Citrus Sinensis ID: 000725

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------133
MATPKEVVFGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCNGASSSKHDNQNSGACADPDFQPYLQRAPVTKKRSRKNEVTNRKPVGRSGFKKPRPANEMNHKHECSAPPSISKGRNEFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLCAPDTLDFVQDNTMPSSPSTHDKGNYSLKEDFTTANNVHSERIVADSHAEEEIGTSNSNASFGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRKEKANFRPSETSPIRVNLQEGKNETSLSMKPSSPVSSLLSSLKLAAAIEKTNGDREEKLQNQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEADEPSTDKDINLPSPQKDCAVEDARNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFANLSKNSTVAEIHPVEKDLKNEPESTEGANDADTRGMNSTVQLSRKDIPVKVASDETGSPVQVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFAEFNSSVVSQKQEISGCEYTSSNAKESQVSSDLKLQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGDGPDGGRRQRDPRHGQNDHVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTRRAT
ccccccccccccHHHHccccEEEEEEEcEEcccccccccccccccccccccccEEEEEEEcccEEEEEEEEcccccEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccEEEEEEcccccccEEEEEEccccEEEEEEEccccccccEEEEEEEEEccccccccccEEEEEEEEcccccccccccccccccccEEcccccEEEEEcccccccccccccccccccccccccccccEEEEEEcccEEEEEEEEEccccEEEEEEccccEEEEEcccccEEEEEEccccccEEEEEEEcccccccccEEEEEEccccccEEEEEcccccEEEEEccccEEEEccccccccEEEEEEEEcEEEEccccccHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccccHHHHccccccccccccccEEHHHHHccEEEEccccccccccccccccccEEEccccEEEEEEccccccccEEEEEcccEEEEEEEccccccEEEEcccccccccccccccccccccEEEEEEccccccEEcccccccccEEEEEEEcccccccEEEEEccc
cccccEEEEccccHccccccEEEEEccHHcccccccHccccccccccccccccHHEEEEcccEEEEEEEEEcccccEEEEEEccccccccccccHHHHHHHHHcccccEEcccccccccccccHHcccccHHHHHHHHHHHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEcccccccccccccccccccccccHHcccccccHHHccccccccccccccEEEEccccccccccEEEEEccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHcHHHcccccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccccccccccccccccccHHcccccccccccccccccccccHHccccccccEEEEccccEEEEcccccccccccccccccccHHHHccccccccEEEEccHHHHHccccccEEEEEcccccccccccccccccccccHHHHHHHHHHcHcccccccccccccccccccccEEEHEHcccccccccccccccHcEEEcccccccccccccccccHHHccHHEccccccccccccEcccccccccccccccEEEEccEEEEccccccccccccccccHHccccccHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEcccccEEEEEEEccccEEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEEEEEccccccccccccccHccccEEcccccEEEEEEcEEcccccccccccEccccEcccccccEEEEEEEEccEEEEEEEEEccccEEEEEEEcccEEEEEEccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEccccccEEEEcccccEEEEEEHHHHHHHHEEcccccEEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHccEEEccccccHHHHHcccccccEEEccccEEEEEEEccccEccccEcccccEEEEEEEEccccEEEEEEccccccccccccccccccccEEEEEcccccccEEcccccccccEEEEEEEccccccEEEEEEccc
matpkevvfggdeeevkseglEIVSIGYlykgpwekkywsssrgkdrypypvgyhavqahngstckmeihegpkgplfmitssdahscsgqtpdiaWEKFqkkhcprmktwhgkrlsckidgveffgfkNSFVQRLLRELVADINGEAERNLLSssfcngassskhdnqnsgacadpdfqpylqrapvtkkrsrknevtnrkpvgrsgfkkprpanemnhkhecsappsiskgrnefhktqsawqpsvhlnsktnkerdgnfsakdgfpsesidfsVHLAEGSVIVQEVANSLIveekpvspvrnilnfsqldrsknfrlleatedvtgdapvlkdspcvetlnlcapdtldfvqdntmpsspsthdkgnyslkedfttannvhserivadshaeeeigtsnsnasfgkggfdsVGQEITEAMMTVLLpkaipllnnvsrkekanfrpsetspirvnlqegknetslsmkpsspvsslLSSLKLAAAIEKTngdreeklqnqdvdlgldapifensksfvldsfeddqhrdhitneVKLSCniveadepstdkdinlpspqkdcavedarnESFVYHVEtsnsknvlSLANMDLdkmlldrdacisesvldcrssskevFSKKVQDNFanlsknstvaeihpvekdlknepestegandadtrgmnstvqlsrkdipvkvasdetgspvqvphkvysrkvskraplmkkfdgpfsesiICRNFIDDHVAKQQHTAETLLASEISqmrssdykpqrenFDAARDLLEVKscclpvisknstvfcatkdkdfhnsfdpstlhmknlkansgkeldeqlnfaefNSSVVSQkqeisgceytssnakesqvssdlkLQKNVECINELAGtfdlmgcyffplpILSVLLSTTGDKIYVCVSCGflvdkkrtlFIYTvdiqeprvgnpscvghtsvmlpflkdnfgrEIALERscalftpdgqYLVLLdsmktpycregrsdclcstctshrldenaVKIVKVKPGYVSVVAKLktddcvqcilvcepkhliavgesgKLHLWEMNSSWSAQVEECiipindciypcivemkripkcaplvvghngfgefgiWDISKRVLVSRFSAARASIyqffpinlfswqrngsvsmdASLELTNTATTSlfskhsekssfcpsvgedSAIWLLVSTIsdsdaqhncmsrdcqknpVRFWRLALLVKNRvilgspldprasaigassglgiigtnDGLVYAWELssgnklgilhhfkggtvsciatddSGLQALAvagdgpdggrrqrdprhgqndhvriwkmdpnlgcvrnsngdskfKQFQISIketklpahiKVTRRAT
matpkevvfggdeeevksegleivsigylykgpweKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCNGASSSKHDNQNSGACADPDFQPYLqrapvtkkrsrknevtnrkpvgrsgfkkprpanemnhkhECSAPPSISKGRNEFHKTqsawqpsvhlnsktnkERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLiveekpvspvrnilnfsqldrsknFRLLEATedvtgdapvlkdspcVETLNLCAPDTLDFVQDNTMPSspsthdkgnysLKEDFTTANNVHSERIVADSHAEEEIgtsnsnasfgkgGFDSVGQEITEAMMTVLLPKAIPLLnnvsrkekanfrpsetspirvnlqegknetslsmkpsspvsSLLSSLKLAAAIEKtngdreeklqnQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEAdepstdkdinlpsPQKDCAVEDARNESFVYHvetsnsknvlSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQdnfanlsknstvaeihpvekdlknepestegandadtrgmnstvqlsrkdipvkvasdetgspvqvphkvysrkvskraplmkkfdgpfSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFhnsfdpstlhMKNLKANSGKELDEQLNFAEFNSSVVSQKQEISGCEYtssnakesqvssdlklQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVdiqeprvgnpscVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCtshrldenavkivkvKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAgdgpdggrrqrdprhgqndhvriwkmdpnlGCVRNSNGDSKFKQFqisiketklpahikvtrrat
MATPKEVVFGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCNGASSSKHDNQNSGACADPDFQPYLQRAPVTKKRSRKNEVTNRKPVGRSGFKKPRPANEMNHKHECSAPPSISKGRNEFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLCAPDTLDFVQDNTMPSSPSTHDKGNYSLKEDFTTANNVHSERIVADSHAEEEIGTSNSNASFGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRKEKANFRPSETSPIRVNLQEGKNETslsmkpsspvssllsslklAAAIEKTNGDREEKLQNQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEADEPSTDKDINLPSPQKDCAVEDARNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFANLSKNSTVAEIHPVEKDLKNEPESTEGANDADTRGMNSTVQLSRKDIPVKVASDETGSPVQVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFAEFNSSVVSQKQEISGCEYTSSNAKESQVSSDLKLQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRasaigassglgiigTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAgdgpdggrrqrdprhgqNDHVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTRRAT
*******************GLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMIT******C*GQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEA****************************************************************************************************************************IDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLCAPDTLDFV*************************************************************GQEITEAMMTVLLPKAIPLLN***********************************************************************LDAPIFENSKSFVLDSF*******HITNEVKLSCNIV****************************SFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDC*************************************************************************************************FDGPFSESIICRNFIDDHVAK*****************************AARDLLEVKSCCLPVISKNSTVFCATKDKDF**************************************************************LQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVS*************************CPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAV*********************VRIWKMDPNLGCVR**********FQI******************
******************EGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKK******************GVEFFGFKNSFVQRLLRELVADINGE************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************DLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDA**********KNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAV********************HVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTR***
MATPKEVVFGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCN***********SGACADPDFQPYLQRAP******************RSGFKKPRPANEMNHKHECSAPPSISKGRNEFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLCAPDTLDFVQDNT********DKGNYSLKEDFTTANNVHSERIVADSHAEEEIGTSNSNASFGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRK*********TSPIRVNLQEG******************SSLKLAAAIEKTNGDREEKLQNQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEADEPSTDKDINLPSPQKDCAVEDARNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFANLSKNSTVAEIHPVEKDL***************RGMNSTVQLSRKDIPVKVASDETGSPVQVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFAEFNSS***************************KLQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLF***********SVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGD***************NDHVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTRRAT
***PKEV*FGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADING*****************************************************************************************EFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDV*GDAPVLKDSPCVETLNLCAPDTLDFVQDNTMPSSP***DKGNYSLKEDFTTANNVHSERIVA*******************G*FDSVGQEITEAMMTVLLPKAIPLLNNVSR**K*NFRPSETSPIRVNLQE**N*TSLSMKPSSPVSSLLSSLKLAAAIEKT********QNQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITN**KLSCNIVEADEPSTDKDINLPSPQKDCAVEDARNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFANLSKNSTVAEIHPVEKDLKN*********D*D*RG*************************QVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFAEFNSSVVS*********************SDLKLQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGDGPDGGRRQRDPRHGQNDHVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTRR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPKEVVFGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAHNGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCNGASSSKHDNQNSGACADPDFQPYLQRAPVTKKRSRKNEVTNRKPVGRSGFKKPRPANEMNHKHECSAPPSISKGRNEFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQEVANSLIVEEKPVSPVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLCAPDTLDFVQDNTMPSSPSTHDKGNYSLKEDFTTANNVHSERIVADSHAEEEIGTSNSNASFGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRKEKANFRPSETSPIRVNLQEGKNETSLSMKPSSPVSSLLSSLKLAAAIEKTNGDREEKLQNQDVDLGLDAPIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEADEPSTDKDINLPSPQKDCAVEDARNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFANLSKNSTVAEIHPVEKDLKNEPESTEGANDADTRGMNSTVQLSRKDIPVKVASDETGSPVQVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFDAARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFAEFNSSVVSQKQEISGCEYTSSNAKESQVSSDLKLQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTVDIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGDGPDGGRRQRDPRHGQNDHVRIWKMDPNLGCVRNSNGDSKFKQFQISIKETKLPAHIKVTRRAT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1329
2254234221242 PREDICTED: uncharacterized protein LOC10 0.885 0.947 0.461 0.0
2241014591312 predicted protein [Populus trichocarpa] 0.904 0.916 0.445 0.0
2977381141177 unnamed protein product [Vitis vinifera] 0.863 0.974 0.462 0.0
2978510521194 predicted protein [Arabidopsis lyrata su 0.861 0.958 0.369 0.0
4494352401214 PREDICTED: uncharacterized protein LOC10 0.858 0.939 0.360 0.0
3575169131244 hypothetical protein MTR_8g066290 [Medic 0.861 0.920 0.367 0.0
2555419841246 conserved hypothetical protein [Ricinus 0.443 0.473 0.470 1e-143
356560781925 PREDICTED: uncharacterized protein LOC10 0.623 0.895 0.372 1e-141
4494934961103 PREDICTED: uncharacterized protein LOC10 0.626 0.754 0.358 1e-128
3341828841194 DNA binding protein [Arabidopsis thalian 0.335 0.373 0.492 1e-116
>gi|225423422|ref|XP_002273558.1| PREDICTED: uncharacterized protein LOC100268093 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1319 (46%), Positives = 781/1319 (59%), Gaps = 142/1319 (10%)

Query: 1    MATPKEVVFGGDEEEVKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHAVQAH 60
            MA PKE          KS+ LEI SIG L+KGPW+KKYWSSSRGKDRYPYPVGY A++ H
Sbjct: 1    MAKPKEE---------KSDDLEITSIGALHKGPWDKKYWSSSRGKDRYPYPVGYQALRTH 51

Query: 61   NGSTCKMEIHEGPKGPLFMITSSDAHSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKI 120
            NG   KMEIHEGPKGPLF+I S+D   CSGQTPDIAWE FQKK CPR+KT HGKRLSCKI
Sbjct: 52   NGIRYKMEIHEGPKGPLFVIISADGILCSGQTPDIAWEIFQKKGCPRLKTLHGKRLSCKI 111

Query: 121  DGVEFFGFKNSFVQRLLRELVADINGEAERNLLSSSFCNGASSSKHDNQNSGACADPDFQ 180
            DGVEFFGF+N FVQRLLRELVA++NG AE+ LLS+SFCN AS +++D +   +C  PD  
Sbjct: 112  DGVEFFGFRNPFVQRLLRELVANVNGTAEQTLLSASFCNRASGAENDTRLPDSCTYPDLL 171

Query: 181  PYLQRAPVTKKRSRKNEVTNRKPVGRSGFKKPRPANEMNHKHECSAPPSISKGRNEFHKT 240
            PYL++   T KRSRK +  N K +  S  K+ RP    +                     
Sbjct: 172  PYLEKPQTTGKRSRKQKNINMKSISGSAHKRLRPRELTD--------------------- 210

Query: 241  QSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQE------------ 288
                      NS  +  R  N +AKDG P E++    HL E ++I+QE            
Sbjct: 211  ----------NSVASSSRQRNRNAKDGLPLETVGLCDHLREEALILQEEGKLVSSENYIS 260

Query: 289  --VANSLIVEEKPVSPV------------RNILNFSQLDRSKNFRLL-----EATEDVTG 329
                N   +EEKPV               RNILNFSQLDRSK+ ++         ED   
Sbjct: 261  TRAVNIPSIEEKPVKLYLIVLYTVNWFSSRNILNFSQLDRSKHIKVQGLGYSTPIEDNNM 320

Query: 330  DAPVLKDSPCVETLNLCAPDTLDFVQDNTMPSSPSTHDKGNYSLKEDFTTANNVHSERIV 389
            +    K S     ++ CAPDTLD +QDNT   + + H +G  ++K++ T A+    E  V
Sbjct: 321  ETIFPKSSQGFSNVDHCAPDTLDHMQDNTSAYASTAHKEGPDNVKDELTAADMTIFEGSV 380

Query: 390  ADSHAEEEIGTSNSNASFGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRKEKANFRPS 449
             +SH E E+GT  SN S  +  FDSVGQE+ ++MMTVLLP+A+PLL   SRK+KA     
Sbjct: 381  TESHLEGEVGTYTSNGSSERSDFDSVGQEVAKSMMTVLLPQALPLLKETSRKKKATNNHL 440

Query: 450  ETSPIRVNLQEGKNETSLSMKPSSPVSSLLSSLKLAAAIEKTNGDREEKLQNQDVDLGLD 509
              S  R    E  +E S     + P+ ++ S   + A  E +  + EEK+Q    D    
Sbjct: 441  GLSFYRA---ESLDENS----GACPIVNVASPALVLA--ENSPVEMEEKVQTFRRDFDPV 491

Query: 510  APIFENSKSFVLDSFEDDQHRDHITNEVKLSCNIVEADEPSTDKDINLPSPQKDCAVEDA 569
             P FE+ KS + DSFEDDQ      N   L  +I  AD+ S DKD             DA
Sbjct: 492  IPSFEHVKSVIPDSFEDDQCGHDSANGPLLFSDIAGADQASFDKDTCACDTLGQFINVDA 551

Query: 570  RNESFVYHVETSNSKNVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVFSKKVQDNFA 629
              ES V HVET   K+  S +  ++             S LD  S    + S + +    
Sbjct: 552  WKESSVCHVETGERKDGFSCSKANV------------ASKLDENSIHHGILSVEREKTLL 599

Query: 630  NLSKNSTVAEIHPVEKDLKNEPESTEGANDADTRGMNSTVQLSRKDIPVKVASDETGSPV 689
            + ++   V  +  V+         T GAN   T+ M S+VQ+S + I  K+   E G+  
Sbjct: 600  DCAE---VVFLQVVD---------TSGAN---TKCMVSSVQISEQSISSKMDGAEAGN-- 642

Query: 690  QVPHKVYSRKVSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSS 749
                     ++S  APL +K++G  SESII RNF DD +     T   LLA+EI Q+ SS
Sbjct: 643  ---------QISDVAPLTRKYNGLLSESIIYRNFGDDCILDAYPTVGPLLAAEIHQVSSS 693

Query: 750  DYKPQRENFDAARDLLEVKSCCL-----------------PVISKNSTVFCATKDKDFHN 792
               P ++   +    LE +   L                 PV S+N    C +K  D + 
Sbjct: 694  ASSPDKKVLFSPEVKLEGQHYNLNTEKIALNPEGVFCNMAPVSSQNQEFICTSKYDDPYI 753

Query: 793  SFDPSTLHMKNLKANSGKELDEQLNFAEFNSSVVSQKQEISGCEYTSSNAKESQVSSDLK 852
             F PS L +++ +A   K+L EQ N  + N SV  QK   S  E   SNA+E Q  ++LK
Sbjct: 754  FFYPSVLRVESCQAYIDKKLVEQQNLVKLNRSV--QKGGTSFGENNMSNAEEVQAGTNLK 811

Query: 853  LQKNVECINELAGTFDLMGCYFFPLPILSVLLSTTGDKIYVCVSCGFLVDKKRTLFIYTV 912
                +E  ++L G  +L+GCY  P+P+LSVLL+T  D+I++CV CG LVDK   LFIY V
Sbjct: 812  AHIKMEVKHDLVGNTELVGCYVHPMPVLSVLLNTREDEIHICVLCGLLVDKDTILFIYKV 871

Query: 913  DIQEPRVGNPSCVGHTSVMLPFLKDNFGREIALERSCALFTPDGQYLVLLDSMKTPYCRE 972
             I+EPR+ +P+ VG+T ++LP LKD  G E+AL+R    FTPDGQ LVLL+S+KTPYCRE
Sbjct: 872  TIKEPRLQSPTFVGYTPIILPTLKDRSGGEVALDRFGLQFTPDGQSLVLLNSIKTPYCRE 931

Query: 973  GRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTDDCVQCILVCEPKHLIAVGESG 1032
             +  CLCS C     +ENA+KIV++K G++SVV KLKT D VQCILVCEP HL+AV ESG
Sbjct: 932  QKIPCLCSACKLECFEENAIKIVQIKLGFLSVVEKLKTVDSVQCILVCEPNHLVAVEESG 991

Query: 1033 KLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKR 1092
            +LH+W MNS+WS Q E+ IIP  DC+ PCIVE+KRIPKCAPLVVGH+GFGEF +WDIS+R
Sbjct: 992  RLHVWVMNSTWSVQTEDFIIPTYDCVSPCIVELKRIPKCAPLVVGHHGFGEFSLWDISQR 1051

Query: 1093 VLVSRFSAARASIYQFFPINLFSWQRNGSVSMDASLEL----TNTATTSLFSKHSEKSSF 1148
            +L+SRF+    SI++F PI+LFS+Q    +S +  ++L       AT   FSKH+E  +F
Sbjct: 1052 ILISRFAMPSISIFEFIPISLFSFQSEVPLSSNPDVDLHINKIMAATKMWFSKHNENYTF 1111

Query: 1149 CPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKNPVRFWRLALLVKNRVILGSPLDPRAS 1208
             P  GE  A+WLLVST+SDSD QH+    DCQ NPV +WRLALLVKN VILGS LDPRA+
Sbjct: 1112 LPLGGESIAVWLLVSTLSDSDTQHDNQMNDCQTNPVGWWRLALLVKNMVILGSALDPRAA 1171

Query: 1209 AIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGDG 1267
            AIGAS+G GIIGT+DGLVY WELS+G KLG LH+FKGG VSCIATDDS     AVAGDG
Sbjct: 1172 AIGASAGHGIIGTHDGLVYMWELSTGTKLGSLHYFKGG-VSCIATDDSRSDVFAVAGDG 1229

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101459|ref|XP_002312290.1| predicted protein [Populus trichocarpa] gi|222852110|gb|EEE89657.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297738114|emb|CBI27315.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297851052|ref|XP_002893407.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339249|gb|EFH69666.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449435240|ref|XP_004135403.1| PREDICTED: uncharacterized protein LOC101212926 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357516913|ref|XP_003628745.1| hypothetical protein MTR_8g066290 [Medicago truncatula] gi|355522767|gb|AET03221.1| hypothetical protein MTR_8g066290 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255541984|ref|XP_002512056.1| conserved hypothetical protein [Ricinus communis] gi|223549236|gb|EEF50725.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356560781|ref|XP_003548666.1| PREDICTED: uncharacterized protein LOC100802319 [Glycine max] Back     alignment and taxonomy information
>gi|449493496|ref|XP_004159317.1| PREDICTED: uncharacterized protein LOC101227425 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334182884|ref|NP_001185099.1| DNA binding protein [Arabidopsis thaliana] gi|332192557|gb|AEE30678.1| DNA binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1329
FB|FBgn00362031514 Muc68D "Mucin 68D" [Drosophila 0.446 0.391 0.190 7.6e-05
CGD|CAL0003874 1404 PGA55 [Candida albicans (taxid 0.443 0.420 0.169 0.00019
UNIPROTKB|Q59SG9 1404 PGA55 "Flocculin-like protein" 0.443 0.420 0.169 0.00019
FB|FBgn0036203 Muc68D "Mucin 68D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 138 (53.6 bits), Expect = 7.6e-05, P = 7.6e-05
 Identities = 120/631 (19%), Positives = 229/631 (36%)

Query:   229 SISKGRNEFHKTQSAWQPSVHLNSKTNKERDGNFSAKDGFPSESIDFSVHLAEGSVIVQE 288
             S ++  NE   T+S+ Q S    S ++ E  G  S +    + +   S   ++ S   QE
Sbjct:   488 SSTEATNESSSTESS-QDSTTQESSSSSE--GPLSTESSTEATNESSSTESSQDST-TQE 543

Query:   289 VANSLIVEEKPVS--PVRNILNFSQLDRSKNFRLLEATEDVTGDAPVLKDSPCVETLNLC 346
              ++S    E P+S  P       S  + S++    E++   T D P+  +S   E  N  
Sbjct:   544 SSSST---ESPLSTEPSTEANESSSTESSQDSTTQESSSS-TED-PLSTESS-TEATN-- 595

Query:   347 APDTLDFVQDNTMPSSPSTHDKGNYSLKEDFTTANNVHSERIVADSHAEEEIGTSNSNAS 406
                + +  QD+T   S S+ + G  S +     +N   S     DS  ++   ++ S  S
Sbjct:   596 ESSSTESSQDSTTQESSSSTE-GPLSTESSTEGSNESSSTESSQDSTTQKSSSSTESPLS 654

Query:   407 FGKGGFDSVGQEITEAMMTVLLPKAIPLLNNVSRKEKANFRPSETSPIRVNLQEGKNETX 466
                        E  E+  T     +    ++ S +   +  PS  +    + +  ++ T 
Sbjct:   655 ------TEPSTEANESSSTESSQDSTTQESSSSTEGPLSTEPSTEANESSSTESSQDSTT 708

Query:   467 XXXXXXXXXXXXXXXXXXAAAIEKTNGDREEKLQNQDVDLGLDAPIFENSKSFVLDSFED 526
                               A     T   ++     Q+     ++P+     +   +S   
Sbjct:   709 QESSSSSEGPLSTESSTEANESSSTESSQDST--TQESSSSTESPLSTEPSTEANESSST 766

Query:   527 DQHRDHITNEVKLSCNIVEADEPSTD--KDINLPSPQKDCAVEDARNESFVYHVETSNSK 584
             +  +D  T E   S     + EPST+  +  +  S Q     E + +       E+S   
Sbjct:   767 ESSQDSTTQESSSSTEGPLSTEPSTEANESSSTESSQDSTTQESSSSSEGPLSTESSTEA 826

Query:   585 NVLSLANMDLDKMLLDRDACISESVLDCRSSSKEVF----SKKVQDNFANLSKNSTVAEI 640
             N  S      D    +  +  +E  L   SS++  +    ++  QD+    S +ST   +
Sbjct:   827 NESSSTESSQDSTTQESSSS-TEDPLSTESSTEATYESSSTESSQDSTTQESSSSTEGPL 885

Query:   641 HPVEK-DLKNEPESTEGANDADTRGMNSTVQLSRKDIPVKVASDETGSPVQVPHKVYSRK 699
                   +  NE  STE + D+ T+  +S+ +      P   A++ + +            
Sbjct:   886 STESSTEGSNESSSTESSQDSTTQESSSSTESPLSTEPSTEANESSSTESSQDSTTQESS 945

Query:   700 VSKRAPLMKKFDGPFSESIICRNFIDDHVAKQQHTAETLLASEISQMRSSDYKPQRENFD 759
              S   PL  +     +ES    +  D    +   + E  L++E S   S++      + D
Sbjct:   946 SSTEGPLSTESSTEANESSSTESSQDSTTQESSSSTEGPLSTESSTEGSNESSSTESSQD 1005

Query:   760 AARDLLEVKSCCLPVISKNSTVFCATKDKDFHNSFDPSTLHMKNLKANSGKELDEQLNFA 819
             +        S   P+ ++ ST   A +     +S D +T   ++  +  G    E    A
Sbjct:  1006 STTQESS-SSTESPLSTEPSTE--ANESSSTESSQDSTT--QESSSSTEGPLSTESSTEA 1060

Query:   820 EFNSSVVSQKQEISGCEYTSSNAKESQVSSD 850
                SS     Q+ +  E  SS++ E  +S++
Sbjct:  1061 SNESSSTESSQDSTTQE--SSSSTEGPLSTE 1089
GO:0016490 "structural constituent of peritrophic membrane" evidence=ISS
GO:0005576 "extracellular region" evidence=IEA
GO:0008061 "chitin binding" evidence=IEA
GO:0006030 "chitin metabolic process" evidence=IEA
GO:0031012 "extracellular matrix" evidence=ISM
GO:0005201 "extracellular matrix structural constituent" evidence=ISM
CGD|CAL0003874 PGA55 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59SG9 PGA55 "Flocculin-like protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030011001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (1213 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1329
pfam0596584 pfam05965, FYRC, F/Y rich C-terminus 2e-05
>gnl|CDD|218831 pfam05965, FYRC, F/Y rich C-terminus Back     alignment and domain information 
 Score = 43.8 bits (104), Expect = 2e-05
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 75  GPLFMITSSDA--HSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCK-IDGVEFFGFKNS 131
           GPLF +TS D       G++P   WE+  ++     K    K L    I G + FG  + 
Sbjct: 3   GPLFEVTSEDDPDFVFEGESPTACWEEVLERVQEARKESGLKLLPPNSISGEDMFGLTHP 62

Query: 132 FVQRLLREL 140
            V RL+  L
Sbjct: 63  AVVRLIESL 71

This region is normally found in the trithorax/ALL1 family proteins. It is similar to SMART:SM00542. Length = 84

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1329
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 99.98
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.91
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.91
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.9
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.9
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.9
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.9
KOG0295406 consensus WD40 repeat-containing protein [Function 99.9
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.9
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.89
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.89
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.88
KOG0266456 consensus WD40 repeat-containing protein [General 99.88
PLN00181793 protein SPA1-RELATED; Provisional 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.86
KOG0283712 consensus WD40 repeat-containing protein [Function 99.86
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.85
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.84
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.84
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.84
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.84
KOG0286343 consensus G-protein beta subunit [General function 99.83
PTZ00421 493 coronin; Provisional 99.83
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.81
KOG0315311 consensus G-protein beta subunit-like protein (con 99.81
KOG0263707 consensus Transcription initiation factor TFIID, s 99.81
PTZ00421 493 coronin; Provisional 99.81
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.81
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.81
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.81
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.79
PTZ00420 568 coronin; Provisional 99.79
KOG0295406 consensus WD40 repeat-containing protein [Function 99.78
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.76
KOG0315311 consensus G-protein beta subunit-like protein (con 99.76
KOG0296399 consensus Angio-associated migratory cell protein 99.75
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.73
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.73
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.72
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.72
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.72
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.71
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.7
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.7
KOG0645312 consensus WD40 repeat protein [General function pr 99.7
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.7
PTZ00420 568 coronin; Provisional 99.7
KOG0294362 consensus WD40 repeat-containing protein [Function 99.69
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.69
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.68
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.67
KOG0645312 consensus WD40 repeat protein [General function pr 99.67
COG2319466 FOG: WD40 repeat [General function prediction only 99.67
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.67
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.66
KOG0646476 consensus WD40 repeat protein [General function pr 99.65
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.64
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.64
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.64
COG2319466 FOG: WD40 repeat [General function prediction only 99.62
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.62
KOG0283712 consensus WD40 repeat-containing protein [Function 99.61
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.6
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.59
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.59
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.59
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.58
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.57
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.57
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.56
KOG0300481 consensus WD40 repeat-containing protein [Function 99.55
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.55
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.55
PF0596586 FYRC: F/Y rich C-terminus; InterPro: IPR003889 The 99.54
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.53
KOG0267 825 consensus Microtubule severing protein katanin p80 99.51
smart0054286 FYRC "FY-rich" domain, C-terminal region. is somet 99.51
KOG0643327 consensus Translation initiation factor 3, subunit 99.51
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.5
KOG1273405 consensus WD40 repeat protein [General function pr 99.5
KOG0646 476 consensus WD40 repeat protein [General function pr 99.5
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.49
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.49
KOG0293519 consensus WD40 repeat-containing protein [Function 99.48
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.46
KOG0294362 consensus WD40 repeat-containing protein [Function 99.46
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.46
KOG0270463 consensus WD40 repeat-containing protein [Function 99.46
KOG0300481 consensus WD40 repeat-containing protein [Function 99.45
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.45
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.44
KOG0289506 consensus mRNA splicing factor [General function p 99.43
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.43
KOG1274 933 consensus WD40 repeat protein [General function pr 99.43
KOG0296399 consensus Angio-associated migratory cell protein 99.42
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.42
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.41
KOG0289506 consensus mRNA splicing factor [General function p 99.4
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.4
KOG0639705 consensus Transducin-like enhancer of split protei 99.38
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.38
PRK11028330 6-phosphogluconolactonase; Provisional 99.38
KOG0267 825 consensus Microtubule severing protein katanin p80 99.36
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.36
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.35
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.34
KOG0641350 consensus WD40 repeat protein [General function pr 99.34
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.32
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.31
KOG0643327 consensus Translation initiation factor 3, subunit 99.3
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.3
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.3
KOG0270463 consensus WD40 repeat-containing protein [Function 99.29
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.29
PRK11028330 6-phosphogluconolactonase; Provisional 99.28
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.28
KOG1539 910 consensus WD repeat protein [General function pred 99.28
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.27
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.27
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.27
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.26
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.24
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.22
KOG2055514 consensus WD40 repeat protein [General function pr 99.22
KOG2096420 consensus WD40 repeat protein [General function pr 99.2
KOG2096420 consensus WD40 repeat protein [General function pr 99.19
KOG0641350 consensus WD40 repeat protein [General function pr 99.18
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.18
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.18
KOG2048 691 consensus WD40 repeat protein [General function pr 99.14
KOG1334559 consensus WD40 repeat protein [General function pr 99.11
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.1
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.08
KOG4283397 consensus Transcription-coupled repair protein CSA 99.07
KOG0302440 consensus Ribosome Assembly protein [General funct 99.07
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.05
PF0596454 FYRN: F/Y-rich N-terminus; InterPro: IPR003888 The 99.05
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.05
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.03
KOG0302440 consensus Ribosome Assembly protein [General funct 99.02
KOG1539 910 consensus WD repeat protein [General function pred 99.02
KOG0639705 consensus Transducin-like enhancer of split protei 99.02
KOG2048 691 consensus WD40 repeat protein [General function pr 99.01
KOG4283 397 consensus Transcription-coupled repair protein CSA 99.0
PRK01742429 tolB translocation protein TolB; Provisional 99.0
KOG2106626 consensus Uncharacterized conserved protein, conta 98.99
KOG4328498 consensus WD40 protein [Function unknown] 98.97
KOG0772 641 consensus Uncharacterized conserved protein, conta 98.95
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 98.93
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 98.92
KOG0303472 consensus Actin-binding protein Coronin, contains 98.92
KOG1188376 consensus WD40 repeat protein [General function pr 98.89
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.89
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 98.85
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.84
KOG1310 758 consensus WD40 repeat protein [General function pr 98.84
KOG0649325 consensus WD40 repeat protein [General function pr 98.82
KOG1063 764 consensus RNA polymerase II elongator complex, sub 98.81
KOG4227 609 consensus WD40 repeat protein [General function pr 98.79
KOG1063 764 consensus RNA polymerase II elongator complex, sub 98.76
KOG4328498 consensus WD40 protein [Function unknown] 98.74
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.72
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.65
PRK01742429 tolB translocation protein TolB; Provisional 98.63
KOG1273 405 consensus WD40 repeat protein [General function pr 98.6
KOG1188376 consensus WD40 repeat protein [General function pr 98.58
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.58
KOG0771398 consensus Prolactin regulatory element-binding pro 98.58
PRK03629429 tolB translocation protein TolB; Provisional 98.57
KOG2055514 consensus WD40 repeat protein [General function pr 98.57
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.55
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.53
KOG0303 472 consensus Actin-binding protein Coronin, contains 98.53
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.53
KOG1274 933 consensus WD40 repeat protein [General function pr 98.48
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.48
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 98.46
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.46
KOG0771398 consensus Prolactin regulatory element-binding pro 98.44
PRK04922433 tolB translocation protein TolB; Provisional 98.43
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.42
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.41
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.39
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.39
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.37
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.37
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.36
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.33
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.32
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.3
KOG2110391 consensus Uncharacterized conserved protein, conta 98.28
PRK04922433 tolB translocation protein TolB; Provisional 98.28
KOG0649325 consensus WD40 repeat protein [General function pr 98.27
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.23
KOG2110391 consensus Uncharacterized conserved protein, conta 98.23
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.22
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.22
KOG4227 609 consensus WD40 repeat protein [General function pr 98.2
KOG1963 792 consensus WD40 repeat protein [General function pr 98.19
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.17
smart0054144 FYRN "FY-rich" domain, N-terminal region. is somet 98.17
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.16
PRK05137435 tolB translocation protein TolB; Provisional 98.16
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.12
PRK03629429 tolB translocation protein TolB; Provisional 98.11
PRK04792448 tolB translocation protein TolB; Provisional 98.11
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.09
KOG1310 758 consensus WD40 repeat protein [General function pr 98.01
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.0
PRK05137435 tolB translocation protein TolB; Provisional 97.99
PRK02889427 tolB translocation protein TolB; Provisional 97.98
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.96
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.95
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 97.95
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.92
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.91
PRK02889427 tolB translocation protein TolB; Provisional 97.9
PRK00178430 tolB translocation protein TolB; Provisional 97.86
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.85
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 97.84
PRK00178430 tolB translocation protein TolB; Provisional 97.83
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.8
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.8
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.76
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.75
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.72
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 97.67
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.65
KOG4547 541 consensus WD40 repeat-containing protein [General 97.59
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.58
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.58
KOG4547 541 consensus WD40 repeat-containing protein [General 97.54
KOG1963 792 consensus WD40 repeat protein [General function pr 97.53
KOG2111346 consensus Uncharacterized conserved protein, conta 97.45
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.44
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.4
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.24
KOG2321 703 consensus WD40 repeat protein [General function pr 97.24
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 97.13
KOG14451012 consensus Tumor-specific antigen (contains WD repe 97.1
KOG1409404 consensus Uncharacterized conserved protein, conta 97.06
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.05
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 96.99
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.95
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.9
KOG2321 703 consensus WD40 repeat protein [General function pr 96.79
KOG2139445 consensus WD40 repeat protein [General function pr 96.77
KOG4532344 consensus WD40-like repeat containing protein [Gen 96.76
PRK01029428 tolB translocation protein TolB; Provisional 96.75
KOG2315 566 consensus Predicted translation initiation factor 96.68
KOG2314698 consensus Translation initiation factor 3, subunit 96.66
KOG2111346 consensus Uncharacterized conserved protein, conta 96.62
PRK01029428 tolB translocation protein TolB; Provisional 96.59
KOG41901034 consensus Uncharacterized conserved protein [Funct 96.59
PRK04792448 tolB translocation protein TolB; Provisional 96.58
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.56
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 96.33
KOG41901034 consensus Uncharacterized conserved protein [Funct 96.31
KOG1334 559 consensus WD40 repeat protein [General function pr 96.24
KOG3881412 consensus Uncharacterized conserved protein [Funct 96.06
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.01
KOG2315566 consensus Predicted translation initiation factor 95.97
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.85
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 95.82
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 95.81
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 95.7
KOG0280339 consensus Uncharacterized conserved protein [Amino 95.67
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.65
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 95.44
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.4
PRK04043419 tolB translocation protein TolB; Provisional 95.18
KOG2695425 consensus WD40 repeat protein [General function pr 95.08
KOG2695425 consensus WD40 repeat protein [General function pr 95.02
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.99
PRK04043419 tolB translocation protein TolB; Provisional 94.94
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 94.91
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.89
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.86
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 94.56
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 94.53
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.5
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.2
KOG1409404 consensus Uncharacterized conserved protein, conta 94.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.94
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 93.94
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 93.67
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 93.59
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.44
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.41
KOG4714319 consensus Nucleoporin [Nuclear structure] 93.4
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 93.26
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.08
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 92.65
KOG4532344 consensus WD40-like repeat containing protein [Gen 91.88
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 90.59
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 90.29
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 90.19
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.54
KOG2139445 consensus WD40 repeat protein [General function pr 88.64
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 88.57
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 87.18
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 87.1
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 86.95
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 86.85
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 86.74
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 86.47
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 86.32
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 85.97
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 85.93
KOG4714319 consensus Nucleoporin [Nuclear structure] 85.07
KOG2314698 consensus Translation initiation factor 3, subunit 84.93
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 84.93
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 84.63
KOG2444238 consensus WD40 repeat protein [General function pr 84.6
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 82.8
PRK02888635 nitrous-oxide reductase; Validated 82.63
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 81.6
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 81.04
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-53  Score=458.12  Aligned_cols=241  Identities=21%  Similarity=0.364  Sum_probs=225.6

Q ss_pred             eeEEEecc-cceeEEEEe-cCCeEEEecCCCeEEEEe-----------ccCcceEEEee-----eee---cCCCC-cccc
Q 000725         1004 VVAKLKTD-DCVQCILVC-EPKHLIAVGESGKLHLWE-----------MNSSWSAQVEE-----CII---PINDC-IYPC 1061 (1329)
Q Consensus      1004 ll~kL~~h-~sV~cIlVc-DpnhLVSaSdDGkL~IWD-----------M~SgWsm~tee-----~Vi---~~n~~-v~p~ 1061 (1329)
                      ...+|+|| ..|.|+-|+ |.+||||+|+||+|+|||           |+|.|+|.|+|     |||   ++|.| +|+.
T Consensus        47 ~rr~LkGH~~Ki~~~~ws~Dsr~ivSaSqDGklIvWDs~TtnK~haipl~s~WVMtCA~sPSg~~VAcGGLdN~Csiy~l  126 (343)
T KOG0286|consen   47 TRRTLKGHLNKIYAMDWSTDSRRIVSASQDGKLIVWDSFTTNKVHAIPLPSSWVMTCAYSPSGNFVACGGLDNKCSIYPL  126 (343)
T ss_pred             eEEEecccccceeeeEecCCcCeEEeeccCCeEEEEEcccccceeEEecCceeEEEEEECCCCCeEEecCcCceeEEEec
Confidence            45799999 999999999 999999999999999999           99999999999     999   99999 7777


Q ss_pred             eeE-------EE-------------ecCCCCCeeEecCCCccEEEEEccccceeeeeccCccceeE--eccccccccccC
Q 000725         1062 IVE-------MK-------------RIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQ--FFPINLFSWQRN 1119 (1329)
Q Consensus      1062 I~e-------lK-------------rFpkss~lIVTgSGDgtf~LWDIskg~llqsF~ahs~sV~s--fsP~~s~S~d~~ 1119 (1329)
                      -..       ++             +|.. +.+|||+|||+||+||||++|++++.|++|+++|++  |+|..       
T Consensus       127 s~~d~~g~~~v~r~l~gHtgylScC~f~d-D~~ilT~SGD~TCalWDie~g~~~~~f~GH~gDV~slsl~p~~-------  198 (343)
T KOG0286|consen  127 STRDAEGNVRVSRELAGHTGYLSCCRFLD-DNHILTGSGDMTCALWDIETGQQTQVFHGHTGDVMSLSLSPSD-------  198 (343)
T ss_pred             ccccccccceeeeeecCccceeEEEEEcC-CCceEecCCCceEEEEEcccceEEEEecCCcccEEEEecCCCC-------
Confidence            654       11             8988 899999999999999999999999999999999999  88842       


Q ss_pred             cceEECcchhhh------c-ccccccccc---CCCceeecCCCCccceEEEEeeccCccchh--hcccccccCCCCccee
Q 000725         1120 GSVSMDASLELT------N-TATTSLFSK---HSEKSSFCPSVGEDSAIWLLVSTISDSDAQ--HNCMSRDCQKNPVRFW 1187 (1329)
Q Consensus      1120 v~tfd~~s~d~~------l-eatv~~fSg---dvn~VsF~P~sGeD~AiwLLVST~Sdd~t~--~Dlra~~~~gH~n~~w 1187 (1329)
                      .++|.++.+|+.      | +.++|.|.+   |+|+|+|+| +|++||      |+||+.+|  ||+|+++         
T Consensus       199 ~ntFvSg~cD~~aklWD~R~~~c~qtF~ghesDINsv~ffP-~G~afa------tGSDD~tcRlyDlRaD~---------  262 (343)
T KOG0286|consen  199 GNTFVSGGCDKSAKLWDVRSGQCVQTFEGHESDINSVRFFP-SGDAFA------TGSDDATCRLYDLRADQ---------  262 (343)
T ss_pred             CCeEEecccccceeeeeccCcceeEeecccccccceEEEcc-CCCeee------ecCCCceeEEEeecCCc---------
Confidence            488888888887      5 688999988   999999999 999999      99999888  9999999         


Q ss_pred             EEEeeeccceecCCCCCCCceeeecCCCeEEeecCCCeEEEEEccccceeeeeecccCceEEEEEecCCCCceEEEecCC
Q 000725         1188 RLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGILHHFKGGTVSCIATDDSGLQALAVAGDG 1267 (1329)
Q Consensus      1188 RLALl~K~siI~Gs~ldpra~afs~SG~~gfaGT~DGlVYmWDLstG~kL~tL~~Heg~rVSCVA~dps~p~~~AsA~d~ 1267 (1329)
                      +||.|.++.+|+|.    ++++||.|||++|+||.|+++++||.++|++++.|.+|+| ||||+.++   |+|||+|+++
T Consensus       263 ~~a~ys~~~~~~gi----tSv~FS~SGRlLfagy~d~~c~vWDtlk~e~vg~L~GHeN-RvScl~~s---~DG~av~TgS  334 (343)
T KOG0286|consen  263 ELAVYSHDSIICGI----TSVAFSKSGRLLFAGYDDFTCNVWDTLKGERVGVLAGHEN-RVSCLGVS---PDGMAVATGS  334 (343)
T ss_pred             EEeeeccCcccCCc----eeEEEcccccEEEeeecCCceeEeeccccceEEEeeccCC-eeEEEEEC---CCCcEEEecc
Confidence            99999999999999    9999999999999999999999999999999999999999 99999999   9999999999


Q ss_pred             CCCCccccC
Q 000725         1268 PDGGRRQRD 1276 (1329)
Q Consensus      1268 ~d~~~r~~~ 1276 (1329)
                      ||.++|||+
T Consensus       335 WDs~lriW~  343 (343)
T KOG0286|consen  335 WDSTLRIWA  343 (343)
T ss_pred             hhHheeecC
Confidence            999999995

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF05965 FYRC: F/Y rich C-terminus; InterPro: IPR003889 The "FY-rich" domain C-terminal region is sometimes closely juxtaposed with the N-terminal region (IPR003888 from INTERPRO), but sometimes is far distant Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00542 FYRC "FY-rich" domain, C-terminal region Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PF05964 FYRN: F/Y-rich N-terminus; InterPro: IPR003888 The "FY-rich" domain N-terminal region is sometimes closely juxtaposed with the C-terminal region (IPR003889 from INTERPRO), but sometimes is far distant Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00541 FYRN "FY-rich" domain, N-terminal region Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1329
2wzo_A146 Transforming growth factor beta regulator 1; nucle 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>2wzo_A Transforming growth factor beta regulator 1; nucleus, cell cycle, tumor suppressor; 1.60A {Homo sapiens} Length = 146 Back     alignment and structure
 Score = 77.3 bits (190), Expect = 1e-16
 Identities = 24/134 (17%), Positives = 45/134 (33%), Gaps = 19/134 (14%)

Query: 16  VKSEGLEIVSIGYLYKGPWEKKYWSSSRGKDRYPYPVGYHA-------VQAHNGSTCKME 68
           +   GL + S+G +     ++  +      +   YPVGY +                  +
Sbjct: 7   IGLGGLTVYSLGEII---TDRPGFHD----ESAIYPVGYCSTRIYASMKCPDQKCLYTCQ 59

Query: 69  IHEGPKGPLFMITSSDA--HSCSGQTPDIAWEKFQKKHCPRMKTWHGKRLSCKIDGVEFF 126
           I +G   P F I   D   ++    + D    +  +     M       L     G +FF
Sbjct: 60  IKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLL---PAGADFF 116

Query: 127 GFKNSFVQRLLREL 140
           GF +  +  L++  
Sbjct: 117 GFSHPAIHNLIQSC 130
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1329
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.004
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.6 bits (88), Expect = 0.004
 Identities = 44/357 (12%), Positives = 96/357 (26%), Gaps = 47/357 (13%)

Query: 950  ALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLK 1009
                  G  +V      T       +     T   H      V   +++   +   +  +
Sbjct: 21   TCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH---TGGVWSSQMRDNIIISGSTDR 77

Query: 1010 TDDCVQCILVCEPKHLIAVGESGKLHLWEMNSSWSAQVEECIIPIND-------CIYPCI 1062
            T              L     + +          S   +  +   +         +   +
Sbjct: 78   TLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHV 137

Query: 1063 VEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFSAARASIYQFFPINLFSWQRNGSV 1122
              ++ +      VV         +WD      +         +Y       F      S 
Sbjct: 138  AAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQ----FDGIHVVSG 193

Query: 1123 SMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMSRDCQKN 1182
            S+D S+ + +  T +     +   S    +       +LVS  +D              +
Sbjct: 194  SLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDN--ILVSGNAD--------------S 237

Query: 1183 PVRFWRLALLVKNRVILGSPLDPRASAIGASSG-LGIIGTNDGLVYAWELSSGNKLGILH 1241
             V+ W +      + + G      A      +    I  ++DG V  W+L +G  +  L 
Sbjct: 238  TVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLV 297

Query: 1242 HFK----GGTVSCIATDDSGLQALAVAGDGPDGGRRQRDPRHGQNDHVRIWKMDPNL 1294
              +    GG V  I   ++ L     + +G +  +            + +   D ++
Sbjct: 298  TLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETK------------LLVLDFDVDM 342

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1329
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.95
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.92
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.89
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.88
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.88
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.85
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.82
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.81
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.8
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.76
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.76
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.72
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.65
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.56
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.55
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.55
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.53
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.52
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.51
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.41
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.32
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.32
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.27
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.82
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.73
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.5
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.39
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.45
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.12
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.05
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 95.99
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 93.71
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.33
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 93.24
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 88.9
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.9
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 86.41
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 84.69
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 83.71
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1.4e-30  Score=218.59  Aligned_cols=234  Identities=17%  Similarity=0.266  Sum_probs=151.5

Q ss_pred             CCCEEEECCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEEECC-CCEEEEEEE-CCC
Q ss_conf             122016667986899823766764347986445665445667778179998257620145788314-543699972-398
Q 000725          946 ERSCALFTPDGQYLVLLDSMKTPYCREGRSDCLCSTCTSHRLDENAVKIVKVKPGYVSVVAKLKTD-DCVQCILVC-EPK 1023 (1329)
Q Consensus       946 ersglqFTPDGQ~LvLlgsik~p~CR~~~~dC~Cs~C~~s~seDNtVKIv~V~~G~vsll~kL~ah-~sV~cIlVc-Dpn 1023 (1329)
                      ...+++|+|||++|+                        +|+.|++|++|+...+.  .+..+.+| ..|.++.+. +..
T Consensus       123 ~V~~l~~s~~~~~l~------------------------s~~~dg~v~i~~~~~~~--~~~~~~~h~~~v~~~~~~~~~~  176 (388)
T d1erja_         123 YIRSVCFSPDGKFLA------------------------TGAEDRLIRIWDIENRK--IVMILQGHEQDIYSLDYFPSGD  176 (388)
T ss_dssp             BEEEEEECTTSSEEE------------------------EEETTSCEEEEETTTTE--EEEEECCCSSCEEEEEECTTSS
T ss_pred             CEEEEEECCCCCCCE------------------------ECCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC
T ss_conf             889999889998012------------------------13444111121111111--1111111111111101111111


Q ss_pred             EEEEECCCCEEEEEECCCCCEEEEEEEEECCCCCCCCCEEEEEECCCCCCEEEECCCCCCEEEEECCCCCEEEEEC----
Q ss_conf             4999548981999952576327776412068997555116877317999926713787428998733552343630----
Q 000725         1024 HLIAVGESGKLHLWEMNSSWSAQVEECIIPINDCIYPCIVEMKRIPKCAPLVVGHNGFGEFGIWDISKRVLVSRFS---- 1099 (1329)
Q Consensus      1024 hLVSaSdDGkL~IWDM~SgWsi~tee~Vi~~n~gv~p~I~elKrFpkss~lIITgSGDgtf~LWDIskg~liqtF~---- 1099 (1329)
                      .+++++.+|.+++||+.+........       .+...+... .++....++++++.|+.+.+||+.++..+..+.    
T Consensus       177 ~~~~~~~~~~i~~~d~~~~~~~~~~~-------~~~~~~~~~-~~~~~~~~l~~~~~d~~i~i~~~~~~~~~~~~~~~~~  248 (388)
T d1erja_         177 KLVSGSGDRTVRIWDLRTGQCSLTLS-------IEDGVTTVA-VSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENE  248 (388)
T ss_dssp             EEEEEETTSEEEEEETTTTEEEEEEE-------CSSCEEEEE-ECSTTCCEEEEEETTSCEEEEETTTCCEEEEEC----
T ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCC-------CCCCCCCCC-CCCCCCCEEEEECCCCEEEEEECCCCCCCEEECCCCC
T ss_conf             11122210156541011111100001-------245442112-3688787589973898199963455730001024433


Q ss_pred             ---CCCCCEEEECCCCCCCCCCCCCEEECCCHHHHCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEECCCCCCHHHCCCC
Q ss_conf             ---47665158645664333467313777403343023345100278723416898856417888621573101110334
Q 000725         1100 ---AARASIYQFFPINLFSWQRNGSVSMDASLELTNTATTSLFSKHSEKSSFCPSVGEDSAIWLLVSTISDSDAQHNCMS 1176 (1329)
Q Consensus      1100 ---ahs~sV~sfsPi~s~S~d~~v~ifd~~svE~~leatv~~fSgdvn~VsF~P~sGeD~AiwLLVST~Sdd~tl~Dlra 1176 (1329)
                         +|...|++                                      +.|+|    + +.+|++++.+..++.||++.
T Consensus       249 ~~~~h~~~v~~--------------------------------------l~~s~----~-~~~l~s~~~d~~i~iwd~~~  285 (388)
T d1erja_         249 SGTGHKDSVYS--------------------------------------VVFTR----D-GQSVVSGSLDRSVKLWNLQN  285 (388)
T ss_dssp             --CCCSSCEEE--------------------------------------EEECT----T-SSEEEEEETTSEEEEEEC--
T ss_pred             CCCCCCCCEEE--------------------------------------EEECC----C-CCEEEEEECCCCEEEEECCC
T ss_conf             34577898789--------------------------------------99979----9-99999997899289875157


Q ss_pred             CC----------------CCCCCCCEEEEEEEECCCEECCCCCCCCCEEEECCCCEEEEECCCCEEEEEECCCCCEEEEE
Q ss_conf             65----------------57898623687764034041279999873045207880895038990999983556445333
Q 000725         1177 RD----------------CQKNPVRFWRLALLVKNRVILGSPLDPRASAIGASSGLGIIGTNDGLVYAWELSSGNKLGIL 1240 (1329)
Q Consensus      1177 ~~----------------~~gH~n~~wRLALl~K~siI~Gs~ldpra~afs~SG~~gfaGT~DGlVYmWDLstG~kL~tL 1240 (1329)
                      ..                +..|....                   ++++++++|.++++|+.||.|++||+.+|+.+.++
T Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~v-------------------~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~l  346 (388)
T d1erja_         286 ANNKSDSKTPNSGTCEVTYIGHKDFV-------------------LSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLML  346 (388)
T ss_dssp             -------------CEEEEEECCSSCE-------------------EEEEECGGGCEEEEEETTSEEEEEETTTCCEEEEE
T ss_pred             CCCCCCCCCCCCCCEEEECCCCCCEE-------------------EEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEE
T ss_conf             76432101344420011012455327-------------------89998899999999969897999999999699999


Q ss_pred             ECCCCCEEEEEEECCCC---CC--EEEEECCCCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             10159659999964899---73--28992489999854568988889828995518
Q 000725         1241 HHFKGGTVSCIATDDSG---LQ--ALAVAGDGPDGGRRQRDPRHGQNDHVRIWKMD 1291 (1329)
Q Consensus      1241 ~~Heg~rVSCVA~dps~---p~--~iAvA~d~~d~~~r~~~~~~s~D~~VRiW~~~ 1291 (1329)
                      .+|++ .|++++..+..   |+  .+|++               |.|++||||+..
T Consensus       347 ~~H~~-~V~~~~~~~~~~~spd~~~l~s~---------------s~Dg~I~iW~~~  386 (388)
T d1erja_         347 QGHRN-SVISVAVANGSSLGPEYNVFATG---------------SGDCKARIWKYK  386 (388)
T ss_dssp             ECCSS-CEEEEEECSSCTTCTTCEEEEEE---------------ETTSEEEEEEEE
T ss_pred             ECCCC-CEEEEEEECCCCCCCCCCEEEEE---------------ECCCEEEEEEEE
T ss_conf             68899-78999984674258999999999---------------189979997621
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure