding cassette sub- no no 0.418 0.339 0.325 1e-120
Q9BZC7 2435 ATP-binding cassette sub- no no 0.392 0.295 0.326 1e-115
Q9ESR9 2434 ATP-binding cassette sub- no no 0.328 0.247 0.364 1e-115
P783632273 Retinal-specific ATP-bind no no 0.379 0.305 0.327 1e-106
>sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 Back     alignment and function desciption
 Score = 2688 bits (6968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1328/1817 (73%), Positives = 1546/1817 (85%), Gaps = 40/1817 (2%)

Query: 1    MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRK 60
            MG++KR  KAMLRKNWLLK RHPFVT+AEILLPT+VMLLLIAVRTRVDT IHPA   I K
Sbjct: 1    MGSSKRQFKAMLRKNWLLKTRHPFVTSAEILLPTIVMLLLIAVRTRVDTTIHPAHSNIDK 60

Query: 61   DMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKD 120
            D  VE+GKG SP+F + L+L+LA+G++LAFAPDT+ET  MI+++S+KFP+L+LV++I+KD
Sbjct: 61   DTVVEVGKGNSPSFPEVLKLLLAEGDFLAFAPDTDETNNMIDILSLKFPELRLVTKIFKD 120

Query: 121  ELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVK 180
            ++ELETYI S  YG CS+V++C NPKIKGAVVFH+QGP LFDYSIRLNHTWAF+GFP+VK
Sbjct: 121  DIELETYITSAHYGVCSEVRNCSNPKIKGAVVFHEQGPHLFDYSIRLNHTWAFAGFPNVK 180

Query: 181  TIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIP 240
            +IMDTNGPY+NDLE+G+N IPTMQYSFSGFLTLQQV+DSFIIFA+QQ        ++ + 
Sbjct: 181  SIMDTNGPYINDLEMGINTIPTMQYSFSGFLTLQQVVDSFIIFASQQN------NDLPLS 234

Query: 241  PSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISR 300
             SNLS + L  + PWTL+SPS IRMVPFPTREYTDDEFQSI+K VMG+LYLLGFL+PISR
Sbjct: 235  HSNLS-SALRFELPWTLFSPSVIRMVPFPTREYTDDEFQSIVKSVMGLLYLLGFLFPISR 293

Query: 301  LISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDK 360
            LISYSVFEKEQKIREGLYMMGLKD IFHLSWFITYA QFA+ SGIITACTM SLFKYSDK
Sbjct: 294  LISYSVFEKEQKIREGLYMMGLKDEIFHLSWFITYALQFALCSGIITACTMGSLFKYSDK 353

Query: 361  TVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKV 420
            T+VFTYFF FGLSAI LSF ISTFF RAKTAVAVGTL+FLGAFFPYYTVNDE+V MVLKV
Sbjct: 354  TLVFTYFFLFGLSAIMLSFMISTFFTRAKTAVAVGTLTFLGAFFPYYTVNDESVSMVLKV 413

Query: 421  IASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGL 480
            +ASLLSPTAFALGS+NFADYERAHVGLRWSN+WRASSGV+F VCLLMMLLD++LY  +GL
Sbjct: 414  VASLLSPTAFALGSINFADYERAHVGLRWSNIWRASSGVSFFVCLLMMLLDSILYCALGL 473

Query: 481  YLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSS-------AEVKINKKLSKEKECA 533
            YLDKVLP+ENGVRY WNFIF   F RKK+ +++ +         A++++N+         
Sbjct: 474  YLDKVLPRENGVRYPWNFIFSKYFGRKKNNLQNRIPGFETDMFPADIEVNQG-------- 525

Query: 534  FALDACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILA 593
               +  +PV E+ISL+M+QQE+DGRCIQ+R LHKVYA++RGNCCAVNSLQLTLYENQIL+
Sbjct: 526  ---EPFDPVFESISLEMRQQELDGRCIQVRNLHKVYASRRGNCCAVNSLQLTLYENQILS 582

Query: 594  LLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTV 653
            LLGHNGAGKSTTISMLVGL+PPT+GDAL+ G +I  +MDEIRK LGVCPQ+DILFPELTV
Sbjct: 583  LLGHNGAGKSTTISMLVGLLPPTSGDALILGNSIITNMDEIRKELGVCPQHDILFPELTV 642

Query: 654  REHLEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDS 713
            REHLEMFAVLKGV+E  L+S V +M +EVGL+DK+N +VRALSGGMKRKLSLGIALIG+S
Sbjct: 643  REHLEMFAVLKGVEEGSLKSTVVDMAEEVGLSDKINTLVRALSGGMKRKLSLGIALIGNS 702

Query: 714  KVVILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKC 773
            KV+ILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRI IMANGSLKC
Sbjct: 703  KVIILDEPTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIGIMANGSLKC 762

Query: 774  CGSSLFLKHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSS 833
            CGSS+FLKH YGVGYTLTLVK++P  S AA IV+RHIPSA CVSEVG EI+FKLPLAS  
Sbjct: 763  CGSSIFLKHHYGVGYTLTLVKTSPTVSVAAHIVHRHIPSATCVSEVGNEISFKLPLASLP 822

Query: 834  SFESMFREIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESEC 893
             FE+MFREIESC++ SV + +    ED+DY GI+S+GISVTTLEEVFLRVAGCNLD  + 
Sbjct: 823  CFENMFREIESCMKNSVDRSKISEIEDSDYPGIQSYGISVTTLEEVFLRVAGCNLDIED- 881

Query: 894  ISQRNNLVTLDYVSA-------ESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIV 946
              Q +  V+ D  S+       +     PK +++C          G I+T V +A  LIV
Sbjct: 882  -KQEDIFVSPDTKSSLVCIGSNQKSSMQPKLLASCNDGA------GVIITSVAKAFRLIV 934

Query: 947  AAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLV 1006
            AAV   + F+  +CC C IISRSMFW+HCKALFIKRA SA RDRKT+ FQ +IPA+FLL 
Sbjct: 935  AAVWTLIGFISIQCCGCSIISRSMFWRHCKALFIKRARSACRDRKTVAFQFIIPAVFLLF 994

Query: 1007 GLLFLKLKPHPDMLSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRF 1066
            GLLFL+LKPHPD  S+T TT+ FNPLLSG GGGGPIPFDLS PIA EV++YI+GGWIQ  
Sbjct: 995  GLLFLQLKPHPDQKSITLTTAYFNPLLSGKGGGGPIPFDLSVPIAKEVAQYIEGGWIQPL 1054

Query: 1067 KQSSYRFPNAEKALADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDG 1126
            + +SY+FPN ++ALADA+DAAGPTLGP LLSMSE+LMSSF++SYQSRYG+I+MD Q+ DG
Sbjct: 1055 RNTSYKFPNPKEALADAIDAAGPTLGPTLLSMSEFLMSSFDQSYQSRYGSILMDGQHPDG 1114

Query: 1127 SLGFTVLHNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLD 1186
            SLG+TVLHN +CQHAGP +INVM+ AILRLATGN+NMTI+TRNHPLP T++Q++QRHDLD
Sbjct: 1115 SLGYTVLHNGTCQHAGPIYINVMHAAILRLATGNKNMTIQTRNHPLPPTKTQRIQRHDLD 1174

Query: 1187 AFSVSIIISIAFSFIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFP 1246
            AFS +II++IAFSFIPASFAV IVKEREVKAK QQLISGVSVLSYW STY+WDFISFLFP
Sbjct: 1175 AFSAAIIVNIAFSFIPASFAVPIVKEREVKAKHQQLISGVSVLSYWLSTYVWDFISFLFP 1234

Query: 1247 SSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLV 1306
            S+ AIILFY FGL+QF+G G  LPTVL+ L YGLAIASSTYCLTFFF++H+MAQNV+L+V
Sbjct: 1235 STFAIILFYAFGLEQFIGIGRFLPTVLMLLEYGLAIASSTYCLTFFFTEHSMAQNVILMV 1294

Query: 1307 HFFTGLILMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSD 1366
            HFF+GLILMVISF+MGL+ AT SANS LKNFFRLSPGFCF+DGLASLALLRQGMKDK+S 
Sbjct: 1295 HFFSGLILMVISFVMGLIPATASANSYLKNFFRLSPGFCFSDGLASLALLRQGMKDKSSH 1354

Query: 1367 GVFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSY 1426
            GVF+WNVT ASICYLG ESI YFL+TLGLEL+P  K    +I EWW+  +       SS 
Sbjct: 1355 GVFEWNVTGASICYLGLESIFYFLVTLGLELMPVQKVMSFSIGEWWQNLKAFKQGAGSSS 1414

Query: 1427 LEPLLQSSSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAV 1486
             EPLL+ S+ + + D+ +DIDVQ ER+RV+SG  DN ++YL+NLRKVYPG K    KVAV
Sbjct: 1415 TEPLLKDSTGAISTDMEDDIDVQEERDRVISGLSDNTMLYLQNLRKVYPGDKHHGPKVAV 1474

Query: 1487 HSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIG 1546
             SLTFSVQAGECFGFLGTNGAGKTTTLSM+SGEE PT GTAFIFGKDI + PKA R+ IG
Sbjct: 1475 QSLTFSVQAGECFGFLGTNGAGKTTTLSMLSGEETPTSGTAFIFGKDIVASPKAIRQHIG 1534

Query: 1547 YCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGN 1606
            YCPQFDAL EYLTV+EHLELYARIKGV ++R+D+VV EKLVEFDLLKH+ KPSFTLSGGN
Sbjct: 1535 YCPQFDALFEYLTVKEHLELYARIKGVVDHRIDNVVTEKLVEFDLLKHSHKPSFTLSGGN 1594

Query: 1607 KRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEA 1666
            KRKLSVAIAMIGDPPIVILDEPSTGMDP+AKRFMW+VISRLSTR GKTAVILTTHSMNEA
Sbjct: 1595 KRKLSVAIAMIGDPPIVILDEPSTGMDPVAKRFMWDVISRLSTRSGKTAVILTTHSMNEA 1654

Query: 1667 QALCTRIGIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDI 1726
            QALCTRIGIMVGG+LRCIGSPQHLKTR+GN LELEVKP EVS+V+LE+ CQIIQ+ +F++
Sbjct: 1655 QALCTRIGIMVGGRLRCIGSPQHLKTRYGNHLELEVKPNEVSNVELENFCQIIQQWLFNV 1714

Query: 1727 PSQRRSLLDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSS 1786
            P+Q RSLL DLEVCIG  DSI+ + A+A+EISLS EM+  + ++LGNE+R+ TL+     
Sbjct: 1715 PTQPRSLLGDLEVCIGVSDSITPDTASASEISLSPEMVQRIAKFLGNEQRVSTLVPPLPE 1774

Query: 1787 PDRIFGEQLSEQLVRDG 1803
             D  F +QLSEQL RDG
Sbjct: 1775 EDVRFDDQLSEQLFRDG 1791





Arabidopsis thaliana (taxid: 3702)
>sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 Back     alignment and function description
>sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3 Back     alignment and function description
>sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 Back     alignment and function description
>sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 Back     alignment and function description
>sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 Back     alignment and function description
>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 Back     alignment and function description
>sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 Back     alignment and function description
>sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 Back     alignment and function description
>sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1833
2240900971891 ABC transporter family, cholesterol/phos 0.981 0.951 0.802 0.0
2254418601881 PREDICTED: ABC transporter A family memb 0.976 0.951 0.792 0.0
3565047791892 PREDICTED: ABC transporter A family memb 0.982 0.951 0.767 0.0
795952671882 ABC transporter A family member 1 [Arabi 0.969 0.944 0.730 0.0
333509341882 ATP-binding cassette transporter AtABCA1 0.970 0.945 0.730 0.0
2978278171914 ATPase, coupled to transmembrane movemen 0.973 0.932 0.720 0.0
2555772581722 abc transporter, putative [Ricinus commu 0.900 0.958 0.768 0.0
793248831846 ABC transporter A family member 1 [Arabi 0.913 0.906 0.657 0.0
297739642 2001 unnamed protein product [Vitis vinifera] 0.697 0.638 0.767 0.0
3028106591855 hypothetical protein SELMODRAFT_446818 [ 0.935 0.923 0.536 0.0
>gi|224090097|ref|XP_002308937.1| ABC transporter family, cholesterol/phospholipid flippase [Populus trichocarpa] gi|222854913|gb|EEE92460.1| ABC transporter family, cholesterol/phospholipid flippase [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 2956 bits (7664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1447/1804 (80%), Positives = 1605/1804 (88%), Gaps = 4/1804 (0%)

Query: 1    MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRK 60
            MG + R L+AMLRKNWLLK+RHPF+T+AEILLPT+VMLLLIAVRTRVD +IHPAQ  I++
Sbjct: 1    MGNSTRQLRAMLRKNWLLKIRHPFITSAEILLPTIVMLLLIAVRTRVDLQIHPAQACIKE 60

Query: 61   DMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKD 120
            +M VE+GKG+SPNF + LE +L +GE+LAFAPDTEETR MINLMSIKFP L+ VS IYKD
Sbjct: 61   NMLVEVGKGMSPNFQEVLEALLVRGEFLAFAPDTEETRMMINLMSIKFPLLQQVSLIYKD 120

Query: 121  ELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVK 180
            ELELETY+ SDLYGTCSQVK+C NPKIKGAVVFH+QGP+LFDYSIRLNHTWAFSGFPDV+
Sbjct: 121  ELELETYLTSDLYGTCSQVKNCSNPKIKGAVVFHNQGPQLFDYSIRLNHTWAFSGFPDVR 180

Query: 181  TIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIP 240
            TIMD NGPYLNDLELGVNIIPTMQYS S F TLQQV+DSFIIFA+QQT    +TE++E+P
Sbjct: 181  TIMDVNGPYLNDLELGVNIIPTMQYSSSAFFTLQQVVDSFIIFASQQTETESSTEHIELP 240

Query: 241  PSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISR 300
             SN      SLK PWT +SPS IR+ PFPTREYTDD+FQSIIKRVMGVLYLLGFLYPIS 
Sbjct: 241  SSNSFNKSSSLKLPWTKFSPSKIRIAPFPTREYTDDQFQSIIKRVMGVLYLLGFLYPISG 300

Query: 301  LISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDK 360
            LISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYA QFA+SSGIITACT+++LFKYSDK
Sbjct: 301  LISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYALQFAISSGIITACTLNNLFKYSDK 360

Query: 361  TVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKV 420
            +VVF YFFSFGLSAI LSF ISTFF RAKTAVAVGTLSF GAFFPYYTVND AVPM+LKV
Sbjct: 361  SVVFVYFFSFGLSAIMLSFLISTFFTRAKTAVAVGTLSFFGAFFPYYTVNDPAVPMILKV 420

Query: 421  IASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFLVCLLMMLLDTLLYGVIGL 480
            +ASLLSPTAFALGS+NFADYERAHVGLRWSN+WR SSGVNFLVCLLMML DTL+Y  IGL
Sbjct: 421  LASLLSPTAFALGSINFADYERAHVGLRWSNIWRESSGVNFLVCLLMMLFDTLIYCAIGL 480

Query: 481  YLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACE 540
            YLDKVLP+ENG+RY WNF+FQ CF RK + +KHH SS E   N +LS E+      +  E
Sbjct: 481  YLDKVLPRENGMRYPWNFLFQKCFWRKNNFVKHHGSSLESNFNDELSNERASFLGNNTQE 540

Query: 541  PVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGA 600
            P VEAISLDMKQQE+D RCIQIR L KVYA+KRGNCCAVNSLQLTLYENQILALLGHNGA
Sbjct: 541  PAVEAISLDMKQQELDKRCIQIRNLRKVYASKRGNCCAVNSLQLTLYENQILALLGHNGA 600

Query: 601  GKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMF 660
            GKSTTISMLVGL+PPT+GDALVFGKNIT DMDEIR GLGVCPQ DILFPELTVREHLE+F
Sbjct: 601  GKSTTISMLVGLLPPTSGDALVFGKNITTDMDEIRNGLGVCPQNDILFPELTVREHLEIF 660

Query: 661  AVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDE 720
            A LKGVKE++LE  V +MV+EVGLADKVN  VRALSGGMKRKLSLGIALIG+SKVVILDE
Sbjct: 661  AALKGVKEDILERDVTDMVNEVGLADKVNTAVRALSGGMKRKLSLGIALIGNSKVVILDE 720

Query: 721  PTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFL 780
            PTSGMDPYSMRLTWQLIK+IKKGRIILLTTHSMDEA+ELGDRIAIMANGSLKCCGSSLFL
Sbjct: 721  PTSGMDPYSMRLTWQLIKRIKKGRIILLTTHSMDEADELGDRIAIMANGSLKCCGSSLFL 780

Query: 781  KHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFR 840
            KHQYGVGYTLTLVKS+P AS A+DIVYRH+PSA CVSEVGTEI+FKLPLASS SFESMFR
Sbjct: 781  KHQYGVGYTLTLVKSSPTASVASDIVYRHVPSATCVSEVGTEISFKLPLASSVSFESMFR 840

Query: 841  EIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESECISQRNNL 900
            EIESC+R+S+SK E  ++ED  Y GIES+GISVTTLEEVFLRVAGC  DE++    RNN+
Sbjct: 841  EIESCMRRSISKSEMSSSEDKSYPGIESYGISVTTLEEVFLRVAGCGYDETDDFVDRNNI 900

Query: 901  VTLD-YVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFLNFLIKK 959
            ++ +  V A  D++  + I + K+ GNYK + GFI  +V R   L+ A +L F+NFL  +
Sbjct: 901  LSSNSTVPAAYDNRPSETIFDAKILGNYKKIIGFISAMVGRVSGLMAATILSFINFLGMQ 960

Query: 960  CCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGLLFLKLKPHPDM 1019
            CC+CCIISRS FWQH KALFIKRA+SARRDRKTIVFQLLIPAIFLL GLLFLKLK HPD 
Sbjct: 961  CCSCCIISRSTFWQHTKALFIKRAISARRDRKTIVFQLLIPAIFLLFGLLFLKLKSHPDQ 1020

Query: 1020 LSVTFTTSNFNPLLSGGGGGGPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRFPNAEKA 1079
             SVT TTS+FNPLLSGGGGGGPIPFDLS PIA EV+ YI+GGWIQ F+QS+YRFP+AE+ 
Sbjct: 1021 QSVTLTTSHFNPLLSGGGGGGPIPFDLSLPIAKEVAGYIKGGWIQNFRQSAYRFPDAERE 1080

Query: 1080 LADAVDAAGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVLHNSSCQ 1139
            LADA+ AAGPTLGPVLLSMSE+LMSSFNESYQSRYGA+VMD ++DDGSLG+T+LHNSSCQ
Sbjct: 1081 LADAIKAAGPTLGPVLLSMSEFLMSSFNESYQSRYGAVVMDKKHDDGSLGYTILHNSSCQ 1140

Query: 1140 HAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDAFSVSIIISIAFS 1199
            HA PTFIN+MN AILRLATG++NMTI+TRNHPLP T+SQ LQ HDLDAFS +II++IAFS
Sbjct: 1141 HAAPTFINLMNAAILRLATGDQNMTIQTRNHPLPMTKSQHLQHHDLDAFSAAIIVNIAFS 1200

Query: 1200 FIPASFAVAIVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGL 1259
            FIPASFAVAIVKEREVKAK QQLISGVSVLSYW STYIWDFISFL PSS A++LFYIFGL
Sbjct: 1201 FIPASFAVAIVKEREVKAKHQQLISGVSVLSYWVSTYIWDFISFLIPSSFALLLFYIFGL 1260

Query: 1260 DQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLILMVISF 1319
            DQF+G+ C LPT L+FL YGLAIASSTYCLTF FS+H+MAQNVVLLVHFFTGLILMVISF
Sbjct: 1261 DQFIGKDCFLPTFLMFLEYGLAIASSTYCLTFCFSEHSMAQNVVLLVHFFTGLILMVISF 1320

Query: 1320 IMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNVTSASIC 1379
            IMGL++ T SAN+LLKNFFRLSPGFCFADGLASLALLRQGMKDK+S+ VFDWNVT AS+C
Sbjct: 1321 IMGLIQTTASANNLLKNFFRLSPGFCFADGLASLALLRQGMKDKSSNAVFDWNVTGASLC 1380

Query: 1380 YLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDT 1439
            YLG ESI YFLLTLG ELLP HK T + IK++W+   +   +T    LEPLL+S SE+  
Sbjct: 1381 YLGFESIGYFLLTLGWELLPFHKLTPVGIKQYWRSIMNLQHDTHD--LEPLLKSPSETVD 1438

Query: 1440 LDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECF 1499
            L+ +EDIDVQ ERNRVL+GS+DNAIIYLRNLRKVYPG K    KVAV SLTFSVQAGECF
Sbjct: 1439 LNFDEDIDVQTERNRVLAGSIDNAIIYLRNLRKVYPGEKHR-TKVAVRSLTFSVQAGECF 1497

Query: 1500 GFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLT 1559
            GFLGTNGAGKTTTLSM++GEE PTDG+AFIFGKD RSDPKAARR IGYCPQFDALLE+LT
Sbjct: 1498 GFLGTNGAGKTTTLSMLTGEESPTDGSAFIFGKDTRSDPKAARRHIGYCPQFDALLEFLT 1557

Query: 1560 VQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGD 1619
            VQEHLELYARIKGVA+YR+DDVVMEKL+EFDLLKHA KPSFTLSGGNKRKLSVAIAMIGD
Sbjct: 1558 VQEHLELYARIKGVADYRIDDVVMEKLLEFDLLKHANKPSFTLSGGNKRKLSVAIAMIGD 1617

Query: 1620 PPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGG 1679
            PPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGG
Sbjct: 1618 PPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGG 1677

Query: 1680 QLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEV 1739
            +LRCIGSPQHLKTRFGN LELEVKPTEVSSVDLE+LCQ IQ R+FDIPS  RSLLDD+EV
Sbjct: 1678 RLRCIGSPQHLKTRFGNHLELEVKPTEVSSVDLENLCQTIQSRLFDIPSHPRSLLDDIEV 1737

Query: 1740 CIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQL 1799
            CIG IDSI+SENA+  EISLSQEM++++GRWLGNEER+KTL+SS+   D +FGEQLSEQL
Sbjct: 1738 CIGRIDSITSENASVMEISLSQEMIILIGRWLGNEERVKTLVSSTPISDGVFGEQLSEQL 1797

Query: 1800 VRDG 1803
            VRDG
Sbjct: 1798 VRDG 1801




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225441860|ref|XP_002284204.1| PREDICTED: ABC transporter A family member 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504779|ref|XP_003521172.1| PREDICTED: ABC transporter A family member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|79595267|ref|NP_850354.2| ABC transporter A family member 1 [Arabidopsis thaliana] gi|75327922|sp|Q84M24.2|AB1A_ARATH RecName: Full=ABC transporter A family member 1; Short=ABC transporter ABCA.1; Short=AtABCA1; AltName: Full=ABC one homolog protein 1; Short=AtAOH1 gi|45504175|dbj|BAC75958.2| AtABCA1 [Arabidopsis thaliana] gi|330254923|gb|AEC10017.1| ABC transporter A family member 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|33350934|gb|AAK39643.3| ATP-binding cassette transporter AtABCA1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297827817|ref|XP_002881791.1| ATPase, coupled to transmembrane movement of substances [Arabidopsis lyrata subsp. lyrata] gi|297327630|gb|EFH58050.1| ATPase, coupled to transmembrane movement of substances [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255577258|ref|XP_002529511.1| abc transporter, putative [Ricinus communis] gi|223531027|gb|EEF32880.1| abc transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|79324883|ref|NP_001031526.1| ABC transporter A family member 1 [Arabidopsis thaliana] gi|330254924|gb|AEC10018.1| ABC transporter A family member 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297739642|emb|CBI29824.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302810659|ref|XP_002987020.1| hypothetical protein SELMODRAFT_446818 [Selaginella moellendorffii] gi|300145185|gb|EFJ11863.1| hypothetical protein SELMODRAFT_446818 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1833
TAIR|locus:20543661882 ABCA1 "ATP-binding cassette A1 0.973 0.947 0.699 0.0
ZFIN|ZDB-GENE-050517-1 2503 abca2 "ATP-binding cassette, s 0.335 0.245 0.356 4.6e-183
UNIPROTKB|Q9BZC7 2435 ABCA2 "ATP-binding cassette su 0.341 0.257 0.348 4.2e-178
UNIPROTKB|J3QSS3 2436 ABCA2 "ATP-binding cassette su 0.341 0.256 0.348 4.2e-178
RGD|620238 2434 Abca2 "ATP-binding cassette, s 0.342 0.257 0.345 1.2e-177
UNIPROTKB|F1RFA01702 ABCA3 "Uncharacterized protein 0.308 0.331 0.349 1.7e-175
UNIPROTKB|F1Q1F11702 ABCA3 "Uncharacterized protein 0.302 0.326 0.378 2.2e-169
UNIPROTKB|Q997581704 ABCA3 "ATP-binding cassette su 0.310 0.333 0.373 2.6e-168
UNIPROTKB|E1BCR11704 ABCA3 "Uncharacterized protein 0.303 0.326 0.376 1.2e-173
MGI|MGI:13516171704 Abca3 "ATP-binding cassette, s 0.303 0.326 0.374 1.3e-173
TAIR|locus:2054366 ABCA1 "ATP-binding cassette A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 6477 (2285.1 bits), Expect = 0., P = 0.
 Identities = 1266/1810 (69%), Positives = 1472/1810 (81%)

Query:     1 MGTAKRHLKAMLRKNWLLKVRHPFVTAAEILLPTVVMLLLIAVRTRVDTRIHPAQPYIRK 60
             MG++KR  KAMLRKNWLLK RHPFVT+AEILLPT+VMLLLIAVRTRVDT IHPA   I K
Sbjct:     1 MGSSKRQFKAMLRKNWLLKTRHPFVTSAEILLPTIVMLLLIAVRTRVDTTIHPAHSNIDK 60

Query:    61 DMFVEIGKGVSPNFVQALELMLAKGEYLAFAPDTEETRTMINLMSIKFPKLKLVSRIYKD 120
             D  VE+GKG SP+F + L+L+LA+G++LAFAPDT+ET  MI+++S+KFP+L+LV++I+KD
Sbjct:    61 DTVVEVGKGNSPSFPEVLKLLLAEGDFLAFAPDTDETNNMIDILSLKFPELRLVTKIFKD 120

Query:   121 ELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQGPELFDYSIRLNHTWAFSGFPDVK 180
             ++ELETYI S  YG CS+V++C NPKIKGAVVFH+QGP LFDYSIRLNHTWAF+GFP+VK
Sbjct:   121 DIELETYITSAHYGVCSEVRNCSNPKIKGAVVFHEQGPHLFDYSIRLNHTWAFAGFPNVK 180

Query:   181 TIMDTNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIP 240
             +IMDTNGPY+NDLE+G+N IPTMQYSFSGFLTLQQV+DSFIIFA+QQ        ++ + 
Sbjct:   181 SIMDTNGPYINDLEMGINTIPTMQYSFSGFLTLQQVVDSFIIFASQQNN------DLPLS 234

Query:   241 PSNLSGTHLSLKQPWTLYSPSNIRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISR 300
              SNLS   L  + PWTL+SPS IRMVPFPTREYTDDEFQSI+K VMG+LYLLGFL+PISR
Sbjct:   235 HSNLSSA-LRFELPWTLFSPSVIRMVPFPTREYTDDEFQSIVKSVMGLLYLLGFLFPISR 293

Query:   301 LISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSSGIITACTMDSLFKYSDK 360
             LISYSVFEKEQKIREGLYMMGLKD IFHLSWFITYA QFA+ SGIITACTM SLFKYSDK
Sbjct:   294 LISYSVFEKEQKIREGLYMMGLKDEIFHLSWFITYALQFALCSGIITACTMGSLFKYSDK 353

Query:   361 TVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTVNDEAVPMVLKV 420
             T+VFTYFF FGLSAI LSF ISTFF RAKTAVAVGTL+FLGAFFPYYTVNDE+V MVLKV
Sbjct:   354 TLVFTYFFLFGLSAIMLSFMISTFFTRAKTAVAVGTLTFLGAFFPYYTVNDESVSMVLKV 413

Query:   421 IASLLSPTAFALGSVNFADYERAHVGLRWSNMWRASSGVNFXXXXXXXXXXXXXYGVIGL 480
             +ASLLSPTAFALGS+NFADYERAHVGLRWSN+WRASSGV+F             Y  +GL
Sbjct:   414 VASLLSPTAFALGSINFADYERAHVGLRWSNIWRASSGVSFFVCLLMMLLDSILYCALGL 473

Query:   481 YLDKVLPKENGVRYRWNFIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACE 540
             YLDKVLP+ENGVRY WNFIF   F RKK+ +++ +   E  +      + E     +  +
Sbjct:   474 YLDKVLPRENGVRYPWNFIFSKYFGRKKNNLQNRIPGFETDM---FPADIEVNQG-EPFD 529

Query:   541 PVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGA 600
             PV E+ISL+M+QQE+DGRCIQ+R LHKVYA++RGNCCAVNSLQLTLYENQIL+LLGHNGA
Sbjct:   530 PVFESISLEMRQQELDGRCIQVRNLHKVYASRRGNCCAVNSLQLTLYENQILSLLGHNGA 589

Query:   601 GKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMF 660
             GKSTTISMLVGL+PPT+GDAL+ G +I  +MDEIRK LGVCPQ+DILFPELTVREHLEMF
Sbjct:   590 GKSTTISMLVGLLPPTSGDALILGNSIITNMDEIRKELGVCPQHDILFPELTVREHLEMF 649

Query:   661 AVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDE 720
             AVLKGV+E  L+S V +M +EVGL+DK+N +VRALSGGMKRKLSLGIALIG+SKV+ILDE
Sbjct:   650 AVLKGVEEGSLKSTVVDMAEEVGLSDKINTLVRALSGGMKRKLSLGIALIGNSKVIILDE 709

Query:   721 PTSGMDPYSMRLTWQXXXXXXXXXXXXXTTHSMDEAEELGDRIAIMANGSLKCCGSSLFL 780
             PTSGMDPYSMRLTWQ             TTHSMDEAEELGDRI IMANGSLKCCGSS+FL
Sbjct:   710 PTSGMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIGIMANGSLKCCGSSIFL 769

Query:   781 KHQYGVGYTLTLVKSAPDASAAADIVYRHIPSALCVSEVGTEITFKLPLASSSSFESMFR 840
             KH YGVGYTLTLVK++P  S AA IV+RHIPSA CVSEVG EI+FKLPLAS   FE+MFR
Sbjct:   770 KHHYGVGYTLTLVKTSPTVSVAAHIVHRHIPSATCVSEVGNEISFKLPLASLPCFENMFR 829

Query:   841 EIESCIRKSVSKVEADATEDTDYLGIESFGISVTTLEEVFLRVAGCNLD---ESECI--- 894
             EIESC++ SV + +    ED+DY GI+S+GISVTTLEEVFLRVAGCNLD   + E I   
Sbjct:   830 EIESCMKNSVDRSKISEIEDSDYPGIQSYGISVTTLEEVFLRVAGCNLDIEDKQEDIFVS 889

Query:   895 -SQRNNLVTLDYVSAESDDQAPKRISNCKLFGNYKWVFGFIVTVVQRACTLIVAAVLGFL 953
                +++LV +   S +     PK +++C   G      G I+T V +A  LIVAAV   +
Sbjct:   890 PDTKSSLVCIG--SNQKSSMQPKLLASCN-DGA-----GVIITSVAKAFRLIVAAVWTLI 941

Query:   954 NFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIXXXXXXXXXXX 1013
              F+  +CC C IISRSMFW+HCKALFIKRA SA RDRKT+ FQ +IPA+           
Sbjct:   942 GFISIQCCGCSIISRSMFWRHCKALFIKRARSACRDRKTVAFQFIIPAVFLLFGLLFLQL 1001

Query:  1014 XPHPDMLSVTFTTSNFNPLLSXXXXXXPIPFDLSWPIANEVSKYIQGGWIQRFKQSSYRF 1073
              PHPD  S+T TT+ FNPLLS      PIPFDLS PIA EV++YI+GGWIQ  + +SY+F
Sbjct:  1002 KPHPDQKSITLTTAYFNPLLSGKGGGGPIPFDLSVPIAKEVAQYIEGGWIQPLRNTSYKF 1061

Query:  1074 PNXXXXXXXXXXXXGPTLGPVLLSMSEYLMSSFNESYQSRYGAIVMDDQNDDGSLGFTVL 1133
             PN            GPTLGP LLSMSE+LMSSF++SYQSRYG+I+MD Q+ DGSLG+TVL
Sbjct:  1062 PNPKEALADAIDAAGPTLGPTLLSMSEFLMSSFDQSYQSRYGSILMDGQHPDGSLGYTVL 1121

Query:  1134 HNSSCQHAGPTFINVMNTAILRLATGNRNMTIRTRNHPLPTTQSQQLQRHDLDXXXXXXX 1193
             HN +CQHAGP +INVM+ AILRLATGN+NMTI+TRNHPLP T++Q++QRHDLD       
Sbjct:  1122 HNGTCQHAGPIYINVMHAAILRLATGNKNMTIQTRNHPLPPTKTQRIQRHDLDAFSAAII 1181

Query:  1194 XXXXXXXXXXXXXXXXVKEREVKAKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIIL 1253
                             VKEREVKAK QQLISGVSVLSYW STY+WDFISFLFPS+ AIIL
Sbjct:  1182 VNIAFSFIPASFAVPIVKEREVKAKHQQLISGVSVLSYWLSTYVWDFISFLFPSTFAIIL 1241

Query:  1254 FYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDHTMAQNVVLLVHFFTGLI 1313
             FY FGL+QF+G G  LPTVL+ L YGLAIASSTYCLTFFF++H+MAQNV+L+VHFF+GLI
Sbjct:  1242 FYAFGLEQFIGIGRFLPTVLMLLEYGLAIASSTYCLTFFFTEHSMAQNVILMVHFFSGLI 1301

Query:  1314 LMVISFIMGLLEATRSANSLLKNFFRLSPGFCFADGLASLALLRQGMKDKTSDGVFDWNV 1373
             LMVISF+MGL+ AT SANS LKNFFRLSPGFCF+DGLASLALLRQGMKDK+S GVF+WNV
Sbjct:  1302 LMVISFVMGLIPATASANSYLKNFFRLSPGFCFSDGLASLALLRQGMKDKSSHGVFEWNV 1361

Query:  1374 TSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQS 1433
             T ASICYLG ESI YFL+TLGLEL+P  K    +I EWW+  +       SS  EPLL+ 
Sbjct:  1362 TGASICYLGLESIFYFLVTLGLELMPVQKVMSFSIGEWWQNLKAFKQGAGSSSTEPLLKD 1421

Query:  1434 SSESDTLDLNEDIDVQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSV 1493
             S+ + + D+ +DIDVQ ER+RV+SG  DN ++YL+NLRKVYPG K    KVAV SLTFSV
Sbjct:  1422 STGAISTDMEDDIDVQEERDRVISGLSDNTMLYLQNLRKVYPGDKHHGPKVAVQSLTFSV 1481

Query:  1494 QAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDA 1553
             QAGECFGFLGTNGAGKTTTLSM+SGEE PT GTAFIFGKDI + PKA R+ IGYCPQFDA
Sbjct:  1482 QAGECFGFLGTNGAGKTTTLSMLSGEETPTSGTAFIFGKDIVASPKAIRQHIGYCPQFDA 1541

Query:  1554 LLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVA 1613
             L EYLTV+EHLELYARIKGV ++R+D+VV EKLVEFDLLKH+ KPSFTLSGGNKRKLSVA
Sbjct:  1542 LFEYLTVKEHLELYARIKGVVDHRIDNVVTEKLVEFDLLKHSHKPSFTLSGGNKRKLSVA 1601

Query:  1614 IAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRI 1673
             IAMIGDPPIVILDEPSTGMDP+AKRFMW+VISRLSTR GKTAVILTTHSMNEAQALCTRI
Sbjct:  1602 IAMIGDPPIVILDEPSTGMDPVAKRFMWDVISRLSTRSGKTAVILTTHSMNEAQALCTRI 1661

Query:  1674 GIMVGGQLRCIGSPQHLKTRFGNFLELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSL 1733
             GIMVGG+LRCIGSPQHLKTR+GN LELEVKP EVS+V+LE+ CQIIQ+ +F++P+Q RSL
Sbjct:  1662 GIMVGGRLRCIGSPQHLKTRYGNHLELEVKPNEVSNVELENFCQIIQQWLFNVPTQPRSL 1721

Query:  1734 LDDLEVCIGGIDSISSENATAAEISLSQEMLLIVGRWLGNEERIKTLISSSSSPDRIFGE 1793
             L DLEVCIG  DSI+ + A+A+EISLS EM+  + ++LGNE+R+ TL+      D  F +
Sbjct:  1722 LGDLEVCIGVSDSITPDTASASEISLSPEMVQRIAKFLGNEQRVSTLVPPLPEEDVRFDD 1781

Query:  1794 QLSEQLVRDG 1803
             QLSEQL RDG
Sbjct:  1782 QLSEQLFRDG 1791




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
ZFIN|ZDB-GENE-050517-1 abca2 "ATP-binding cassette, sub-family A (ABC1), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZC7 ABCA2 "ATP-binding cassette sub-family A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QSS3 ABCA2 "ATP-binding cassette sub-family A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620238 Abca2 "ATP-binding cassette, subfamily A (ABC1), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFA0 ABCA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q1F1 ABCA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99758 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCR1 ABCA3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1351617 Abca3 "ATP-binding cassette, sub-family A (ABC1), member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84M24AB1A_ARATHNo assigned EC number0.73080.96940.9442yesno
Q99758ABCA3_HUMANNo assigned EC number0.32360.83190.8949yesno
Q8R420ABCA3_MOUSENo assigned EC number0.32040.83250.8955yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1833
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-115
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-104
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 1e-101
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-96
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-79
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-78
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 3e-64
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 4e-63
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-62
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-60
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-59
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 4e-58
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-52
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 4e-51
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-50
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 2e-49
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 6e-48
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 4e-47
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 4e-46
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 7e-46
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 9e-46
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-45
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-45
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 4e-45
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 5e-45
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-44
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-44
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-44
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-44
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 8e-43
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 5e-42
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 6e-42
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 9e-42
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-41
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 4e-41
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 6e-41
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 4e-40
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 4e-40
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-39
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 3e-39
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-39
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 5e-39
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 5e-39
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 6e-39
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 9e-39
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-38
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-38
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-37
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-37
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 4e-37
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-37
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 4e-37
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 6e-37
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 6e-37
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 7e-37
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 9e-37
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-36
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 4e-36
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-36
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-35
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-35
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-35
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 7e-35
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 9e-35
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 1e-34
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-34
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-34
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-34
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-34
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-33
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-33
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 2e-33
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-33
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 4e-33
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 5e-33
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 5e-33
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 8e-33
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 9e-33
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-32
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 1e-32
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-32
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-32
cd03234226 cd03234, ABCG_White, White pigment protein homolog 3e-32
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 3e-32
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-32
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-32
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 5e-32
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 7e-32
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-31
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-31
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 2e-31
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-31
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 3e-31
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 6e-31
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 7e-31
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 7e-31
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-30
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-30
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-30
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-30
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 3e-30
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-30
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-30
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 5e-30
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 8e-30
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 8e-30
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 9e-30
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 9e-30
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-29
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-29
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-29
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-29
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 4e-29
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 4e-29
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 9e-29
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 9e-29
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-28
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-28
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-28
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-28
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-28
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-28
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 3e-28
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 5e-28
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 7e-28
COG1123539 COG1123, COG1123, ATPase components of various ABC 8e-28
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 9e-28
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-27
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-27
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-27
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 2e-27
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-27
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 2e-27
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 2e-27
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 3e-27
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 4e-27
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 6e-27
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 6e-27
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 7e-27
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 7e-27
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 1e-26
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-26
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-26
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-26
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 8e-26
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 8e-26
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 9e-26
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 9e-26
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 9e-26
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-25
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-25
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 2e-25
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-25
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-25
COG1117253 COG1117, PstB, ABC-type phosphate transport system 3e-25
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-25
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-25
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 4e-25
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 5e-25
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 8e-25
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-24
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 2e-24
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 2e-24
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-24
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 3e-24
COG4525259 COG4525, TauB, ABC-type taurine transport system, 3e-24
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 3e-24
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-24
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 4e-24
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 4e-24
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 5e-24
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 6e-24
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 6e-24
COG4988559 COG4988, CydD, ABC-type transport system involved 6e-24
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 7e-24
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 7e-24
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 7e-24
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 8e-24
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 9e-24
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-23
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-23
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-23
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-23
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-23
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 2e-23
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-23
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 2e-23
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 3e-23
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 3e-23
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 3e-23
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-23
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 6e-23
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 6e-23
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 7e-23
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 7e-23
COG4988559 COG4988, CydD, ABC-type transport system involved 8e-23
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 1e-22
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-22
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-22
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 2e-22
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-22
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 3e-22
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 3e-22
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 4e-22
COG4525259 COG4525, TauB, ABC-type taurine transport system, 4e-22
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 4e-22
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 5e-22
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 5e-22
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 6e-22
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 6e-22
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 6e-22
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 7e-22
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 9e-22
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-21
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 1e-21
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 1e-21
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-21
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-21
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 2e-21
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 2e-21
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 2e-21
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 2e-21
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 2e-21
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 3e-21
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-21
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 3e-21
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 3e-21
COG4133209 COG4133, CcmA, ABC-type transport system involved 3e-21
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 4e-21
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 5e-21
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 7e-21
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 8e-21
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 8e-21
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 9e-21
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 9e-21
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 9e-21
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-20
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-20
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 1e-20
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 1e-20
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-20
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 2e-20
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 2e-20
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-20
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-20
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-20
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 2e-20
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-20
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 3e-20
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-20
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 5e-20
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 5e-20
pfam12698278 pfam12698, ABC2_membrane_3, ABC-2 family transport 5e-20
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 9e-20
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 1e-19
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-19
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 2e-19
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-19
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-19
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-19
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-19
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-19
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-19
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 3e-19
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 3e-19
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 3e-19
COG4987573 COG4987, CydC, ABC-type transport system involved 3e-19
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 3e-19
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 4e-19
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 5e-19
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 5e-19
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 5e-19
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 5e-19
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 5e-19
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 5e-19
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 6e-19
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 6e-19
COG0488530 COG0488, Uup, ATPase components of ABC transporter 6e-19
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 7e-19
COG1117253 COG1117, PstB, ABC-type phosphate transport system 9e-19
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 9e-19
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 9e-19
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 9e-19
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 9e-19
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-18
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 1e-18
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-18
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-18
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-18
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 2e-18
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-18
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 2e-18
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 3e-18
COG4133209 COG4133, CcmA, ABC-type transport system involved 3e-18
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 3e-18
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-18
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-18
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 3e-18
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 3e-18
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 4e-18
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 6e-18
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 6e-18
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-18
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 6e-18
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 6e-18
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 6e-18
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 7e-18
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 7e-18
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 7e-18
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 7e-18
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 7e-18
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 8e-18
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 8e-18
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 8e-18
COG4148352 COG4148, ModC, ABC-type molybdate transport system 9e-18
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 9e-18
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 1e-17
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-17
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 1e-17
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 1e-17
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 1e-17
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 2e-17
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-17
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-17
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-17
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 3e-17
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 3e-17
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-17
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 3e-17
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 3e-17
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 3e-17
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 4e-17
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 4e-17
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 4e-17
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 4e-17
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 5e-17
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 5e-17
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 6e-17
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 6e-17
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 6e-17
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 7e-17
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 7e-17
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 9e-17
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 9e-17
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 1e-16
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 1e-16
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-16
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 1e-16
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-16
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-16
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 3e-16
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 4e-16
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 4e-16
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 4e-16
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 5e-16
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 5e-16
COG4598256 COG4598, HisP, ABC-type histidine transport system 5e-16
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 6e-16
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 6e-16
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 7e-16
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 7e-16
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 7e-16
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 8e-16
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 9e-16
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 9e-16
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 1e-15
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-15
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 1e-15
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 1e-15
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-15
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-15
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 2e-15
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 2e-15
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-15
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 2e-15
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 2e-15
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-15
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-15
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 3e-15
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-15
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 3e-15
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 3e-15
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 4e-15
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 4e-15
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 4e-15
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 5e-15
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 5e-15
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 6e-15
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 6e-15
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 7e-15
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 8e-15
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 8e-15
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 1e-14
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 1e-14
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 1e-14
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-14
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 1e-14
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 1e-14
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 1e-14
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 1e-14
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-14
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-14
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 2e-14
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 2e-14
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 2e-14
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-14
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 2e-14
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 2e-14
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 2e-14
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 3e-14
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 3e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 4e-14
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-14
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 4e-14
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 5e-14
COG0488530 COG0488, Uup, ATPase components of ABC transporter 6e-14
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 6e-14
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 6e-14
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 6e-14
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 6e-14
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 7e-14
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 7e-14
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 8e-14
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 8e-14
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 8e-14
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP- 8e-14
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 9e-14
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 9e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-13
pfam12698278 pfam12698, ABC2_membrane_3, ABC-2 family transport 1e-13
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 1e-13
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 1e-13
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 1e-13
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-13
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-13
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-13
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 2e-13
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 2e-13
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 2e-13
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-13
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 3e-13
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 3e-13
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 3e-13
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 4e-13
COG4148352 COG4148, ModC, ABC-type molybdate transport system 4e-13
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 4e-13
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 5e-13
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 5e-13
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 5e-13
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 5e-13
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 5e-13
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-13
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-13
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 6e-13
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 6e-13
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 7e-13
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 7e-13
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 8e-13
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 8e-13
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 8e-13
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 9e-13
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 9e-13
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 9e-13
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 1e-12
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 1e-12
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 1e-12
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-12
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 2e-12
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 3e-12
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-12
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-12
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-12
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-12
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 4e-12
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 4e-12
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 4e-12
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 4e-12
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 4e-12
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 4e-12
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 5e-12
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 5e-12
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 5e-12
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 6e-12
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 6e-12
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 7e-12
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 7e-12
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 7e-12
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 8e-12
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 8e-12
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 8e-12
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 9e-12
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 1e-11
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-11
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-11
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 1e-11
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 1e-11
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 1e-11
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 1e-11
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 1e-11
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 1e-11
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-11
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 1e-11
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-11
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-11
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-11
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-11
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 2e-11
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-11
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-11
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 2e-11
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 2e-11
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 2e-11
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 3e-11
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 3e-11
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 4e-11
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-11
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 4e-11
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 4e-11
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 4e-11
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 4e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system 5e-11
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 5e-11
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 5e-11
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 5e-11
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 6e-11
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 6e-11
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 6e-11
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 6e-11
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 7e-11
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 7e-11
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 8e-11
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 1e-10
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 1e-10
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 1e-10
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 2e-10
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 2e-10
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-10
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 2e-10
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-10
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 3e-10
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 3e-10
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 3e-10
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 3e-10
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 3e-10
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 3e-10
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 4e-10
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 4e-10
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 4e-10
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 4e-10
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 4e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 5e-10
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-10
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 7e-10
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 7e-10
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 8e-10
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 8e-10
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 8e-10
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 9e-10
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 1e-09
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 1e-09
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-09
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-09
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-09
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 1e-09
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 1e-09
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 1e-09
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 1e-09
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 1e-09
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-09
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 2e-09
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 2e-09
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 2e-09
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-09
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-09
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-09
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-09
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 3e-09
PRK13545549 PRK13545, tagH, teichoic acids export protein ATP- 3e-09
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-09
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-09
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 3e-09
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-09
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 3e-09
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-09
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 4e-09
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 4e-09
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 4e-09
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 5e-09
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 6e-09
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 7e-09
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 7e-09
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 8e-09
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 9e-09
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 9e-09
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-08
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-08
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-08
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 1e-08
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 1e-08
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 2e-08
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-08
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 3e-08
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 3e-08
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 3e-08
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 3e-08
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 3e-08
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 4e-08
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 4e-08
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 4e-08
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 5e-08
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 5e-08
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 6e-08
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 7e-08
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 7e-08
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 7e-08
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 8e-08
COG5265497 COG5265, ATM1, ABC-type transport system involved 8e-08
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 9e-08
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 9e-08
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 1e-07
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 1e-07
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 2e-07
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 3e-07
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 3e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 3e-07
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 3e-07
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 3e-07
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 3e-07
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 4e-07
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 4e-07
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 4e-07
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 5e-07
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 6e-07
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 6e-07
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 7e-07
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 7e-07
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 7e-07
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 9e-07
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 1e-06
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 1e-06
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 2e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 2e-06
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 2e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-06
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-06
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 2e-06
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 2e-06
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 3e-06
pfam13304256 pfam13304, AAA_21, AAA domain 3e-06
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 4e-06
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 4e-06
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 5e-06
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 6e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 6e-06
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 7e-06
pfam13304256 pfam13304, AAA_21, AAA domain 7e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 9e-06
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 9e-06
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 9e-06
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 9e-06
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 1e-05
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 1e-05
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-05
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-05
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 2e-05
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 2e-05
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 3e-05
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 3e-05
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 4e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 4e-05
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 4e-05
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 5e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 5e-05
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 7e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 9e-05
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 9e-05
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 1e-04
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 1e-04
cd03240204 cd03240, ABC_Rad50, ATP-binding cassette domain of 1e-04
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-04
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-04
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 2e-04
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-04
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 2e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 2e-04
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 2e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-04
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 3e-04
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 3e-04
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 4e-04
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 4e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-04
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 7e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 7e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 7e-04
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.001
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 0.002
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.002
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.002
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 0.003
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.003
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 0.003
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 0.004
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 0.004
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 0.004
cd03240204 cd03240, ABC_Rad50, ATP-binding cassette domain of 0.004
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
 Score =  407 bits (1046), Expect = e-115
 Identities = 241/681 (35%), Positives = 366/681 (53%), Gaps = 98/681 (14%)

Query: 263  IRMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGL 322
            ++ +P+P   + DD F  I+ R   +  +L ++Y +S  +   V EKE +++E L   G+
Sbjct: 634  LQQMPYPC--FVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGV 691

Query: 323  KDGIFHLSWFITYAAQFAVSSGIITACTMDS-LFKYSDKTVVFTYFFSFGLSAITLSFFI 381
             + +   +WF+   +  ++S  ++T   M   +  YSD  ++F +  +F  + I   F +
Sbjct: 692  SNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMQCFLL 751

Query: 382  STFFARAKTAVAVGTLSFLGAFFPY---YTVNDEAVPMVLKVIASLLSPTAFALGSVNFA 438
            STFF++A  A A   + +   + P+   +   D  +   LK   SLLSP AF  G+    
Sbjct: 752  STFFSKASLAAACSGVIYFTLYLPHILCFAWQDR-MTADLKTAVSLLSPVAFGFGTEYLV 810

Query: 439  DYERAHVGLRWSNMWRA---SSGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYR 495
             +E   +GL+WSN+  +       +FL+ + MMLLD  LYG++  YLD+V P + G    
Sbjct: 811  RFEEQGLGLQWSNIGNSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLP 870

Query: 496  WNFIFQN--------CFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALDACEPVVEAIS 547
            W F+ Q         C  R++  ++           + L++E E     D   P  E I+
Sbjct: 871  WYFLLQESYWLGGEGCSTREERALEK---------TEPLTEEME-----DPEHP--EGIN 914

Query: 548  LDMKQQE----VDGRCIQIRKLHKVYATKRGNCCAVNSLQLTLYENQILALLGHNGAGKS 603
                ++E    V G C+  + L K++  +     AV+ L +T YENQI A LGHNGAGK+
Sbjct: 915  DSFFERELPGLVPGVCV--KNLVKIF--EPSGRPAVDRLNITFYENQITAFLGHNGAGKT 970

Query: 604  TTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREHLEMFAVL 663
            TT+S+L GL+PPT+G  LV GK+I  ++D +R+ LG+CPQ++ILF  LTV EH+  +A L
Sbjct: 971  TTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTVAEHILFYAQL 1030

Query: 664  KGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTS 723
            KG   E  +  +  M+++ GL  K N   + LSGGM+RKLS+ IA +GD+KVV+LDEPTS
Sbjct: 1031 KGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVVLDEPTS 1090

Query: 724  GMDPYSMRLTWQLIKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQ 783
            G+DPYS R  W L+ K + GR I+++TH MDEA+ LGDRIAI++ G L C G+ LFLK+ 
Sbjct: 1091 GVDPYSRRSIWDLLLKYRSGRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNC 1150

Query: 784  YGVGYTLTLVKSAP---------------------------------------DASAAAD 804
            +G G+ LTLV+                                          D +   D
Sbjct: 1151 FGTGFYLTLVRKMKNIQSQRGGCEGTCSCTSKGFSTRCPARVDEITPEQVLDGDVNELMD 1210

Query: 805  IVYRHIPSALCVSEVGTEITFKLPLAS--SSSFESMFREIESCIRKSVSKVEADATEDTD 862
            +VY H+P A  V  +G E+ F LP  +    ++ S+FRE+E  +        AD      
Sbjct: 1211 LVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETL--------AD------ 1256

Query: 863  YLGIESFGISVTTLEEVFLRV 883
             LG+ SFGIS T LEE+FL+V
Sbjct: 1257 -LGLSSFGISDTPLEEIFLKV 1276


This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease [Transport and binding proteins, Other]. Length = 2272

>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|221721 pfam12698, ABC2_membrane_3, ABC-2 family transporter protein Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|221721 pfam12698, ABC2_membrane_3, ABC-2 family transporter protein Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1833
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
KOG0059885 consensus Lipid exporter ABCA1 and related protein 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
KOG0059885 consensus Lipid exporter ABCA1 and related protein 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
Probab=100.00  E-value=3.3e-210  Score=2134.26  Aligned_cols=1544  Identities=33%  Similarity=0.539  Sum_probs=1168.9

Q ss_pred             ceeEEcCChHHHHHHHHhccCCCccccccCCCCceEEEEEEecC------CCCeeEEEEEecCcccccCCCccccccc--
Q 000224          113 LVSRIYKDELELETYIRSDLYGTCSQVKDCLNPKIKGAVVFHDQ------GPELFDYSIRLNHTWAFSGFPDVKTIMD--  184 (1833)
Q Consensus       113 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~c~~~~~~~~vvF~~~------~~~~~~Y~ir~~~~~~~~~~~~~~~~~~--  184 (1833)
                      +..++++||++|++.-.....          +.+++|||+|++.      .|..++|+||+|.+.    .|+++...+  
T Consensus       523 d~~~~~~~~~~~~~~~~~l~~----------~~~~~agI~F~~~~~~~~~~p~~v~y~IR~~~~~----~~~t~~~~~~~  588 (2272)
T TIGR01257       523 DKFESYDDEVQLTQRALSLLE----------ENRFWAGVVFPDMYPWTSSLPPHVKYKIRMDIDV----VEKTNKIKDRY  588 (2272)
T ss_pred             cceecCCCHHHHHHHHHHHhh----------cCCeEEEEEeCCCcccccCCCCceEEEEecCccc----cCcchhhcccc
Confidence            446789999999876544321          3468999999764      257899999999752    222221111  


Q ss_pred             -CCCCCCcccccCCCCcCCccchhhhhhHHHHHHHHHHHHHhhhcCCccccccccCCCCCCCCCccccCCCccccCCcce
Q 000224          185 -TNGPYLNDLELGVNIIPTMQYSFSGFLTLQQVLDSFIIFAAQQTGANVATENVEIPPSNLSGTHLSLKQPWTLYSPSNI  263 (1833)
Q Consensus       185 -~~~~~~~~~~~g~~~~~~~~Y~~~gFl~lQ~~id~aii~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  263 (1833)
                       ..||+....       .+.+|+.+||++||++||+||++...+.    .                         ....+
T Consensus       589 w~~g~~~~~~-------~~~~Y~~~GFl~lQ~ai~~aii~~~~~~----~-------------------------~~~~v  632 (2272)
T TIGR01257       589 WDSGPRADPV-------EDFRYIWGGFAYLQDMVEQGITRSQMQA----E-------------------------PPVGI  632 (2272)
T ss_pred             ccCCCCCCcc-------ccccHHHhhHHHHHHHHHHHHHHhhcCC----C-------------------------cccce
Confidence             134443211       1247999999999999999999743211    0                         01246


Q ss_pred             eeeccCCCcccchHHHHHHHHHHHHHHHHHHHhHHHHHhHHHHHHHHHhHHHHHHHcCCCchHHHHHHHHHHHHHHHHHH
Q 000224          264 RMVPFPTREYTDDEFQSIIKRVMGVLYLLGFLYPISRLISYSVFEKEQKIREGLYMMGLKDGIFHLSWFITYAAQFAVSS  343 (1833)
Q Consensus       264 ~~~~~p~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~iv~EKe~~lke~m~~mGl~~~~~wlsw~i~~~~~~~i~~  343 (1833)
                      .+++||+|+|.+|.|...+..++|++++++|+|+++.+++.||.|||+|+||+|+||||++++||+|||+.+++..++++
T Consensus       633 ~~q~~P~P~y~~d~~l~~~~~~~pl~~~la~~~~~~~lv~~iV~EKE~rlKE~MkiMGL~~~~~w~sWfi~~~~~~~i~~  712 (2272)
T TIGR01257       633 YLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSI  712 (2272)
T ss_pred             eeeeCCCCCeeccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999998888877


Q ss_pred             HHHHHH-HhcccccccChhhhHHHHHHHHHHHHHHHHHHHHhcCchhHHHHHHHHHHHHHHhhhhcc--cCCCchhHHhH
Q 000224          344 GIITAC-TMDSLFKYSDKTVVFTYFFSFGLSAITLSFFISTFFARAKTAVAVGTLSFLGAFFPYYTV--NDEAVPMVLKV  420 (1833)
Q Consensus       344 ~i~~~~-~~~~~f~~s~~~~~f~~~~l~~~s~i~~~f~iS~fF~~~~~a~~~~~l~~~~~~~~~~~~--~~~~~~~~~~~  420 (1833)
                      ++++++ ....+|++||++++|+++++|++++|+||||+|+||+|+++|+++++++||++++|+++.  .....+...++
T Consensus       713 ~l~~~il~~~~~~~~s~~~~lfl~~~~y~~s~I~~~fliS~fFska~~A~~~~~li~f~~~lp~~~~~~~~~~~~~~~~~  792 (2272)
T TIGR01257       713 FLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMQCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTADLKT  792 (2272)
T ss_pred             HHHHHHHhhCceeecCChHHHHHHHHHHHHHHHHHHHHHHHHhCchHHHHHHHHHHHHHHHHHHHHHhhcccccCHHHHH
Confidence            776654 356799999999999999999999999999999999999999999999999999998632  33445667899


Q ss_pred             HHhhhchhHHHHHHHHHHHHhhccCCccccccccCC---CCchHHHHHHHHHHHHHHHHHHHHHHhccccCCCCcccccc
Q 000224          421 IASLLSPTAFALGSVNFADYERAHVGLRWSNMWRAS---SGVNFLVCLLMMLLDTLLYGVIGLYLDKVLPKENGVRYRWN  497 (1833)
Q Consensus       421 ~~sl~~~~a~~~~~~~~~~~e~~~~g~~~~~~~~~~---~~~~~~~~~~~l~~~~~ly~~l~~yld~v~p~~~G~~~p~~  497 (1833)
                      ++||+||+||++|+..++.+|.++.|++|+|++..+   ++++++.+++||++|+++|++|+||+|+|+|++||+++|||
T Consensus       793 ~~sL~sp~af~~g~~~i~~~e~~~~G~~w~n~~~~~~~~d~~s~~~~~~ml~~d~~lY~lL~~Yld~V~PgeyG~~kpw~  872 (2272)
T TIGR01257       793 AVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWY  872 (2272)
T ss_pred             HHHhcCHHHHHHHHHHHHHHhhhCCCcccccccccccCCCCccHHHHHHHHHHHHHHHHHHHHHHhhcCcCCCCCCCCcc
Confidence            999999999999999999999999999999998643   45789999999999999999999999999999999999999


Q ss_pred             ccccccccCccccccccccchhHHhhhhhhhhhhhhhccc-cCcchhhhhhhhccccccCcceEEEEeeEEEecCCCCcc
Q 000224          498 FIFQNCFRRKKSVIKHHVSSAEVKINKKLSKEKECAFALD-ACEPVVEAISLDMKQQEVDGRCIQIRKLHKVYATKRGNC  576 (1833)
Q Consensus       498 f~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~e~~~~~~~~~~~~~~~i~i~~l~k~y~~~~~~~  576 (1833)
                      |||+++||+++........ ......+...++.......+ ..+..+|+.     ..+ ....|+++||+|.|++  +++
T Consensus       873 F~~~~syW~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~-----~~~-~~~~L~I~nLsK~y~~--~~k  943 (2272)
T TIGR01257       873 FLLQESYWLGGEGCSTREE-RALEKTEPLTEEMEDPEHPEGINDSFFERE-----LPG-LVPGVCVKNLVKIFEP--SGR  943 (2272)
T ss_pred             cccchhhhcCCcccccccc-cccccccccccccccccccccccccccccc-----cCC-CCceEEEEeEEEEecC--CCc
Confidence            9999999976532110000 00000000000000000000 000011111     111 1257999999999953  235


Q ss_pred             cceeeeeEEEeCCeEEEEecCCCCChHHHHHHHcCCCCCCcceEEEcCccCCccHHHhhcceEEEccCCCCCCCCCHHHH
Q 000224          577 CAVNSLQLTLYENQILALLGHNGAGKSTTISMLVGLIPPTTGDALVFGKNITADMDEIRKGLGVCPQYDILFPELTVREH  656 (1833)
Q Consensus       577 ~al~~vsl~i~~Gei~~llG~NGaGKSTll~~l~Gl~~p~~G~i~i~g~~i~~~~~~~r~~ig~~~Q~~~l~~~lTv~e~  656 (1833)
                      .||+|+||++++||+++|+||||||||||+++|+|+++|++|+|.++|+++..+..++|+.+|+|||++.+++.+||+||
T Consensus       944 ~aL~~lsl~I~~Gei~aLLG~NGAGKSTLLkiLaGLl~PtsG~I~i~G~dI~~~~~~~r~~IG~~pQ~~~L~~~LTV~E~ 1023 (2272)
T TIGR01257       944 PAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTVAEH 1023 (2272)
T ss_pred             eEEEeeEEEEcCCcEEEEECCCCChHHHHHHHHhcCCCCCceEEEECCEECcchHHHHhhcEEEEecCCcCCCCCCHHHH
Confidence            69999999999999999999999999999999999999999999999999977777788999999999999999999999


Q ss_pred             HHHHHHhcCCCHHHHHHHHHHHHHHcCCCcccccccCCCChhHHHHHHHHHHHhCCCcEEEEeCCCCCCCHHHHHHHHHH
Q 000224          657 LEMFAVLKGVKEELLESVVAEMVDEVGLADKVNIVVRALSGGMKRKLSLGIALIGDSKVVILDEPTSGMDPYSMRLTWQL  736 (1833)
Q Consensus       657 l~~~~~~~~~~~~~~~~~v~~~l~~~~L~~~~~~~~~~LSgGqkqrl~lA~al~~~p~vliLDEPtsgLD~~~r~~l~~~  736 (1833)
                      +.++++++|.+.++.+++++++++.+||.++.++++++|||||||||+|||||+++|+||||||||+||||.+|+.+|++
T Consensus      1024 L~f~~~lkg~~~~~~~~~v~~lL~~vgL~~~~~~~~~~LSGGqKQRLsLArALi~~PkVLLLDEPTSGLDp~sr~~l~~l 1103 (2272)
T TIGR01257      1024 ILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDL 1103 (2272)
T ss_pred             HHHHHHhcCCCHHHHHHHHHHHHHHcCCchhhcCChhhCCHHHHHHHHHHHHHHcCCCEEEEECCCcCCCHHHHHHHHHH
Confidence            99999999887777788999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCcEEEEEcCCHHHHHhhcCEEEEeeCCEEEeecCHHHHHhhhCCcEEEEEEecCC-------------------
Q 000224          737 IKKIKKGRIILLTTHSMDEAEELGDRIAIMANGSLKCCGSSLFLKHQYGVGYTLTLVKSAP-------------------  797 (1833)
Q Consensus       737 l~~~~~g~tiil~tH~~~e~~~l~Dri~im~~G~l~~~G~~~~Lk~~~g~gy~l~~~~~~~-------------------  797 (1833)
                      |+++++|+|||++||++++++.+||||++|++|+++|.|++.+||++||.||++++.+...                   
T Consensus      1104 L~~l~~g~TIIltTHdmdea~~laDrI~iL~~GkL~~~Gs~~~Lk~~~g~gy~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 1183 (2272)
T TIGR01257      1104 LLKYRSGRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGTCSCTSKG 1183 (2272)
T ss_pred             HHHHhCCCEEEEEECCHHHHHHhCCEEEEEECCEEEEecCHHHHHHhcCCcEEEEEEecccccccccccccccccccccc
Confidence            9999889999999999999999999999999999999999999999999999999976430                   


Q ss_pred             --------------------ChhhHHHHHHHhCCCceEEeeeCcEEEEEecCCCc--chHHHHHHHHHHhhhhccccccc
Q 000224          798 --------------------DASAAADIVYRHIPSALCVSEVGTEITFKLPLASS--SSFESMFREIESCIRKSVSKVEA  855 (1833)
Q Consensus       798 --------------------~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~p~~~~--~~~~~~~~~le~~~~~~~~~~~~  855 (1833)
                                          +.+.+.+++++++|++.+.++.+.+++|.+|.+..  ..|+.+|++||+..         
T Consensus      1184 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~v~~~iP~a~l~~~~g~el~y~LP~~~~~~~~f~~lf~~Le~~~--------- 1254 (2272)
T TIGR01257      1184 FSTRCPARVDEITPEQVLDGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETL--------- 1254 (2272)
T ss_pred             cccccccccccccccccccccHHHHHHHHHHhCCCcEEEeccCCEEEEEecccccccchHHHHHHHHHhhH---------
Confidence                                23456778899999999999999999999999875  46999999999753         


Q ss_pred             cccccccCCCeeEEEecCCChHHHHHHHhcCCCcchh----hhhhccccccccc-c-ccccCCCCccccccc-cccCCcc
Q 000224          856 DATEDTDYLGIESFGISVTTLEEVFLRVAGCNLDESE----CISQRNNLVTLDY-V-SAESDDQAPKRISNC-KLFGNYK  928 (1833)
Q Consensus       856 ~~~~~~~~~~i~~~~~s~~tlE~vfl~~~~~~~~~~~----~~~~~~~~~~~~~-~-~~~~~~~~~~~~~~~-~~~~~~~  928 (1833)
                            +++||.+|++|.|||||||||++++...+..    ............. . ......+.+...... .......
T Consensus      1255 ------~~lgi~sygis~tTLEeVFlkv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1328 (2272)
T TIGR01257      1255 ------ADLGLSSFGISDTPLEEIFLKVTEDADSGSLFAGGAQQKRENANLRHPCSGPTEKAGQTPQASHTCSPGQPAAH 1328 (2272)
T ss_pred             ------hhCCCceEEeecCCHHHHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                  4799999999999999999999875432110    0000000000000 0 000000000000000 0000000


Q ss_pred             cccceeeeeecchhhhhhHHhhhhhhhhcccccccccccchhHHHHHHHHHHHHHhHhccchhHHHHHHHHHHHHHHHHH
Q 000224          929 WVFGFIVTVVQRACTLIVAAVLGFLNFLIKKCCTCCIISRSMFWQHCKALFIKRAVSARRDRKTIVFQLLIPAIFLLVGL 1008 (1833)
Q Consensus       929 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~al~~Kr~~~~~R~~~~~~~~l~lP~~~~~~~l 1008 (1833)
                             ........             ..........+..+++||++||++||+++++|||+.+++|+++|++++++++
T Consensus      1329 -------~~~~~~~~-------------~~~~~~~~~tg~~L~~qQf~All~KR~~~~~Rd~k~~~~qillPi~fv~lal 1388 (2272)
T TIGR01257      1329 -------PEGQPPPE-------------PEDPGVPLNTGARLILQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLAL 1388 (2272)
T ss_pred             -------cccccccc-------------ccccccccccchhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence                   00000000             0000011234677899999999999999999999999999999999999999


Q ss_pred             HHHhccCC-CCCCccccccccCCCccCCC-CC--------------------CCCc---------ccccCchh-----hh
Q 000224         1009 LFLKLKPH-PDMLSVTFTTSNFNPLLSGG-GG--------------------GGPI---------PFDLSWPI-----AN 1052 (1833)
Q Consensus      1009 ~~~~~~~~-~~~~~~~l~~~~~~~~~~~~-~~--------------------~~~~---------~~~~~~~~-----~~ 1052 (1833)
                      ++....+. .+.|++.++++.|....... ..                    +...         +.....+.     ..
T Consensus      1389 ~~~~~~~~~~~~p~l~Ls~~~Y~~~~~~~s~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1468 (2272)
T TIGR01257      1389 MLSIIIPPFGEYPALTLHPWMYGQQYTFFSMDEPNSEHLEVLADVLLNKPGFGNRCLKEEWLPEYPCGNSTPWKTPSVSP 1468 (2272)
T ss_pred             HHHhhcccccCCCCeecchhhccCcceeccccccccccccchhhhhhcccccccccccccccccccccccccccccchhH
Confidence            88876543 45677888877663221100 00                    0000         00000000     00


Q ss_pred             hhhhhhc-CCcccccccCCCCCCCh--HHHHHHHHHh-cCCC---C---------cchhhchhHHHHHhhhhcc------
Q 000224         1053 EVSKYIQ-GGWIQRFKQSSYRFPNA--EKALADAVDA-AGPT---L---------GPVLLSMSEYLMSSFNESY------ 1110 (1833)
Q Consensus      1053 ~~~~~~~-~~~~~~~~~~~~~~~~~--~~~l~~~~~~-~~~~---~---------~~~~~~~~~~l~~~~~~~~------ 1110 (1833)
                      .+...+. ..|..........+...  .....++... .+..   .         .....++++|+...++...      
T Consensus      1469 ~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~n~sdyll~~~~~~~~~~~~~ 1548 (2272)
T TIGR01257      1469 NITHLFQKQKWTAAHPSPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKS 1548 (2272)
T ss_pred             HHHHHHhhccccccccccccccccccccccccccccccccCCCcccccccchhhhhhcccchHHHHhhhhhhhhcccccc
Confidence            0000000 00000000000000000  0000000000 0000   0         0011245666654433211      


Q ss_pred             -----cceecEEEeecc------------------------------------------CCCCceeEEEEeCCCCCChHH
Q 000224         1111 -----QSRYGAIVMDDQ------------------------------------------NDDGSLGFTVLHNSSCQHAGP 1143 (1833)
Q Consensus      1111 -----~~~~~~~~~~~~------------------------------------------~~~~~~~~~~~~n~~~~hs~p 1143 (1833)
                           ..|||++..+..                                          +.++...+++|||++++|++|
T Consensus      1549 ~~~~~~~ry~~~s~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vwfNn~~~Hs~p 1628 (2272)
T TIGR01257      1549 KFWVNEQRYGGISIGGKLPAIPITGEALVGFLSDLGQMMNVSGGPVTREASKEMPDFLKHLETEDNIKVWFNNKGWHALV 1628 (2272)
T ss_pred             ccccccccccccccccccccccccchhhhhhhhhcccccccccccccccccchhhhhhhccccCcceEEEEcCCcccHHH
Confidence                 134443321100                                          001123468999999999999


Q ss_pred             HHHHHHHHHHHHHhcCC----CcceEEEEeecCCCchhhhhhh---cchhhhHHHHHHHHHHHHHhhHhHHHHHHHHHHh
Q 000224         1144 TFINVMNTAILRLATGN----RNMTIRTRNHPLPTTQSQQLQR---HDLDAFSVSIIISIAFSFIPASFAVAIVKEREVK 1216 (1833)
Q Consensus      1144 ~~ln~~~nailr~~~~~----~~~~I~~~~~Plp~~~~~~~~~---~~~~~~~~~~~i~~~~s~i~a~f~~~~V~ER~~k 1216 (1833)
                      .++|+++||++|...++    .+.+|++.|||+|.+..+....   ........++++.++|+|+|++|++++|+||++|
T Consensus      1629 ~~lN~l~NaiLr~~~~~~~~~~~~~I~v~N~Plp~t~~~~~~~~~~~~~~~~~iai~ii~~~sfi~asfv~~~V~ER~sk 1708 (2272)
T TIGR01257      1629 SFLNVAHNAILRASLPKDRDPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVNK 1708 (2272)
T ss_pred             HHHHHHHHHHHHHhcccccCCccceEEEEecCCCCchhhhhhhhhcccchhHHHHHHHHHHHHHHHHHHheeeehHHhhh
Confidence            99999999999997542    3578999999999876442211   1223445678899999999999999999999999


Q ss_pred             HHHHHHHhCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccCchHHHHHHHHHHHHHHHHHHHhhhhhccCc
Q 000224         1217 AKQQQLISGVSVLSYWTSTYIWDFISFLFPSSCAIILFYIFGLDQFVGRGCLLPTVLIFLGYGLAIASSTYCLTFFFSDH 1296 (1833)
Q Consensus      1217 ~k~lq~vsGv~~~~YW~s~~l~D~i~~li~~~~~iii~~~f~~~~~~~~~~~~~~~ll~llyG~a~i~~~Yl~Sf~f~~~ 1296 (1833)
                      +||+|++||+++.+||+++|+||++.|+++++++++++++|+.+.|.+...++.+++++++||+|++|++|++||+|+++
T Consensus      1709 aK~lQ~vSGv~~~~YWls~fl~D~~~y~i~~~~~i~i~~~f~~~~~~~~~~l~~~~lll~lyG~a~ip~tYl~SflF~~~ 1788 (2272)
T TIGR01257      1709 AKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPENLPALVALLMLYGWAVIPMMYPASFLFDVP 1788 (2272)
T ss_pred             HHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChhhhcCcchHHHHHHHHHHHHHHHHHHHHHHHHhhCCc
Confidence            99999999999999999999999999999999999999999999999988999999999999999999999999999999


Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHH---hHHHHHHHHHhhhcccchhhhhHHHHHHHhhhc------ccCCCCCC
Q 000224         1297 TMAQNVVLLVHFFTGLILMVISFIMGLLEA---TRSANSLLKNFFRLSPGFCFADGLASLALLRQG------MKDKTSDG 1367 (1833)
Q Consensus      1297 ~~a~~~~~~i~~~~g~~~~i~~~il~~~~~---~~~~~~~l~~~f~l~P~~~l~~gl~~l~~~~~~------~~~~~~~~ 1367 (1833)
                      .+|+..+.++++++|++.+++.+++.....   ....+..++++|+++|.||++.|+..+......      .......+
T Consensus      1789 ~~A~~~~~~in~~~G~~~~i~~~il~~~~~~~~~~~~~~~l~~if~i~P~f~lg~gl~~l~~~~~~~~~~~~~~~~~~~~ 1868 (2272)
T TIGR01257      1789 STAYVALSCANLFIGINSSAITFVLELFENNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEHSAN 1868 (2272)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhHHHHHHHHHeeCchhhhHHHHHHHHHhHHHHHHHHhhcccccCC
Confidence            999999999999999999988888876532   344577889999999999999999988754311      11122346


Q ss_pred             ccccccchhhHHHHHHHHHHHHHHHHHHHhccCcchhhhhHhhhhccccccccCCCCCCCcccccCCCCCCcCCCCCChh
Q 000224         1368 VFDWNVTSASICYLGCESICYFLLTLGLELLPSHKWTLMTIKEWWKGTRHRLCNTPSSYLEPLLQSSSESDTLDLNEDID 1447 (1833)
Q Consensus      1368 ~~~~~~~g~~i~~l~~~~i~~~lL~l~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ed~d 1447 (1833)
                      +++|+..|..++||++++++|+++++++|+....       .+ |...        .   .+         ....+||+|
T Consensus      1869 ~~~~~~~g~~ll~m~~~~iv~flLl~~ie~~~~~-------~~-~~~~--------~---~~---------~~~~~eD~D 1920 (2272)
T TIGR01257      1869 PFQWDLIGKNLVAMAVEGVVYFLLTLLIQHHFFL-------SR-WIAE--------P---AK---------EPIFDEDDD 1920 (2272)
T ss_pred             ccchhhccHHHHHHHHHHHHHHHHHHHHHhhhhh-------hh-hccc--------c---Cc---------CcCCCchhH
Confidence            7899999999999999999999999999963210       00 1000        0   00         001268999


Q ss_pred             hHHHHhhcccCCCCcceEEEEeEEEEcCCCccccccceeeeeeEEEeCCcEEEEEcCCCCcHHHHHHHHhCCCCCCceEE
Q 000224         1448 VQVERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTA 1527 (1833)
Q Consensus      1448 V~~E~~rv~~~~~~~~~l~v~~l~k~y~~~~~~~~~~al~~vs~~v~~Gei~gllG~NGaGKSTll~~l~Gl~~p~~G~i 1527 (1833)
                      |.+||.||.+....+.+|+++||+|+|+++    ++.||+|+||+|++|||+||+||||||||||+|||+|+++|++|+|
T Consensus      1921 V~~Er~rV~~~~~~~~~L~v~nLsK~Y~~~----~~~aL~~ISf~I~~GEi~gLLG~NGAGKTTLlkmL~Gll~ptsG~I 1996 (2272)
T TIGR01257      1921 VAEERQRIISGGNKTDILRLNELTKVYSGT----SSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDA 1996 (2272)
T ss_pred             HHHHHHHHhccCCCCceEEEEEEEEEECCC----CceEEEeeEEEEcCCcEEEEECCCCCcHHHHHHHHhCCCCCCccEE
Confidence            999999998766667799999999999631    3569999999999999999999999999999999999999999999


Q ss_pred             EEcCeeCCCChHHhccceEEEecCCCCCCCCCHHHHHHHHHHHcCCChhhHHHHHHHHHHHcCCccccCCCCCCCChhHH
Q 000224         1528 FIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNK 1607 (1833)
Q Consensus      1528 ~i~G~~i~~~~~~~~~~ig~~pQ~~~l~~~lTv~e~l~~~~~~~g~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~k 1607 (1833)
                      +++|+++.....+.+++||||||++.+++.+|++||+.++++++|.++++.++.++++++.++|.+++++++++||||||
T Consensus      1997 ~i~G~~i~~~~~~~r~~IGy~pQ~~~L~~~LTv~E~L~l~a~l~g~~~~~~~~~v~~lLe~lgL~~~~dk~~~~LSGGqK 2076 (2272)
T TIGR01257      1997 TVAGKSILTNISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPAEEIEKVANWSIQSLGLSLYADRLAGTYSGGNK 2076 (2272)
T ss_pred             EECCEECcchHHHHhhhEEEEeccccCCCCCCHHHHHHHHHHhcCCCHHHHHHHHHHHHHHcCCHHHhcCChhhCCHHHH
Confidence            99999997655567788999999999999999999999999999988776777888999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHhccCCeEEEEecCCHHHHHHHcCEEEEEECCEEEEecCh
Q 000224         1608 RKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSP 1687 (1833)
Q Consensus      1608 qrl~lA~al~~~p~vllLDEPTsgLD~~~~~~l~~~l~~l~~~~g~~tvil~sH~~~e~~~l~drv~im~~G~i~~~g~~ 1687 (1833)
                      |||+||+||+++|+||||||||+||||.+|+.+|+.|+++++ +| +|||+|||+|+|++++||||++|++|+++|.|++
T Consensus      2077 qRLslA~ALi~~P~VLLLDEPTsGLDp~sr~~l~~lL~~l~~-~g-~TIILtTH~mee~e~lcDrV~IL~~G~i~~~Gs~ 2154 (2272)
T TIGR01257      2077 RKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNTIVSIIR-EG-RAVVLTSHSMEECEALCTRLAIMVKGAFQCLGTI 2154 (2272)
T ss_pred             HHHHHHHHHhcCCCEEEEECCCCCCCHHHHHHHHHHHHHHHh-CC-CEEEEEeCCHHHHHHhCCEEEEEECCEEEEECCH
Confidence            999999999999999999999999999999999999999864 44 6899999999999999999999999999999999


Q ss_pred             hHHHhhcCCeEEEEEeecCCccc---cHHHHHHHHHhhcccCCcchhhhhhhhhhhhccccccccCCCceeeecch----
Q 000224         1688 QHLKTRFGNFLELEVKPTEVSSV---DLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEISLS---- 1760 (1833)
Q Consensus      1688 ~~l~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---- 1760 (1833)
                      ++++++++.+|.++++.......   +.+.+..++...+....     ..+.              ........+.    
T Consensus      2155 q~Lk~~~g~g~~l~i~~~~~~~~~~~~~~~v~~~i~~~fp~a~-----~~e~--------------~~~~l~~~i~~~~~ 2215 (2272)
T TIGR01257      2155 QHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSV-----QRER--------------HYNMLQFQVSSSSL 2215 (2272)
T ss_pred             HHHHHHhCCceEEEEEEcCcchhhhhHHHHHHHHHhhcCccce-----eecc--------------ccceEEEEeCcccH
Confidence            99999999999888875432211   12223333333221110     0000              0001111111    


Q ss_pred             HHHHHHHHHhhccccceeEeEecCCChhhHHHHhhcccccccCC
Q 000224         1761 QEMLLIVGRWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGT 1804 (1833)
Q Consensus      1761 ~~~~~~~~~~~~~~~~~~~~~~~~~sl~~vf~~~t~~~~~~~~~ 1804 (1833)
                      .+.+..+.+ ...+..|.++.+.++||||||+++++++-.+++.
T Consensus      2216 ~~if~~L~~-~k~~l~I~dysvsqtSLE~VFl~l~~~q~~~~~~ 2258 (2272)
T TIGR01257      2216 ARIFQLLIS-HKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYDL 2258 (2272)
T ss_pred             HHHHHHHHh-cCCCCCeEEEEcCCCCHHHHHHHHhccccccCCC
Confidence            222222222 1135678999999999999999999998775533



This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease.

>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1833
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 4e-26
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 6e-26
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 6e-23
3tui_C366 Inward Facing Conformations Of The Metni Methionine 2e-21
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 3e-21
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 6e-21
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 7e-21
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 3e-20
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 3e-20
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 3e-20
1g29_1372 Malk Length = 372 6e-20
1g29_1372 Malk Length = 372 4e-19
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 7e-20
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 2e-19
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 3e-19
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 4e-19
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 3e-16
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-18
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 6e-18
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 2e-16
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 3e-07
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 3e-16
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 5e-16
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 1e-10
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 7e-16
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 8e-16
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 2e-10
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 9e-16
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 5e-15
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 7e-13
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 9e-15
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 3e-14
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 8e-14
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 9e-14
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 9e-14
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 3e-13
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 3e-13
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-13
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 4e-13
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 2e-12
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 3e-12
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 1e-11
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 1e-11
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 1e-11
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 1e-11
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-11
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-11
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 2e-11
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 3e-11
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 3e-11
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 3e-11
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 4e-11
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 7e-08
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 4e-10
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 5e-10
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-08
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 1e-09
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 1e-09
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-09
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 1e-09
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 1e-09
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 2e-09
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 5e-09
2bbo_A291 Human Nbd1 With Phe508 Length = 291 6e-09
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 6e-09
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 6e-09
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 6e-09
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 7e-09
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 9e-09
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 9e-09
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 1e-08
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-08
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 1e-08
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 1e-08
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 3e-08
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 3e-08
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 3e-08
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 5e-08
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 7e-07
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 1e-07
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 1e-07
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-07
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-07
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 4e-07
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 6e-07
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 6e-07
1yqt_A538 Rnase-L Inhibitor Length = 538 8e-07
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 8e-07
3j15_B 593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 2e-04
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 9e-07
3bk7_A 607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 2e-04
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 1e-06
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 4e-04
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 1e-06
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 1e-06
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 3e-06
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 3e-06
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 4e-06
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 4e-06
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 2e-05
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 6e-06
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 8e-06
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 1e-05
4dbl_C249 Crystal Structure Of E159q Mutant Of Btucdf Length 1e-05
4fi3_C249 Structure Of Vitamin B12 Transporter Btucd-F In A N 2e-05
2qi9_C249 Abc-Transporter Btucd In Complex With Its Periplasm 4e-05
3j16_B608 Models Of Ribosome-Bound Dom34p And Rli1p And Their 1e-04
1l7v_C249 Bacterial Abc Transporter Involved In B12 Uptake Le 2e-04
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure

Iteration: 1

Score = 118 bits (295), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 70/218 (32%), Positives = 120/218 (55%), Gaps = 4/218 (1%) Query: 1478 KRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSD 1537 KR K + ++F ++ GE FG +G NGAGKTTTL +IS P+ G +FGK++ + Sbjct: 23 KRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEE 82 Query: 1538 PKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEF-DLLKHAK 1596 P R+LI Y P+ + E+L A + ++++V E+ E L + K Sbjct: 83 PHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMV-ERATEIAGLGEKIK 141 Query: 1597 KPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAV 1656 T S G RKL +A A++ +P + ILDEP++G+D + R + +++ + S Q + Sbjct: 142 DRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQAS--QEGLTI 199 Query: 1657 ILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRF 1694 ++++H+M E + LC RI ++ G + G+ + LK R+ Sbjct: 200 LVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERY 237
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 Back     alignment and structure
>pdb|3J16|B Chain B, Models Of Ribosome-Bound Dom34p And Rli1p And Their Ribosomal Binding Partners Length = 608 Back     alignment and structure
>pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1833
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 3e-81
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 1e-79
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-66
1sgw_A214 Putative ABC transporter; structural genomics, P p 4e-64
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-49
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-43
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-43
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 7e-40
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 1e-41
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-40
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 8e-39
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 6e-38
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-34
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-27
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-33
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-30
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 4e-24
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 9e-20
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-31
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-28
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-26
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 4e-21
1g6h_A257 High-affinity branched-chain amino acid transport 8e-31
1g6h_A257 High-affinity branched-chain amino acid transport 9e-28
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 2e-29
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 2e-23
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-29
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-26
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-20
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-20
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 7e-29
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 7e-23
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-28
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-23
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-22
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-21
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 2e-28
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 3e-25
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-28
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 6e-25
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 5e-28
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 9e-25
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 3e-26
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 9e-25
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-25
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-19
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-24
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-23
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 6e-22
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 7e-21
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-21
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 4e-20
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-16
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 7e-19
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 6e-16
1b0u_A262 Histidine permease; ABC transporter, transport pro 6e-18
1b0u_A262 Histidine permease; ABC transporter, transport pro 5e-08
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 1e-17
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 5e-13
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 3e-17
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 6e-15
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-16
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-14
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-08
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-08
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-04
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-16
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-13
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 7e-12
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-09
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 4e-16
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 6e-16
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 1e-15
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 6e-09
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 5e-14
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 4e-13
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 2e-13
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 4e-09
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 5e-13
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 4e-07
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 6e-13
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 8e-13
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 7e-13
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 1e-06
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-12
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-11
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 8e-12
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 8e-09
2ghi_A260 Transport protein; multidrug resistance protein, M 3e-11
2ghi_A260 Transport protein; multidrug resistance protein, M 5e-11
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 6e-11
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 2e-10
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 7e-10
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 3e-08
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 1e-09
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 8e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-08
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-07
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-08
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-08
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-08
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-07
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 3e-06
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 3e-06
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 4e-06
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 3e-05
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 8e-06
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 4e-05
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-04
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 5e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  267 bits (684), Expect = 3e-81
 Identities = 72/257 (28%), Positives = 132/257 (51%), Gaps = 14/257 (5%)

Query: 1450 VERNRVLSGSVDNAIIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGK 1509
            +  +++         + +++LRK          K  +  ++F ++ GE FG +G NGAGK
Sbjct: 1    MGSDKIHHHHHHMGAVVVKDLRKRI------GKKEILKGISFEIEEGEIFGLIGPNGAGK 54

Query: 1510 TTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYAR 1569
            TTTL +IS    P+ G   +FGK++  +P   R+LI Y P+       +   E+L   A 
Sbjct: 55   TTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAG 114

Query: 1570 IKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPS 1629
                +   ++++V        L +  K    T S G  RKL +A A++ +P + ILDEP+
Sbjct: 115  FYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPT 174

Query: 1630 TGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQH 1689
            +G+D +  R + +++ + S ++G T +++++H+M E + LC RI ++  G +   G+ + 
Sbjct: 175  SGLDVLNAREVRKILKQAS-QEGLT-ILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEE 232

Query: 1690 LKTRFGN------FLEL 1700
            LK R+        F E+
Sbjct: 233  LKERYKAQNIEEVFEEV 249


>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1833
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 5e-58
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-55
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 7e-57
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 9e-56
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-53
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-51
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-48
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 3e-47
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-47
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-47
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 4e-47
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 7e-46
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-47
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-46
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 5e-47
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-45
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 5e-47
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 4e-46
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-45
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-42
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-43
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 4e-41
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-41
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-40
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-40
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-40
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-38
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 6e-38
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 3e-37
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 5e-36
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 6e-36
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-33
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 7e-36
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 3e-34
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-35
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 3e-34
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-35
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 4e-33
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 4e-35
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-33
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 8e-16
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 3e-13
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-07
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 6e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-06
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.002
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]
 Score =  198 bits (505), Expect = 5e-58
 Identities = 70/242 (28%), Positives = 124/242 (51%), Gaps = 14/242 (5%)

Query: 1465 IYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTD 1524
            + +++LRK          K  +  ++F ++ GE FG +G NGAGKTTTL +IS    P+ 
Sbjct: 3    VVVKDLRKRI------GKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSS 56

Query: 1525 GTAFIFGKDIRSDPKAARRLIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVME 1584
            G   +FGK++  +P   R+LI Y P+       +   E+L   A     +   ++++V  
Sbjct: 57   GIVTVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVER 116

Query: 1585 KLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAKRFMWEVI 1644
                  L +  K    T S G  RKL +A A++ +P + ILDEP++G+D +  R + +++
Sbjct: 117  ATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKIL 176

Query: 1645 SRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGN------FL 1698
             +    Q    +++++H+M E + LC RI ++  G +   G+ + LK R+        F 
Sbjct: 177  KQA--SQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIEEVFE 234

Query: 1699 EL 1700
            E+
Sbjct: 235  EV 236


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1833
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.82
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.54
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.54
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.5
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.34
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.24
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.17
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 99.16
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.95
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.81
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 98.52
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 98.29
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 98.11
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.99
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.88
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.8
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.66
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.65
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.6
d1vmaa2213 GTPase domain of the signal recognition particle r 96.45
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.3
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.29
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.25
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.18
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.16
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.12
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.02
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.93
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.93
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.93
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.7
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.69
d1okkd2207 GTPase domain of the signal recognition particle r 95.42
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.41
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.36
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.28
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.24
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.23
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.22
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.21
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.19
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.18
d1okkd2207 GTPase domain of the signal recognition particle r 95.12
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.06
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.06
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.05
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.01
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.91
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.87
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.82
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.81
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.75
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.7
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.67
d1vmaa2213 GTPase domain of the signal recognition particle r 94.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.53
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.47
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.43
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.3
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.21
d2qy9a2211 GTPase domain of the signal recognition particle r 94.2
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.19
d2qy9a2211 GTPase domain of the signal recognition particle r 94.0
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.0
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.97
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.95
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.94
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.93
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.79
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.72
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.63
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.63
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.61
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 93.46
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.44
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.27
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.26
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.21
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.02
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.01
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.96
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.85
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.78
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.78
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.63
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.56
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 92.55
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.54
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.47
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.43
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.4
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.39
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.27
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.26
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.26
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.22
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.15
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.15
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.13
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.1
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.05
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.03
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.99
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.98
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.96
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.83
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.76
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.75
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.69
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.65
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 91.64
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.63
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.59
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.57
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.53
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.51
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.5
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.48
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 91.46
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.46
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.4
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 91.39
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.36
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.35
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.27
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.25
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.18
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.16
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.15
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.07
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.07
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.99
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.95
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.86
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.71
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.7
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 90.66
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.64
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.61
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.61
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.55
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.51
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.4
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.29
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.28
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.24
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.23
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.13
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.11
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.1
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.08
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.04
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.97
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.91
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.91
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 89.91
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.88
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.88
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.87
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.63
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 89.49
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.47
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.33
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.3
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.27
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.24
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.22
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.17
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 89.16
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.1
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.05
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 89.04
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.03
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 88.96
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.92
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.92
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.85
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 88.72
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.72
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.69
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.64
d1xpua3289 Transcription termination factor Rho, ATPase domai 88.61
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 88.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.46
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 88.46
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.36
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.2
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.14
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.14
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.1
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.08
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.07
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.95
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 87.93
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.88
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.86
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.84
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.81
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.8
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.74
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.63
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.55
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.42
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 87.42
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.41
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.39
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.37
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.35
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.33
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.31
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.05
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 86.87
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.87
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.68
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.63
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.56
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.42
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 86.42
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.38
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 86.35
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.22
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.15
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.11
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.11
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.11
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 86.1
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.04
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 85.99
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 85.99
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 85.98
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 85.98
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.85
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 85.83
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 85.71
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 85.66
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.57
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.51
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.39
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 85.37
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 85.3
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 85.21
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 85.13
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 85.12
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.03
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.9
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 84.9
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.89
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 84.85
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 84.8
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 84.79
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.76
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 84.68
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 84.67
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.59
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.57
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.57
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.51
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.49
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.44
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.41
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.39
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 84.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 84.3
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 84.2
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 84.12
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 83.96
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 83.92
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.88
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 83.8
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.73
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.64
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 83.56
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 83.52
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 83.5
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 83.42
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.3
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.17
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 83.15
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 83.12
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.99
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 82.93
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 82.9
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 82.86
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 82.78
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 82.75
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.71
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 82.69
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.62
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 82.56
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.56
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 82.52
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.48
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 82.43
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 82.39
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 82.36
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.23
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 82.16
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 82.01
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.95
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 81.9
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 81.86
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.76
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 81.71
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.7
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.55
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 81.52
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 81.3
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 81.16
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 80.97
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 80.93
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.89
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.85
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 80.8
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 80.7
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 80.63
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 80.45
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 80.34
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.3
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=0  Score=435.59  Aligned_cols=222  Identities=31%  Similarity=0.441  Sum_probs=180.8

Q ss_pred             EEEEEEEEEECCCCCCCCCCCEEEEEEEEEECCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHCC
Q ss_conf             19998689991898655654213333599758819999959999689999999199889950799968508999687604
Q 000224         1464 IIYLRNLRKVYPGGKRSDAKVAVHSLTFSVQAGECFGFLGTNGAGKTTTLSMISGEEYPTDGTAFIFGKDIRSDPKAARR 1543 (1833)
Q Consensus      1464 ~l~v~~l~k~y~~~~~~~~~~av~~is~~v~~Gei~gllG~NGAGKTTll~~l~G~~~p~~G~i~i~G~~i~~~~~~~~~ 1543 (1833)
                      .|+++||+|.|+      ++.||+||||+|++||++||+|||||||||+++||+|+++|++|+|.++|.++.+.+. .++
T Consensus         6 ~I~v~nlsk~yg------~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~~~~-~~r   78 (239)
T d1v43a3           6 EVKLENLTKRFG------NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPP-KDR   78 (239)
T ss_dssp             CEEEEEEEEEET------TEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCG-GGG
T ss_pred             EEEEEEEEEEEC------CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCC-CCC
T ss_conf             499987999999------9999813067887998999999999829999999975899987879991641354770-001


Q ss_pred             CEEEEECCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             42998058987989999999999999709990559999999998749962018898998946999999999990699989
Q 000224         1544 LIGYCPQFDALLEYLTVQEHLELYARIKGVAEYRMDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIV 1623 (1833)
Q Consensus      1544 ~ig~~pQ~~~l~~~ltv~e~l~~~~~l~g~~~~~~~~~v~~~l~~~~L~~~~~~~~~~lSgG~krrl~iA~al~~~p~il 1623 (1833)
                      +||||||++.+++.+||+||+.+.+++++.++.++++++.++++.++|.++.++++.+||||||||++||+||+.+|++|
T Consensus        79 ~ig~v~Q~~~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iL  158 (239)
T d1v43a3          79 NISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVL  158 (239)
T ss_dssp             TEEEEEC------CCCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTCCSEE
T ss_pred             EEEEEEECHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             58998003353422209999999998739999999999999998759855660995469999988999976640499824


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHCCEEEEEECCEEEEECCHHHHHHH
Q ss_conf             9938789989999999999999987416996999963778889977679999989999996596679751
Q 000224         1624 ILDEPSTGMDPIAKRFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTR 1693 (1833)
Q Consensus      1624 lLDEPt~GlDp~~r~~i~~~i~~l~~~~~~~tiilttH~m~e~e~l~dri~il~~G~i~~~gs~~~l~~~ 1693 (1833)
                      +|||||+||||.+++.+|++|++++++.| +|||++||+|+++..+||||++|++|++++.|+++++.++
T Consensus       159 llDEPts~LD~~~~~~i~~ll~~l~~~~g-~tii~vTHd~~~a~~~~dri~vm~~G~iv~~G~~~el~~~  227 (239)
T d1v43a3         159 LMDEPLSNLDAKLRVAMRAEIKKLQQKLK-VTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLR  227 (239)
T ss_dssp             EEESTTTTSCHHHHHHHHHHHHHHHHHHT-CEEEEEESCHHHHHHHCSEEEEEETTEEEEEECHHHHHHC
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHCCEEEEEECCEEEEECCHHHHHHC
T ss_conf             30688666898999899999999987319-8079994899999986999999989999998599999868



>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure