Citrus Sinensis ID: 001355

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090---
MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGTAKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSSSKYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGDSPINSQKQVDDSFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIRLPKIINV
cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEcccHHHHHHHHHHHHHccccccccccccccEEEEEEccHHHHHcccccHHHHHHHHHHHHHHHHcccccEEEEEEccccHHccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccccccccccEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEEHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHccccccccccccccccHHHHHccccccHHHHccccccccccccHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHHHccccccccHHccccEEEEEHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHccHHHHHHcccEEEcccccccHHHHEcccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHcccccHccccHHcccccHHHHHHHHcHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccHHHHHcccccHHccccccccHcHccccccccccEcccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEcHHHHHHccHHHHcccccccccccccccccHHHHHHHHHHccccEEEEEHHHHHHccHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHcccHHHHHHHccccccccHHccHccccccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccEcc
MRTLVTLARQCLSEESARVLDDAVGvarqrrhsqTTSLHVVSALLCVPSSLLREACdrvqsysvspkLQFRALELCLGVafdrlpssksvefppisNSLMAAIKRSqaqqrrnpdnyhlqqIHCNQQTASLLKVDLKYFVLAIlddpmasrvfgeagflsRDIKLAIiqpsvtqfpprlsltrcppiflynltdsfpgraglklpfgpddvdenCRRIGEVlagrdekkgknpllvGVCANsalkgfvesvnggkvglfprqiyglDVVCVEYEINEFVGGRVNVEMMMLKFKEVESavgrcsgpgvvvnYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKfpgldndwdlqllpihwksslmgsfvpfggffssppdfknpvrskshystlCYLCTEKLEQEVAALLKLessdsvtdqcldnltssdriaaldtskgvgtakaKDDVTALNAKIMELQRKWNDTCQslhrtqlvpkldirqrSHVQLSEFVRLMANrkgssskypslcesqctnpspgahmlsqnissaeqnatiplsseannvnfqsrlpinsstkpqsnndehllpphpladlykphehtsfSFLASVTtdlglgkiypstrqeantpklidnkeqcfsgsisaefdavsegtfhnvvqssscsaphtgepfdprdYKTLRIALAEKVGWQDEAICTISQAVSRWrigngrdvgsnskrGIWLAflgpdkvgKKKIASALAEIVfgnkgklihvdvsseqrvsqpnsifdcqnidfcdcklrGKVLVDYIYQefrskpysvvfledldkaadpivqSSLTKAistgkftdsygrdvsiSGMIFVATSTilkgkhsvhpqttpvkfsEEIILGAKRWQMQTAISHGfadaargsgmnvkvtprkensnpesrrkrkrtddgdspinsqkqvdDSFRSYldlnlpadeaeedtssekfdsdticensgawledffdQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHegllveeeasgirlpkiinv
MRTLVTLARqclseesarvlDDAVGVARQRrhsqttslhvVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIqpsvtqfpprlsLTRCPPIFLYNLTDSFPGRAGLKlpfgpddvdeNCRRIGEvlagrdekkgknpLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTsllksgngeKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLtssdriaaldtskgvgtakakdDVTALNAKIMELQRKWNDTCQSLHRtqlvpkldirqrSHVQLSEFVRLMANRKGSSSKYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAekvgwqdeaICTISqavsrwrigngrdvgsnskrgiWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQssltkaistgkftdsygrdvSISGMIFVATSTILKgkhsvhpqttpvKFSEEIILGAKRWQMQTAISHGFadaargsgmnvkvtprkensnpesrrkrkrtddgdspinsqkqvddsfRSYLDLNLPadeaeedtssekfdsDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGllveeeasgirlpkiinv
MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMgsfvpfggffssppdfKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGTAKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSSSKYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGDSPINSQKQVDDSFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIRLPKIINV
******************VLDDAVGVA*******TTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRL********************************YHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRD*KKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFK**VRSKSHYSTLCYLCTEKLEQEVAALLKLE*****TDQCLDNL*****I**************KDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRL*********************************************************************************LYKPHEHTSFSFLASVTTDLGLGKIYP*****************CFSGSISAEFDAVSEGTFHNV*****************RDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFA************************************************************************TICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIR*******
***LVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAF*******************AAIKRSQA**********************LLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIK************************************************ENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINE*********MMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSS*****************************TLCYLCTEKLEQEVA********************************************************WNDTCQ************************************************************************************************************************************************************************************************YKTLRIALAEKVGWQDEAICTISQAVSR****************IWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDV************************LRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTI******************************************GSGMNVKVT************************************YLDLNLPADEA********************WLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEG********GIRLPKIINV
MRTLVTLARQCLSEESARVLDDA*************SLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAI***********DNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDT*********KDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANR**********CESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINS********DEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHN***********TGEPFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILK*********TPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVK*************************INSQKQVDDSFRSYLDLNLPA**************DTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIRLPKIINV
***LVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSV************PPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGTAKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEF*******************************************************FQSR**********SNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCF*****A*FDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGDSPINSQKQVDDSFRSYLDLNLPADEAE***SSEKFD*DTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIRLP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLMGSFVPFGGFFSSPPDFKNPVRSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGxxxxxxxxxxxxxxxxxxxxxWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSSSKYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGDSPINSQKQVDDSFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHEGLLVEEEASGIRLPKIINV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1093 2.2.26 [Sep-21-2011]
Q54316828 Hemolysin B OS=Treponema yes no 0.132 0.175 0.312 5e-13
Q8KG79438 Probable chaperone protei yes no 0.139 0.347 0.331 1e-12
Q7UM33881 Chaperone protein ClpB OS yes no 0.139 0.172 0.295 4e-12
P33416811 Heat shock protein 78, mi yes no 0.139 0.187 0.339 5e-12
Q8NXY8818 ATP-dependent Clp proteas yes no 0.143 0.191 0.316 7e-12
Q8XZR0862 Chaperone protein ClpB OS yes no 0.147 0.186 0.327 7e-12
Q8EU05809 Chaperone protein ClpB OS yes no 0.139 0.187 0.313 8e-12
Q7NWN7859 Chaperone protein ClpB OS yes no 0.150 0.192 0.303 8e-12
Q81GM5866 Chaperone protein ClpB OS yes no 0.144 0.182 0.316 9e-12
O31673699 ATP-dependent Clp proteas yes no 0.148 0.231 0.301 9e-12
>sp|Q54316|HLYB_TREHY Hemolysin B OS=Treponema hyodysenteriae GN=tlyB PE=3 SV=1 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 85/176 (48%), Gaps = 31/176 (17%)

Query: 690 LAEKVGWQDEAICTISQAVSRWRIG---NGRDVGSNSKRGIWLAFLGPDKVGKKKIASAL 746
           L +KV  Q EAI +IS+A+ R R G   + R +GS         FLGP  VGK  +A  L
Sbjct: 515 LHQKVVGQKEAISSISKAIRRSRAGLKTSKRPLGS-------FIFLGPTGVGKTALAKVL 567

Query: 747 AEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRG-------KVLVDYIYQE 799
           +E +FG+   LI +D+S                  F   +L G             + ++
Sbjct: 568 SEFMFGDSDALIRIDMSEFME-------------KFAVSRLIGAPPGYVGYEEGGGLTEK 614

Query: 800 FRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTI 855
            R KPYS++  ++++KA  P V + L + +  G+ TD++GR V  S  I + TS +
Sbjct: 615 VRRKPYSLILFDEIEKA-HPDVTNILLQVLEEGQLTDNFGRKVDFSNTIIIITSNL 669
Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture by mechanisms not clearly defined.
Treponema hyodysenteriae (taxid: 159)
>sp|Q8KG79|CLPB1_CHLTE Probable chaperone protein ClpB 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=clpB1 PE=3 SV=1 Back     alignment and function description
>sp|Q7UM33|CLPB_RHOBA Chaperone protein ClpB OS=Rhodopirellula baltica (strain SH1) GN=clpB PE=3 SV=2 Back     alignment and function description
>sp|P33416|HSP78_YEAST Heat shock protein 78, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP78 PE=1 SV=2 Back     alignment and function description
>sp|Q8NXY8|CLPC_STAAW ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain MW2) GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|Q8XZR0|CLPB_RALSO Chaperone protein ClpB OS=Ralstonia solanacearum (strain GMI1000) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q8EU05|CLPB_OCEIH Chaperone protein ClpB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7NWN7|CLPB_CHRVO Chaperone protein ClpB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q81GM5|CLPB_BACCR Chaperone protein ClpB OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|O31673|CLPE_BACSU ATP-dependent Clp protease ATP-binding subunit ClpE OS=Bacillus subtilis (strain 168) GN=clpE PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1093
2254345761106 PREDICTED: uncharacterized protein LOC10 0.989 0.977 0.519 0.0
1478661191088 hypothetical protein VITISV_006557 [Viti 0.972 0.977 0.502 0.0
2241062391063 predicted protein [Populus trichocarpa] 0.946 0.972 0.484 0.0
2240592781025 predicted protein [Populus trichocarpa] 0.912 0.972 0.472 0.0
297745889955 unnamed protein product [Vitis vinifera] 0.852 0.975 0.467 0.0
4494551481090 PREDICTED: uncharacterized protein LOC10 0.978 0.980 0.456 0.0
4494726771094 PREDICTED: uncharacterized protein LOC10 0.981 0.980 0.454 0.0
3565695271097 PREDICTED: uncharacterized protein LOC10 0.960 0.957 0.459 0.0
3564989511097 PREDICTED: uncharacterized protein LOC10 0.966 0.962 0.460 0.0
3574907991092 ATP-dependent Clp protease ATP-binding s 0.972 0.973 0.451 0.0
>gi|225434576|ref|XP_002279036.1| PREDICTED: uncharacterized protein LOC100241532 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1041 bits (2691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1113 (51%), Positives = 741/1113 (66%), Gaps = 32/1113 (2%)

Query: 1    MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQ 60
            M T V++ARQCL++E+AR LDDAVGVAR+R H+QTTSLH +SALL  PSS LR+AC R +
Sbjct: 1    MPTPVSIARQCLTDEAARALDDAVGVARRRSHAQTTSLHAISALLAFPSSTLRDACARAR 60

Query: 61   SYSVSPKLQFRALELCLGVAFDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQ 120
            S + SP+LQFRALEL +GV+ DRLPSSK++E PP+SNSLMAAIKRSQA QRR+P+N+HLQ
Sbjct: 61   SSAYSPRLQFRALELSVGVSLDRLPSSKALEEPPVSNSLMAAIKRSQASQRRHPENFHLQ 120

Query: 121  QIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQPSVTQFPPRLS 180
            Q     QTAS L+V+LK+F+L+ILDDP+ SRVFGEAGF S DIK+A+IQP ++    R  
Sbjct: 121  Q---QNQTASFLRVELKHFILSILDDPIVSRVFGEAGFRSCDIKIAMIQPPLSPVS-RFP 176

Query: 181  LTRCPPIFLYNLTDSFPGRAGLKLPF----GPDDVDENCRRIGEVLAGRDEKKGKNPLLV 236
             TRCPPIFL NLTDS P R     PF    G  D DEN RRIGEVL     K GKNPLL+
Sbjct: 177  RTRCPPIFLCNLTDSDPARRTFSFPFAGVSGSGDGDENSRRIGEVLT---RKTGKNPLLI 233

Query: 237  GVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVE 296
            GVC++ AL+ F + V   K  + P +I GL+++C+E EI+EFVG   + + + LK KE+ 
Sbjct: 234  GVCSSDALRCFADCVERRKGDVLPAEIAGLNLICIEKEISEFVGRGGSEDKLGLKLKELG 293

Query: 297  SAVGRCSGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYE 356
                + SGPG+ VN+GELK LV D    EAA FVVS+LTSLLK+     LWL+G++ SYE
Sbjct: 294  HMAEQYSGPGIAVNFGELKALVGDDAPGEAASFVVSKLTSLLKAH--PNLWLMGSSGSYE 351

Query: 357  TYLKMLAKFPGLDNDWDLQLLPIHW----------KSSLMGSFVPFGGFFSSPPDFKNPV 406
            TYLK L +FP ++ DWDL LLPI            +SSLMGSFVPF GFFS+P DFKNP+
Sbjct: 352  TYLKFLTQFPSIEEDWDLHLLPITSSRSSVEGFCSRSSLMGSFVPFAGFFSTPTDFKNPL 411

Query: 407  RSKSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGTAK 466
             S +   TLC+LC EK EQEV+A+LK  S+ S+ D+    L S   +A  DT+KG    K
Sbjct: 412  NSTNQSITLCHLCNEKCEQEVSAILKGGSTISLADRYSGTLPSWLLMAEPDTNKGADAVK 471

Query: 467  AKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSSS 526
            AKDD  ALN K++ +Q+KW D CQ LH     PK   +    V  +E    + +R+ +SS
Sbjct: 472  AKDDGRALNDKVLGVQKKWYDICQRLHHAPPYPKSIFQPVPQVSGAECYGFIPDRRETSS 531

Query: 527  KYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPIN-SSTKPQSN 585
            K  S  ES   N SP   M  Q IS ++    +P+ SE+ +VNFQS+L  + S +K    
Sbjct: 532  KDSSPSESGSANLSPSTTMNLQKISPSKIQIPLPVVSESESVNFQSKLAGSVSKSKQVET 591

Query: 586  NDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQC-- 643
                   P PL +L    + TS S + SVTTDLGLG +Y S  QE     L  +KE+   
Sbjct: 592  RSSPWFSPCPLPNLSLAPDRTSSSCITSVTTDLGLGTLYASNSQETKRLNLQGHKERMNY 651

Query: 644  FSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAICT 703
            FSGS+SAEFD VS      + QS SCS P  G   D RD+K+L  ALA KVGWQDEAIC 
Sbjct: 652  FSGSVSAEFDVVSVNNSSQIGQSPSCSVPDLGGQMDARDFKSLWRALASKVGWQDEAICA 711

Query: 704  ISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVS 763
            ISQ VS  R GN R  GSN K  IWL+FLGPDKVGKK+IA+ALAEI+F +   L+ VD+ 
Sbjct: 712  ISQTVSSCRTGNARRHGSNLKGDIWLSFLGPDKVGKKRIAAALAEIMFRSSKSLVSVDLG 771

Query: 764  SEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQS 823
             +   +Q NSIFD   ++ C  + RGK + DYI  E R KP  VVFLE++DK AD +VQ+
Sbjct: 772  YQHGSNQSNSIFDQHELNSCGIEFRGKTITDYIAGELRKKPQLVVFLENIDK-ADLLVQT 830

Query: 824  SLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQ 883
            SL++AI TGKF DS+GR++SI+ MIFV T+T  KG  ++     PV+FSEE ILGAK WQ
Sbjct: 831  SLSQAIRTGKFPDSHGREISINHMIFVTTATSKKGNRNLVSGKEPVEFSEERILGAKSWQ 890

Query: 884  MQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDG-----DSPINSQKQVDD 938
            M+  I     +A+R +GMNV VTPR+  SNP+S  KRK  D G     D  +   K+   
Sbjct: 891  MKILIGCVTGEASRSNGMNVLVTPREGTSNPKSTSKRKFIDTGSFAEQDKYLEMSKRACK 950

Query: 939  SFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAE 998
            +  SYLDLNLP +E EED  S   DSD++ E+S AWLE+F DQ D    F+P NFD +A+
Sbjct: 951  ASNSYLDLNLPVEELEEDVDSANCDSDSLSESSEAWLEEFLDQMDEKVTFKPFNFDAVAQ 1010

Query: 999  KILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSDRKKAIENWIENVVLRSFYEVRR 1058
            K+L+EI   FQ+  G ++ LEID E++VQILAA WLS++  A+++W+E V+ +SF E R+
Sbjct: 1011 KLLKEISLNFQKIIGSDIQLEIDSEVMVQILAAAWLSEKGGAVDDWVEQVLSKSFTEARQ 1070

Query: 1059 KHHFTAGSVVKLVAHEGLLVEEEASGIRLPKII 1091
            ++  TA S+VKLV  EGL VEE+A G+ LP  I
Sbjct: 1071 RYRLTAQSLVKLVPCEGLSVEEQAPGVCLPARI 1103

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147866119|emb|CAN78825.1| hypothetical protein VITISV_006557 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106239|ref|XP_002314097.1| predicted protein [Populus trichocarpa] gi|222850505|gb|EEE88052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224059278|ref|XP_002299803.1| predicted protein [Populus trichocarpa] gi|222847061|gb|EEE84608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297745889|emb|CBI15945.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455148|ref|XP_004145315.1| PREDICTED: uncharacterized protein LOC101203741 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449472677|ref|XP_004153665.1| PREDICTED: uncharacterized protein LOC101204506 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356569527|ref|XP_003552951.1| PREDICTED: uncharacterized protein LOC100776148 [Glycine max] Back     alignment and taxonomy information
>gi|356498951|ref|XP_003518309.1| PREDICTED: uncharacterized protein LOC100804458 [Glycine max] Back     alignment and taxonomy information
>gi|357490799|ref|XP_003615687.1| ATP-dependent Clp protease ATP-binding subunit clpL [Medicago truncatula] gi|355517022|gb|AES98645.1| ATP-dependent Clp protease ATP-binding subunit clpL [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1093
TAIR|locus:2007412979 AT1G07200 "AT1G07200" [Arabido 0.534 0.596 0.440 5e-177
TAIR|locus:20456531002 AT2G29970 [Arabidopsis thalian 0.613 0.669 0.423 2e-149
TAIR|locus:2065074910 AT2G40130 [Arabidopsis thalian 0.339 0.407 0.430 1.1e-114
TAIR|locus:2172585990 AT5G57710 [Arabidopsis thalian 0.419 0.463 0.330 7.9e-82
TAIR|locus:2118806924 AT4G30350 "AT4G30350" [Arabido 0.419 0.495 0.327 1.7e-67
TAIR|locus:2079904815 AT3G52490 [Arabidopsis thalian 0.144 0.193 0.429 2.6e-44
TAIR|locus:21239441017 AT4G29920 [Arabidopsis thalian 0.158 0.170 0.413 8.2e-35
TAIR|locus:21755891028 AT5G57130 "AT5G57130" [Arabido 0.096 0.103 0.464 1.1e-29
TAIR|locus:2019667911 HSP101 "heat shock protein 101 0.141 0.170 0.277 1.3e-16
UNIPROTKB|Q6F2Y7912 CLPB1 "Chaperone protein ClpB1 0.141 0.169 0.289 1.5e-16
TAIR|locus:2007412 AT1G07200 "AT1G07200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1129 (402.5 bits), Expect = 5.0e-177, Sum P(3) = 5.0e-177
 Identities = 280/635 (44%), Positives = 375/635 (59%)

Query:     1 MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREAC-DRV 59
             M T VT AR+CL+EE+AR LDDAV VAR+R H+QTTSLH VSALL +PSS+LRE C  R 
Sbjct:     1 MPTPVTTARECLTEEAARALDDAVVVARRRSHAQTTSLHAVSALLAMPSSILREVCVSRA 60

Query:    60 -QSYSVSPKLQFRALELCLGVAFDRLPSSKSV---EFPPISNSLMAAIKRSQAQQRRNPD 115
              +S   S +LQFRALELC+GV+ DRLPSSKS    E PP+SNSLMAAIKRSQA QRR+P+
Sbjct:    61 ARSVPYSSRLQFRALELCVGVSLDRLPSSKSPATEEDPPVSNSLMAAIKRSQANQRRHPE 120

Query:   116 NYHLQQIHCNQQ-----TASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAIIQP 170
             +YHLQQIH +         ++LKV+LKYF+L+ILDDP+ +RVFGEAGF S +IKL ++ P
Sbjct:   121 SYHLQQIHASNNGGGGCQTTVLKVELKYFILSILDDPIVNRVFGEAGFRSSEIKLDVLHP 180

Query:   171 SVTQFPPRLSLTRCPPIFLYNLTDSFPGRAGLKLPF-GPDDVDENCRRIGEVLAGRDEKK 229
              VTQ   R S  RCPP+FL NL +S P R   + PF G    DEN RRIGEVL GR +KK
Sbjct:   181 PVTQLSSRFSRGRCPPLFLCNLPNSDPNR---EFPFSGSSGFDENSRRIGEVL-GRKDKK 236

Query:   230 GKNPLLVGVCANSALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVG-GRVNVEMM 288
               NPLL+G CAN ALK F +S+N GK+G     I GL ++ +E EI+E +  G  N E +
Sbjct:   237 --NPLLIGNCANEALKTFTDSINSGKLGFLQMDISGLSLISIEKEISEILADGSKNEEEI 294

Query:   289 MLKFKEVESAVGRC-SGPGVVVNYGELKVLVSDSVSTEAARFVVSQLTSLLKSGNGEKLW 347
              +K  ++   V +  S  G+V+N GELKVL S++    A   +VS+L+ LLK    ++L 
Sbjct:   295 RMKVDDLGRTVEQSGSKSGIVLNLGELKVLTSEA--NAALEILVSKLSDLLKH-ESKQLS 351

Query:   348 LIGAAMSYETYLKMLAKFPGLDNDWDLQLLPI-----------HWKSSLMXXXXXXXXXX 396
              IG   S ETY K++ +FP ++ DWDL +LPI           + KSSLM          
Sbjct:   352 FIGCVSSNETYTKLIDRFPTIEKDWDLHVLPITASTKPSTQGVYPKSSLMGSFVPFGGFF 411

Query:   397 XXXXXXKNPVRSKSHYS-TLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAA 455
                   + P+ S  + + + C+LC EK  QEVAA+LK  SS S+ D+C + L    R   
Sbjct:   412 SSTSNFRVPLSSTVNQTLSRCHLCNEKYLQEVAAVLKAGSSLSLADKCSEKLAPWLRAIE 471

Query:   456 LDTSKGV-GTAKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSH---VQL 511
                 KG+ G++KA DD     ++   LQ+KW++ CQS+H T   PKL  +  S    VQ 
Sbjct:   472 TKEDKGITGSSKALDDANTSASQTAALQKKWDNICQSIHHTPAFPKLGFQSVSPQFPVQT 531

Query:   512 SEFVRLMANRKGSSSKYPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQ 571
              + VR       S  + P L     + P P      ++++++  N T+ L       +F 
Sbjct:   532 EKSVRTPT----SYLETPKLLNPPISKPKP-----MEDLTASVTNRTVSLPLSCVTTDFG 582

Query:   572 SRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHT 606
               L +  ++K Q +      P   L  L    EHT
Sbjct:   583 --LGVIYASKNQESKTTREKPM--LVTLNSSLEHT 613
GO:0005524 "ATP binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2045653 AT2G29970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065074 AT2G40130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172585 AT5G57710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118806 AT4G30350 "AT4G30350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079904 AT3G52490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123944 AT4G29920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175589 AT5G57130 "AT5G57130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019667 HSP101 "heat shock protein 101" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6F2Y7 CLPB1 "Chaperone protein ClpB1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1093
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 1e-14
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-10
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 5e-10
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 1e-09
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 2e-09
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 2e-06
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 4e-06
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 7e-04
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 9e-04
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 78.1 bits (193), Expect = 1e-14
 Identities = 57/173 (32%), Positives = 88/173 (50%), Gaps = 27/173 (15%)

Query: 689 ALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAE 748
            L ++V  QDEA+  +S A+ R R G    +G  ++      FLGP  VGK ++A ALAE
Sbjct: 488 RLKKRVIGQDEAVEAVSDAIRRARAG----LGDPNRPIGSFLFLGPTGVGKTELAKALAE 543

Query: 749 IVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYI-YQE-------F 800
            +FG++  LI +D+S      + +S+           +L G     Y+ Y+E        
Sbjct: 544 ALFGDEQALIRIDMS---EYMEKHSV----------SRLIGAPP-GYVGYEEGGQLTEAV 589

Query: 801 RSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATS 853
           R KPYSV+ L++++K A P V + L + +  G+ TD  GR V     I + TS
Sbjct: 590 RRKPYSVILLDEIEK-AHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTS 641

Length = 786
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1093
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.93
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.92
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.85
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.83
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.82
COG2204464 AtoC Response regulator containing CheY-like recei 99.78
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.78
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.78
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.76
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.74
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.71
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.69
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.66
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.66
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.63
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.63
PRK11608326 pspF phage shock protein operon transcriptional ac 99.62
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.61
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.6
PRK15424538 propionate catabolism operon regulatory protein Pr 99.6
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.59
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.57
COG1221403 PspF Transcriptional regulators containing an AAA- 99.56
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.56
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.55
CHL00181287 cbbX CbbX; Provisional 99.55
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.53
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.52
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.49
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.49
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.47
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.41
PRK15115444 response regulator GlrR; Provisional 99.39
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.39
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.38
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.36
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.35
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.34
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.33
PRK13531 498 regulatory ATPase RavA; Provisional 99.33
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.32
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.29
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.25
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.21
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.21
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.2
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.2
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.12
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.12
PLN03025319 replication factor C subunit; Provisional 99.12
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.12
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.11
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.1
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.1
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.1
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.09
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.09
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.09
PRK13342413 recombination factor protein RarA; Reviewed 99.08
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.08
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.07
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.07
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.05
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.05
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.04
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.03
PRK13341 725 recombination factor protein RarA/unknown domain f 99.03
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.02
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.0
PRK03992389 proteasome-activating nucleotidase; Provisional 99.0
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.99
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.97
PRK12402337 replication factor C small subunit 2; Reviewed 98.95
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.94
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.93
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.93
COG0714329 MoxR-like ATPases [General function prediction onl 98.93
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.92
CHL00195489 ycf46 Ycf46; Provisional 98.92
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.92
PRK07940394 DNA polymerase III subunit delta'; Validated 98.91
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.91
PHA02544316 44 clamp loader, small subunit; Provisional 98.9
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.89
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.88
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.88
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.87
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.87
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.87
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 98.86
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.85
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.85
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.84
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.84
PRK04195 482 replication factor C large subunit; Provisional 98.83
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.83
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.83
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.82
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.8
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.8
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.8
PTZ001121164 origin recognition complex 1 protein; Provisional 98.79
PRK06893229 DNA replication initiation factor; Validated 98.78
PRK00440319 rfc replication factor C small subunit; Reviewed 98.78
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.78
KOG0734752 consensus AAA+-type ATPase containing the peptidas 98.77
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.77
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.77
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.77
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.76
KOG0736953 consensus Peroxisome assembly factor 2 containing 98.76
smart00350509 MCM minichromosome maintenance proteins. 98.76
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.76
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.74
CHL00176638 ftsH cell division protein; Validated 98.74
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.74
KOG2028554 consensus ATPase related to the helicase subunit o 98.73
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.72
PHA02244383 ATPase-like protein 98.72
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.71
PF00004132 AAA: ATPase family associated with various cellula 98.71
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.71
PRK13765 637 ATP-dependent protease Lon; Provisional 98.71
PRK09112351 DNA polymerase III subunit delta'; Validated 98.7
PRK08084235 DNA replication initiation factor; Provisional 98.7
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.7
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.7
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.69
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.69
PRK07399314 DNA polymerase III subunit delta'; Validated 98.69
PRK07471365 DNA polymerase III subunit delta'; Validated 98.66
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.65
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.64
PRK08727233 hypothetical protein; Validated 98.64
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.63
PRK05564313 DNA polymerase III subunit delta'; Validated 98.62
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.62
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.61
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.6
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.6
PF07726131 AAA_3: ATPase family associated with various cellu 98.59
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.58
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.57
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.57
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.56
PRK08058329 DNA polymerase III subunit delta'; Validated 98.55
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.54
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.53
PRK05642234 DNA replication initiation factor; Validated 98.51
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.51
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 98.47
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.45
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 98.45
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.45
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.45
CHL00206 2281 ycf2 Ycf2; Provisional 98.43
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.42
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.41
PRK10865 857 protein disaggregation chaperone; Provisional 98.41
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 98.39
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.39
PRK05707328 DNA polymerase III subunit delta'; Validated 98.38
PRK09862506 putative ATP-dependent protease; Provisional 98.38
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.38
PRK06871325 DNA polymerase III subunit delta'; Validated 98.35
PRK08769319 DNA polymerase III subunit delta'; Validated 98.34
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.33
PRK07993334 DNA polymerase III subunit delta'; Validated 98.32
CHL00095 821 clpC Clp protease ATP binding subunit 98.31
PRK00149450 dnaA chromosomal replication initiation protein; R 98.31
KOG0731774 consensus AAA+-type ATPase containing the peptidas 98.31
PRK14087450 dnaA chromosomal replication initiation protein; P 98.29
PRK14086617 dnaA chromosomal replication initiation protein; P 98.28
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.27
PRK06964342 DNA polymerase III subunit delta'; Validated 98.27
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 98.26
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.25
PRK14088440 dnaA chromosomal replication initiation protein; P 98.24
PRK12422445 chromosomal replication initiation protein; Provis 98.24
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.24
PRK04132846 replication factor C small subunit; Provisional 98.22
PRK06090319 DNA polymerase III subunit delta'; Validated 98.22
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.19
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.18
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.14
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.12
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.11
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.1
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.09
PRK09087226 hypothetical protein; Validated 98.08
PRK06620214 hypothetical protein; Validated 98.08
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.06
PRK12377248 putative replication protein; Provisional 98.04
smart00382148 AAA ATPases associated with a variety of cellular 98.03
PRK08699325 DNA polymerase III subunit delta'; Validated 98.03
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.02
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.01
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.0
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.96
PRK05917290 DNA polymerase III subunit delta'; Validated 97.83
PRK08116268 hypothetical protein; Validated 97.82
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 97.82
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.76
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 97.72
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.71
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 97.71
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.7
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.68
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 97.68
PRK07276290 DNA polymerase III subunit delta'; Validated 97.65
PRK05818261 DNA polymerase III subunit delta'; Validated 97.62
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.61
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 97.59
COG0593408 DnaA ATPase involved in DNA replication initiation 97.57
PF13173128 AAA_14: AAA domain 97.57
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.56
PRK08939306 primosomal protein DnaI; Reviewed 97.54
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.53
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 97.53
PRK06835329 DNA replication protein DnaC; Validated 97.48
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.47
PRK08181269 transposase; Validated 97.46
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.43
PRK07952244 DNA replication protein DnaC; Validated 97.41
PRK06526254 transposase; Provisional 97.36
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 97.3
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.28
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 97.28
PRK06921266 hypothetical protein; Provisional 97.2
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.2
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.19
KOG0480764 consensus DNA replication licensing factor, MCM6 c 97.02
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.0
PRK09183259 transposase/IS protein; Provisional 96.99
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 96.98
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 96.93
KOG1969 877 consensus DNA replication checkpoint protein CHL12 96.93
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.91
PRK07132299 DNA polymerase III subunit delta'; Validated 96.89
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.83
PRK15455 644 PrkA family serine protein kinase; Provisional 96.81
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 96.78
KOG0477854 consensus DNA replication licensing factor, MCM2 c 96.77
KOG0481729 consensus DNA replication licensing factor, MCM5 c 96.72
PF05729166 NACHT: NACHT domain 96.71
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.67
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 96.64
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.48
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.41
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 96.38
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.88
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.87
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 95.87
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 95.85
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 95.83
KOG0736 953 consensus Peroxisome assembly factor 2 containing 95.81
PF00004132 AAA: ATPase family associated with various cellula 95.81
PRK10536262 hypothetical protein; Provisional 95.77
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.74
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.7
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 95.66
PRK04296190 thymidine kinase; Provisional 95.63
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 95.53
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.47
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.43
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 95.41
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 95.37
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.33
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.32
PHA02774613 E1; Provisional 95.29
PHA00729226 NTP-binding motif containing protein 95.25
TIGR00064272 ftsY signal recognition particle-docking protein F 95.14
PRK10867433 signal recognition particle protein; Provisional 95.09
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.08
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 95.06
PRK14974336 cell division protein FtsY; Provisional 95.0
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.98
PRK06581263 DNA polymerase III subunit delta'; Validated 94.87
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.87
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.82
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 94.78
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.77
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.74
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.72
PRK06696223 uridine kinase; Validated 94.71
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.69
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.67
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.49
PRK00131175 aroK shikimate kinase; Reviewed 94.44
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.42
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.31
KOG1514767 consensus Origin recognition complex, subunit 1, a 94.29
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.29
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.14
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.13
PRK10416318 signal recognition particle-docking protein FtsY; 94.09
PRK08118167 topology modulation protein; Reviewed 94.04
CHL00181287 cbbX CbbX; Provisional 94.04
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.03
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.02
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.95
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 93.94
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.93
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.93
PRK13947171 shikimate kinase; Provisional 93.88
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.88
PRK00771437 signal recognition particle protein Srp54; Provisi 93.87
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.85
TIGR00959428 ffh signal recognition particle protein. This mode 93.76
PF13479213 AAA_24: AAA domain 93.68
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.64
PHA01747425 putative ATP-dependent protease 93.56
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.56
PRK03839180 putative kinase; Provisional 93.53
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.49
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 93.3
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.29
PRK05541176 adenylylsulfate kinase; Provisional 93.29
PRK03846198 adenylylsulfate kinase; Provisional 93.28
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.17
PRK13851344 type IV secretion system protein VirB11; Provision 93.16
KOG0482721 consensus DNA replication licensing factor, MCM7 c 93.12
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.06
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.02
PRK00625173 shikimate kinase; Provisional 93.0
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 92.89
PRK13833323 conjugal transfer protein TrbB; Provisional 92.89
PRK14532188 adenylate kinase; Provisional 92.87
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 92.85
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 92.82
PRK03992389 proteasome-activating nucleotidase; Provisional 92.82
PRK07261171 topology modulation protein; Provisional 92.8
PRK06762166 hypothetical protein; Provisional 92.72
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 92.68
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.67
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.61
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.54
PRK06067234 flagellar accessory protein FlaH; Validated 92.54
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 92.53
PLN02200234 adenylate kinase family protein 92.53
PRK06217183 hypothetical protein; Validated 92.45
PRK10436462 hypothetical protein; Provisional 92.41
PRK06547172 hypothetical protein; Provisional 92.4
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 92.31
PRK08233182 hypothetical protein; Provisional 92.29
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 92.28
CHL00176638 ftsH cell division protein; Validated 92.21
PRK08154309 anaerobic benzoate catabolism transcriptional regu 92.19
PRK14531183 adenylate kinase; Provisional 92.19
PLN03210 1153 Resistant to P. syringae 6; Provisional 91.96
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 91.93
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 91.89
PRK13949169 shikimate kinase; Provisional 91.88
CHL00195489 ycf46 Ycf46; Provisional 91.86
PRK00889175 adenylylsulfate kinase; Provisional 91.77
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 91.76
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.71
PRK14530215 adenylate kinase; Provisional 91.7
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.67
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 91.64
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.59
PRK13948182 shikimate kinase; Provisional 91.55
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 91.53
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 91.49
cd03246173 ABCC_Protease_Secretion This family represents the 91.45
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 91.43
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 91.41
PRK03731171 aroL shikimate kinase II; Reviewed 91.37
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 91.26
COG1485367 Predicted ATPase [General function prediction only 91.15
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.13
PRK09435332 membrane ATPase/protein kinase; Provisional 91.13
cd03115173 SRP The signal recognition particle (SRP) mediates 91.13
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 91.13
PRK07667193 uridine kinase; Provisional 91.07
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.04
PRK09270229 nucleoside triphosphate hydrolase domain-containin 90.99
PTZ00088229 adenylate kinase 1; Provisional 90.95
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 90.94
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 90.94
PRK00279215 adk adenylate kinase; Reviewed 90.82
PF04851184 ResIII: Type III restriction enzyme, res subunit; 90.82
PRK05480209 uridine/cytidine kinase; Provisional 90.79
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 90.79
TIGR00235207 udk uridine kinase. Model contains a number of lon 90.56
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 90.56
PRK05057172 aroK shikimate kinase I; Reviewed 90.5
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 90.44
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 90.42
TIGR02237209 recomb_radB DNA repair and recombination protein R 90.38
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 90.33
PRK02496184 adk adenylate kinase; Provisional 90.27
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.23
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.19
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 90.16
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 90.07
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 90.02
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 89.95
PRK13946184 shikimate kinase; Provisional 89.9
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 89.88
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 89.82
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 89.73
PF1324576 AAA_19: Part of AAA domain 89.7
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 89.59
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 89.58
PLN02165334 adenylate isopentenyltransferase 89.51
PRK10875615 recD exonuclease V subunit alpha; Provisional 89.45
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 89.45
PLN02674244 adenylate kinase 89.4
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 89.39
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 89.31
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 89.29
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 89.27
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 89.18
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 89.13
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 89.09
PRK04220301 2-phosphoglycerate kinase; Provisional 89.07
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 89.06
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 89.03
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 89.01
PRK09361225 radB DNA repair and recombination protein RadB; Pr 88.97
COG4088261 Predicted nucleotide kinase [Nucleotide transport 88.85
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 88.84
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 88.8
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 88.79
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 88.79
PRK14528186 adenylate kinase; Provisional 88.78
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 88.66
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 88.57
PRK13764602 ATPase; Provisional 88.45
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 88.38
PRK14527191 adenylate kinase; Provisional 88.38
PLN02840421 tRNA dimethylallyltransferase 88.36
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 88.36
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 88.34
PRK04040188 adenylate kinase; Provisional 88.32
PHA02624647 large T antigen; Provisional 88.26
PRK00411394 cdc6 cell division control protein 6; Reviewed 88.26
PRK05439311 pantothenate kinase; Provisional 88.25
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 88.24
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 88.21
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 88.2
TIGR02012321 tigrfam_recA protein RecA. This model describes or 88.19
cd01394218 radB RadB. The archaeal protein radB shares simila 88.18
PRK00300205 gmk guanylate kinase; Provisional 88.12
PRK11823446 DNA repair protein RadA; Provisional 88.06
PRK13975196 thymidylate kinase; Provisional 88.03
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 87.86
PRK14526211 adenylate kinase; Provisional 87.74
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 87.69
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 87.62
PF1355562 AAA_29: P-loop containing region of AAA domain 87.58
TIGR02928365 orc1/cdc6 family replication initiation protein. M 87.36
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 87.19
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 87.18
PLN02459261 probable adenylate kinase 87.16
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 87.13
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 87.11
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 87.06
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 86.99
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 86.93
PLN02199303 shikimate kinase 86.9
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 86.87
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 86.83
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 86.81
PRK04182180 cytidylate kinase; Provisional 86.8
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 86.71
cd00983325 recA RecA is a bacterial enzyme which has roles in 86.65
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 86.63
PRK00698205 tmk thymidylate kinase; Validated 86.6
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 86.53
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 86.53
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 86.4
PRK15453290 phosphoribulokinase; Provisional 86.31
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 86.29
PHA02530300 pseT polynucleotide kinase; Provisional 86.09
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 86.07
PRK14529223 adenylate kinase; Provisional 86.07
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 86.01
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 85.99
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 85.91
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 85.75
PRK14738206 gmk guanylate kinase; Provisional 85.62
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 85.6
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 85.58
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 85.55
COG1936180 Predicted nucleotide kinase (related to CMP and AM 85.51
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-138  Score=1260.92  Aligned_cols=833  Identities=32%  Similarity=0.422  Sum_probs=656.0

Q ss_pred             CCcchhhhhhhcCHHHHHHHHHHHHHHHHcCCCCccHHHHHHHHccCCCchHHHHHHhhccCCCCchhhHHHHHHHHHHh
Q 001355            1 MRTLVTLARQCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVA   80 (1093)
Q Consensus         1 m~~~~~~~~q~lt~~a~~~l~~A~~lA~rr~h~q~tplH~~~alL~~~~~~lr~a~~~~~~~~~s~~lq~~aLel~~~~a   80 (1093)
                      ||||++|+|||||++|+.||++|+++||||||+||||||+++|||++|+|+||+||.++|      |+||+|||+||+|+
T Consensus         1 m~t~~~t~~q~lT~~Aa~~L~~a~~~Arrrgh~qvtplH~~~~LLs~~t~~lr~ac~~~~------~l~~ralelc~~v~   74 (898)
T KOG1051|consen    1 MRTGVYTVQQTLTEEAATVLKQAVTEARRRGHAQVTPLHVASTLLSSPTGILRRACIKSH------PLQCRALELCFNVS   74 (898)
T ss_pred             CCCcccchHhhhCHHHHHHHHHHHHHHHHcCCCCcchHHHHHHHHcCCchHHHHHHHhcC------cccHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999996      49999999999999


Q ss_pred             hccCCCCCCCCCCCCcHHHHHHHHHHHHhhhcCCCCcchhhhhccccccceeeehhHHHHHHHhcCchhhhhhcccCCCc
Q 001355           81 FDRLPSSKSVEFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLS  160 (1093)
Q Consensus        81 L~rlp~~~~~~~p~~Sn~l~aa~kraqa~qrr~~~~~~~~q~~~~~~~~~~~kv~~e~lilsilddp~vsrv~~eagf~s  160 (1093)
                      |+|||++.+   |++||+|||||||+||||||++.+       +|||   +||||++|||++|||||+|+||||||||+|
T Consensus        75 l~rlpt~~~---p~~sn~l~aalkr~qa~qrr~~~~-------~~~~---~vkvE~~~li~silDdp~vsrv~reag~~s  141 (898)
T KOG1051|consen   75 LNRLPTSYG---PPVSNALMAALKRAQAHQRRGCEE-------QQQQ---AVKVELEQLILSILDDPSVSRVMREAGFSS  141 (898)
T ss_pred             HHhccCCCC---CccchHhHHHHHHHHHHHHhcchh-------hccc---hhhHhHHhhheeeecCchHHHHHHHhcCCh
Confidence            999999865   999999999999999999999853       1223   789999999999999999999999999999


Q ss_pred             HHHHHhhccCCCCCCCCCCCCCCCCCccccCC-CCCCC-CCCCCCCCCCCCCc-hhhHHHHHHHhhcccccCCCCcEEec
Q 001355          161 RDIKLAIIQPSVTQFPPRLSLTRCPPIFLYNL-TDSFP-GRAGLKLPFGPDDV-DENCRRIGEVLAGRDEKKGKNPLLVG  237 (1093)
Q Consensus       161 ~~vk~~i~~~~~~~~~~~~~~~~~~~~~~~n~-~~~~~-~~~~~~~p~~~~~r-deeirrv~~vL~R~~~~~k~NpvlVG  237 (1093)
                      ++||.+|++++..... .+.+...++.|++++ ++..| ++.|+.+|+  +|| ||||||||+||+|   ||||||||||
T Consensus       142 ~~vK~~ve~~~g~~~~-~~~~~~~~~~~L~~~~~dl~p~a~~gkldPv--igr~deeirRvi~iL~R---rtk~NPvLVG  215 (898)
T KOG1051|consen  142 SAVKSAVEQPVGQFRS-PSRGPLWPLLFLENYGTDLTPRARQGKLDPV--IGRHDEEIRRVIEILSR---KTKNNPVLVG  215 (898)
T ss_pred             HHHHHHHHhhccccCC-CCcCCccchhHHHhcccccChhhhccCCCCc--cCCchHHHHHHHHHHhc---cCCCCceEEe
Confidence            9999999998632211 111113356676764 33333 455899999  577 9999999999999   9999999999


Q ss_pred             cchhh---HHHHHHHHHhcCCCCCCCccccCcEEEEeechhhhhhcCCccHHHHHHHHHHHHHHhhccCCCcEEEEeCcc
Q 001355          238 VCANS---ALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGEL  314 (1093)
Q Consensus       238 e~~~~---a~~~~~~~i~~~~~g~vp~~L~~~~v~~l~~e~~~~~a~~~~r~e~e~rlkel~~~v~~~~~~gvil~igdl  314 (1093)
                      |||++   .++|+|++|.+|   +||+.|++.++++|+  |+.+++|+++|||||.|||+|+++|++ +++|||||||||
T Consensus       216 ~~gvgktaiv~gla~ri~~G---~vp~~l~~~~l~~l~--~g~l~aGa~~rge~E~rlk~l~k~v~~-~~~gvILfigel  289 (898)
T KOG1051|consen  216 EPGVGKTAIVEGLAQRIATG---DVPETLKDKKLIALD--FGSLVAGAKRRGEFEERLKELLKEVES-GGGGVILFLGEL  289 (898)
T ss_pred             cCCCCchhHHHHHHHHhhcC---CCCccccccceEEEE--hhhcccCcccchHHHHHHHHHHHHHhc-CCCcEEEEecce
Confidence            99998   499999999986   999999999999999  999999999999999999999999998 489999999999


Q ss_pred             hhhhcCCCcchHHHHHHHHHHhhhcC-CCCCcEEEEEecccHHHHHhhhhcCCCCCCCCcceeeeccCCCCCC-------
Q 001355          315 KVLVSDSVSTEAARFVVSQLTSLLKS-GNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSSLM-------  386 (1093)
Q Consensus       315 ~~~v~~~~~~~~~~~~v~el~~Ll~~-~~~g~lwliG~a~T~~tY~k~~~~~PslE~~w~Lq~v~i~~~~sl~-------  386 (1093)
                      ||+|++++.+|++++     .+||+| +++|+|||||| ||++||+||++|||+||++|+||+|+||..+.+.       
T Consensus       290 h~lvg~g~~~~~~d~-----~nlLkp~L~rg~l~~IGa-tT~e~Y~k~iekdPalErrw~l~~v~~pS~~~~~~iL~~l~  363 (898)
T KOG1051|consen  290 HWLVGSGSNYGAIDA-----ANLLKPLLARGGLWCIGA-TTLETYRKCIEKDPALERRWQLVLVPIPSVENLSLILPGLS  363 (898)
T ss_pred             eeeecCCCcchHHHH-----HHhhHHHHhcCCeEEEec-ccHHHHHHHHhhCcchhhCcceeEeccCcccchhhhhhhhh
Confidence            999999988775543     455555 45788999999 5999999999999999999999999999543211       


Q ss_pred             -CcccCCCCCCCCCCCCCCCccC-CCCccchhhHHHhhHHHHHHHHhhhcCCCccccccccCCchhhhhcccCCCCCCcc
Q 001355          387 -GSFVPFGGFFSSPPDFKNPVRS-KSHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLTSSDRIAALDTSKGVGT  464 (1093)
Q Consensus       387 -~s~~~~~g~~s~~~~~~~p~~~-~~~~~~~C~~C~~~~E~e~~~~~~~~~~~s~~~~~~~~lP~WLq~~~~~~~~~~~~  464 (1093)
                       -.++++|++++....+..+... .+....||+.|+.+|+.|+.+..+.         +...+|+|||+.+...      
T Consensus       364 ~~~e~~hg~~~s~~a~~~a~~~s~~~~t~r~lpd~aidl~dEa~a~~~~---------~~~~lP~wL~~~~~~~------  428 (898)
T KOG1051|consen  364 ERYEVHHGVRISDESLFSAAQLSARYITLSFLPDCAIDLEDEAAALVKS---------QAESLPPWLQNLERVD------  428 (898)
T ss_pred             hhhccccCCcccccccccccchhhhhcccCcCchhcccHHHHHHHHHhh---------hhhhCCHHHHhhhhhh------
Confidence             1356788888765555544332 3466899999999999999988863         3567999999996322      


Q ss_pred             ccccchhHHHHHHHHHHHHHHHHHhhhcccCCCCCcccccccccchhhHHHHHhhccCCCC-CCCCCcccCCCCCCCCCc
Q 001355          465 AKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSS-SKYPSLCESQCTNPSPGA  543 (1093)
Q Consensus       465 ~~~kd~~~~~~~~~~~L~kkW~~~c~~lh~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~-s~~~~~~~~~~~~~~~~~  543 (1093)
                             ...+.++.+|+||||   +++|.+.....+...                 +... +...+|.    +   .  
T Consensus       429 -------~~~~~e~~~L~kk~d---~~~h~r~~~~~~~~~-----------------~~~~~~l~~~~~----~---~--  472 (898)
T KOG1051|consen  429 -------IKLQDEISELQKKWN---QALHKRPSLESLAPS-----------------KPTQQPLSASVD----S---E--  472 (898)
T ss_pred             -------hhhHHHHHHHHHhhh---hhhcccccccccccc-----------------ccccccchhhhc----c---c--
Confidence                   225667889999999   788876532222000                 0000 0000000    0   0  


Q ss_pred             ccccccccccccccCcccccccccccccC--ccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccceeecccCC
Q 001355          544 HMLSQNISSAEQNATIPLSSEANNVNFQS--RLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTSFSFLASVTTDLGLG  621 (1093)
Q Consensus       544 ~~~~~~~~~~~~~~~~p~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~V~tdL~Lg  621 (1093)
                                            .+  +..  ++.++....     .....++          .|   ....++.|||.||
T Consensus       473 ----------------------~s--~~~~l~~~~~~~~~-----~~~~~k~----------~r---~~d~~~~~~l~~~  510 (898)
T KOG1051|consen  473 ----------------------RS--VIEELKLKKNSLDR-----NSLLAKA----------HR---PNDYTRETDLRYG  510 (898)
T ss_pred             ----------------------hh--HHhhhccccCCccc-----chhhhcc----------cC---CCCcchhhhcccc
Confidence                                  00  000  000100000     0000000          11   1234678999999


Q ss_pred             ccCCCccccCCCccccccccccccCCcccccccccCCccccccccCCCCCCCCCCCCCHHHHHHHHHHHhcccCccHHHH
Q 001355          622 KIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLRIALAEKVGWQDEAI  701 (1093)
Q Consensus       622 ~~~~s~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~s~~~~~ss~~~~~~~~~~~d~e~lk~L~~~L~e~ViGQdeai  701 (1093)
                      .++...+  .+                +.++..++.+++++.++|+++|+.... +.+.++|+.|++.|.++|+||++|+
T Consensus       511 ~~p~~~~--~~----------------~~~~~~~~~~i~~~~s~~tgip~~~~~-~~e~~~l~~L~~~L~~~V~gQ~eAv  571 (898)
T KOG1051|consen  511 RIPDELS--EK----------------SNDNQGGESDISEVVSRWTGIPVDRLA-EAEAERLKKLEERLHERVIGQDEAV  571 (898)
T ss_pred             ccchhhh--hh----------------cccccCCccchhhhhhhhcCCchhhhh-hhHHHHHHHHHHHHHhhccchHHHH
Confidence            9992211  10                001112567889999999999997774 6788999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCCCCCCCCCeEEEeeCCCCChHHHHHHHHHHHhccCCCceEEeecCCccccCCCCccccCCCcc
Q 001355          702 CTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNID  781 (1093)
Q Consensus       702 ~~Ia~aI~~~rsg~~~~~~~~~k~~~~LLf~Gp~GvGKT~lAraLA~~lfgs~~~fv~id~s~~~~~~~~~si~~~~~l~  781 (1093)
                      .+|+.+|.+|+.|..++     +++.||+|.||+|+|||+||++||+.+||+.+.||+|||+.|.+ .        ..+.
T Consensus       572 ~aIa~AI~~sr~gl~~~-----~~~awflflGpdgvGKt~lAkaLA~~~Fgse~~~IriDmse~~e-v--------skli  637 (898)
T KOG1051|consen  572 AAIAAAIRRSRAGLKDP-----NPDAWFLFLGPDGVGKTELAKALAEYVFGSEENFIRLDMSEFQE-V--------SKLI  637 (898)
T ss_pred             HHHHHHHHhhhcccCCC-----CCCeEEEEECCCchhHHHHHHHHHHHHcCCccceEEechhhhhh-h--------hhcc
Confidence            99999999999998876     46789999999999999999999999999999999999999765 1        4778


Q ss_pred             ccccccccchhhhHHHHHHHhCCceEEEEcccccccCHHHHHHHhhhhcCCeEecCCCeEeecCCcEEEEecCCCCCCCc
Q 001355          782 FCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTILKGKHS  861 (1093)
Q Consensus       782 G~~~g~~g~~~~~~l~eal~~~p~~VI~LDEVDkiad~~vq~~Ll~aLe~Gr~~d~~G~~V~l~naI~IlTSN~~~~~~~  861 (1093)
                      |.++||+|++..+.|+++++++|++||||||||| ||+.+++.|++++|+|+++|++|++|+++|+|||||||.+  +..
T Consensus       638 gsp~gyvG~e~gg~LteavrrrP~sVVLfdeIEk-Ah~~v~n~llq~lD~GrltDs~Gr~Vd~kN~I~IMTsn~~--~~~  714 (898)
T KOG1051|consen  638 GSPPGYVGKEEGGQLTEAVKRRPYSVVLFEEIEK-AHPDVLNILLQLLDRGRLTDSHGREVDFKNAIFIMTSNVG--SSA  714 (898)
T ss_pred             CCCcccccchhHHHHHHHHhcCCceEEEEechhh-cCHHHHHHHHHHHhcCccccCCCcEeeccceEEEEecccc--hHh
Confidence            8999999999999999999999999999999999 9999999999999999999999999999999999999985  221


Q ss_pred             cCCCCCCCcchHHHHHhhhhhhhhhcccccccccccCCCCcccccCCCCCCCchhhhcccCCCCCCCCccchhhhhhhhc
Q 001355          862 VHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGDSPINSQKQVDDSFR  941 (1093)
Q Consensus       862 ~~~~~~~~~f~eekil~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~kRk~~~~~~~~~~~~k~~~~~~~  941 (1093)
                      +...   .. .+++++...+                                     ++.      .+..+.+++....+
T Consensus       715 i~~~---~~-~~~~l~~~~~-------------------------------------~~~------~~~~~k~~v~~~~~  747 (898)
T KOG1051|consen  715 IAND---AS-LEEKLLDMDE-------------------------------------KRG------SYRLKKVQVSDAVR  747 (898)
T ss_pred             hhcc---cc-cccccccchh-------------------------------------hhh------hhhhhhhhhhhhhh
Confidence            1110   00 1111110000                                     000      00001111111110


Q ss_pred             cccCCCCcccccccccCCccCCchhhhhccccChHHHhhccccccccCCCChHHHHHHHHHHHHHHHHHhcCCCceeecC
Q 001355          942 SYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPKFQRAFGFEVLLEID 1021 (1093)
Q Consensus       942 ~~lDLNl~~~e~e~~~~~~~~~~d~~~e~~~~~~~efl~rId~~VvF~pld~~~l~~ii~~~i~~~~~~~~~~~~~L~Id 1021 (1093)
                      .                          .+...|.+||++|+|.+++|+|++.+++.+++...+.+..+++.+.++.+.+.
T Consensus       748 ~--------------------------~~~~~~r~Ef~nrid~i~lf~~l~~~~~~~i~~~~~~e~~~r~~~~~~~~~v~  801 (898)
T KOG1051|consen  748 I--------------------------YNKQFFRKEFLNRIDELDLNLPLDRDELIEIVNKQLTEIEKRLEERELLLLVT  801 (898)
T ss_pred             c--------------------------ccccccChHHhcccceeeeecccchhhHhhhhhhHHHHHHHHhhhhHHHHHHH
Confidence            0                          01158899999999999999999999999999999999988887778889999


Q ss_pred             HHHHHHHHhcCCchh-hHHHHHHHHHHHHHHHHHHHHhhcCCCCCeEEEEEee
Q 001355         1022 YEILVQILAATWLSD-RKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAH 1073 (1093)
Q Consensus      1022 ~~vle~Ll~~~~~~~-~~r~ie~wve~vl~~~l~e~~~~~~~~~~~~VkLv~~ 1073 (1093)
                      +.+.+.++..+|..+ ++|.|.++|++.|...|...-. .......++++...
T Consensus       802 ~~~~~~v~~~~~d~~ygAr~ikr~i~~~~~~~la~~~l-~ei~~~~~~~i~~~  853 (898)
T KOG1051|consen  802 DRVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALL-GEVEDGLTERILVA  853 (898)
T ss_pred             HHHHhhhhhcCcChHHHhhHHHHHHHHHHHHHHhhhhe-eeecCCceEEEEec
Confidence            999999999999776 8899999999998888877666 55556778887753

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1093
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 7e-11
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-10
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 3e-09
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 7e-09
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 17/166 (10%)
Query: 693 KVGWQDEAICTISQAVSRWRIG---NGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEI 749
           +V  QDEAI  ++ A+ R R G     R +GS         FLGP  VGK ++A  LA  
Sbjct: 559 RVVGQDEAIRAVADAIRRARAGLKDPNRPIGS-------FLFLGPTGVGKTELAKTLAAT 611
Query: 750 VFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVF 809
           +F  +  +I +D++        + +       +   +  G+     + +  R +PYSV+ 
Sbjct: 612 LFDTEEAMIRIDMTEYMEKHAVSRLIGAPP-GYVGYEEGGQ-----LTEAVRRRPYSVIL 665
Query: 810 LEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTI 855
            ++++KA  P V + L + +  G+ TDS+GR V     + + TS +
Sbjct: 666 FDEIEKA-HPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNL 710
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1093
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 1e-09
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-08
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 2e-04
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 6e-07
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
 Score = 68.4 bits (168), Expect = 1e-11
 Identities = 58/172 (33%), Positives = 84/172 (48%), Gaps = 37/172 (21%)

Query: 690 LAEKVGWQDEAICTISQAVSRWRIG---NGRDVGSNSKRGIWLAFLGPDKVGKKKIASAL 746
           L  +V  QDEA+  +++AV R R G     R +GS         FLGP  VGK ++A AL
Sbjct: 489 LHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGS-------FIFLGPTGVGKTELARAL 541

Query: 747 AEIVFGNKGKLIHVDVS--SEQ-RVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSK 803
           AE +FG++  +I +D+S   E+   S                   G  L + +    R K
Sbjct: 542 AESIFGDEESMIRIDMSEYMEKHSTS-------------------GGQLTEKV----RRK 578

Query: 804 PYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTI 855
           PYSVV L+ ++K A P V + L + +  G+ TDS GR V     I + TS +
Sbjct: 579 PYSVVLLDAIEK-AHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNV 629
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1093
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.97
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.94
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.85
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.82
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.75
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.7
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.67
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.66
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.66
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.65
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 99.63
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 99.61
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 99.61
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.58
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 99.56
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.52
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 99.49
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 99.49
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.46
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.39
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.35
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.31
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.3
3pvs_A 447 Replication-associated recombination protein A; ma 99.26
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.26
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.24
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.24
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.23
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.22
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.22
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.2
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.19
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.18
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.18
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.17
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.16
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.16
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.15
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.15
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.14
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.14
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.14
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.13
3co5_A143 Putative two-component system transcriptional RES 99.13
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.12
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.12
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.1
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.1
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.09
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.06
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.05
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.02
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.02
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.01
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.01
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.0
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.0
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.99
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.99
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.97
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.97
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.93
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.89
2r62_A268 Cell division protease FTSH homolog; ATPase domain 98.85
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.85
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.83
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.82
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.8
3bos_A242 Putative DNA replication factor; P-loop containing 98.8
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.77
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.77
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.76
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.75
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.74
3f8t_A506 Predicted ATPase involved in replication control, 98.73
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.73
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.72
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.68
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.68
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.68
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.66
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.63
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.6
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.58
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.57
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.55
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.54
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.54
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.46
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.29
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.1
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.01
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.96
2qgz_A308 Helicase loader, putative primosome component; str 97.61
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.6
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.56
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.15
1tue_A212 Replication protein E1; helicase, replication, E1E 97.14
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.03
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.96
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.78
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.71
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 96.62
2fna_A357 Conserved hypothetical protein; structural genomic 96.61
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 96.57
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.48
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.21
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.16
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.11
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.1
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.95
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.72
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.7
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.51
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.35
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.31
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.18
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.15
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 95.07
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.98
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.71
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.59
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.57
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.56
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.54
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.48
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.34
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 94.26
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.09
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.0
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.99
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.93
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.91
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.87
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.85
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.83
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.76
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.57
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.55
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 93.54
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.49
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.47
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.45
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.43
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.43
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.27
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.26
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.23
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.15
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.14
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.1
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.09
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 93.07
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.04
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 92.98
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.91
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 92.84
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 92.84
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.84
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.81
1via_A175 Shikimate kinase; structural genomics, transferase 92.73
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.7
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.69
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.66
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.61
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.59
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.46
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.41
2og2_A359 Putative signal recognition particle receptor; nuc 92.41
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.33
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.32
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 92.28
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.25
1kag_A173 SKI, shikimate kinase I; transferase, structural g 92.2
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.18
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 92.14
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.08
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 91.99
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 91.98
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 91.96
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.94
1p9r_A418 General secretion pathway protein E; bacterial typ 91.92
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 91.84
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.82
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 91.82
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 91.79
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 91.76
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 91.73
3tlx_A243 Adenylate kinase 2; structural genomics, structura 91.72
1vma_A306 Cell division protein FTSY; TM0570, structural gen 91.72
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.7
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.53
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 91.52
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 91.38
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.34
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.33
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.27
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.26
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 91.21
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 91.2
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.17
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.08
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.07
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.06
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.06
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 91.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 90.98
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.97
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 90.95
2xxa_A433 Signal recognition particle protein; protein trans 90.92
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 90.92
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.87
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.6
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 90.6
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.47
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 90.34
1u94_A356 RECA protein, recombinase A; homologous recombinat 90.3
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.28
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 90.27
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 90.25
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.2
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 90.0
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.0
2vli_A183 Antibiotic resistance protein; transferase, tunica 89.86
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.74
1xp8_A366 RECA protein, recombinase A; recombination, radior 89.67
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 89.66
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 89.61
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 89.56
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.54
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 89.54
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 89.36
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.3
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 89.26
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.16
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.07
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 89.05
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.74
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 88.68
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 88.66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 88.59
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 88.38
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 88.31
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.24
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 88.23
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 88.21
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 88.06
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 87.77
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 87.77
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 87.67
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 87.67
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.54
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 87.53
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 87.53
3r20_A233 Cytidylate kinase; structural genomics, seattle st 87.42
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 87.33
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 87.32
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.06
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 86.89
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 86.81
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.76
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 86.76
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 86.66
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 86.62
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 86.57
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 86.45
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.37
3pvs_A447 Replication-associated recombination protein A; ma 86.36
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 86.13
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 86.1
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.03
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 86.03
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 85.96
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.94
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.71
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 85.63
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 85.24
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 85.21
2cvh_A220 DNA repair and recombination protein RADB; filamen 85.16
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 84.97
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 84.95
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 84.93
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 84.66
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 84.3
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 84.29
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 84.27
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 84.26
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 84.18
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.15
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 83.88
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 83.87
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 83.82
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 83.79
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 83.78
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 83.7
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 83.69
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 83.59
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 83.46
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 83.26
3kta_A182 Chromosome segregation protein SMC; structural mai 83.24
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 83.12
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 82.81
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 82.59
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 82.0
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 81.89
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 81.88
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 81.78
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 81.77
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 81.46
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 80.98
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 80.89
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 80.79
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 80.79
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 80.64
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 80.53
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 80.4
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 80.24
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 80.23
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 80.1
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
Probab=100.00  E-value=7.6e-61  Score=605.69  Aligned_cols=792  Identities=18%  Similarity=0.212  Sum_probs=506.8

Q ss_pred             hhcCHHHHHHHHHHHHHHHHcCCCCccHHHHHHHHccCCCchHHHHHHhhccCCCCchhhHHHHHHHHHHhhccCCCCCC
Q 001355           10 QCLSEESARVLDDAVGVARQRRHSQTTSLHVVSALLCVPSSLLREACDRVQSYSVSPKLQFRALELCLGVAFDRLPSSKS   89 (1093)
Q Consensus        10 q~lt~~a~~~l~~A~~lA~rr~h~q~tplH~~~alL~~~~~~lr~a~~~~~~~~~s~~lq~~aLel~~~~aL~rlp~~~~   89 (1093)
                      ..||++|..||..|+.+|+++||+++||.|++.+||..+.|+++.++.+++.+       ..+|+..+...|+++|+..+
T Consensus         4 ~~~t~~a~~al~~A~~~A~~~~h~~i~~eHLLlaLl~~~~~~~~~iL~~~gvd-------~~~l~~~l~~~l~~~p~~~~   76 (854)
T 1qvr_A            4 ERWTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGAD-------PKALKELQERELARLPKVEG   76 (854)
T ss_dssp             CCSCHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHCCSSSSHHHHHHHTTSSC-------HHHHHHHHHHHHHTSCCCCG
T ss_pred             hhhCHHHHHHHHHHHHHHHHcCCCCccHHHHHHHHHhCCCcHHHHHHHHcCCC-------HHHHHHHHHHHHhhCCCCCC
Confidence            47999999999999999999999999999999999999999999999999843       67899999999999998754


Q ss_pred             C-CCCCCcHHHHHHHHHHHHhhhcCCCCcchhhhhccccccceeeehhHHHHHHHhcCchhhhhhcccCCCcHHHHHhhc
Q 001355           90 V-EFPPISNSLMAAIKRSQAQQRRNPDNYHLQQIHCNQQTASLLKVDLKYFVLAILDDPMASRVFGEAGFLSRDIKLAII  168 (1093)
Q Consensus        90 ~-~~p~~Sn~l~aa~kraqa~qrr~~~~~~~~q~~~~~~~~~~~kv~~e~lilsilddp~vsrv~~eagf~s~~vk~~i~  168 (1093)
                      + ..|++|+.+..+|++|+.+.++..++                +|..+||+++||+++..  +     ++..+++.++.
T Consensus        77 ~~~~~~~S~~~~~vL~~A~~~a~~~g~~----------------~I~~ehlLlall~~~~~--~-----~~~~~~~~~~~  133 (854)
T 1qvr_A           77 AEVGQYLTSRLSGALNRAEGLMEELKDR----------------YVAVDTLVLALAEATPG--L-----PGLEALKGALK  133 (854)
T ss_dssp             GGTTCEECHHHHHHHHHHHHHHHTTTCS----------------SCCHHHHHHHHHHHSTT--S-----CCHHHHHHHHT
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHcCCc----------------EeeHHHHHHHHHhcccc--c-----CCHHHHHHHHH
Confidence            3 57999999999999999887765433                79999999999987752  1     89999999998


Q ss_pred             cCCCCCCCCCCCCCCC-C---CccccCCCCCCCCCCCCCCCCCCCCchhhHHHHHHHhhcccccCCCCcEEeccchhh--
Q 001355          169 QPSVTQFPPRLSLTRC-P---PIFLYNLTDSFPGRAGLKLPFGPDDVDENCRRIGEVLAGRDEKKGKNPLLVGVCANS--  242 (1093)
Q Consensus       169 ~~~~~~~~~~~~~~~~-~---~~~~~n~~~~~~~~~~~~~p~~~~~rdeeirrv~~vL~R~~~~~k~NpvlVGe~~~~--  242 (1093)
                      +....... ....... .   ..|..|+++.  ++.+..+|+  +||++++++++++|.|   ++++|++|+|++|+|  
T Consensus       134 ~~~~~~~~-~~~~~~~~~~~l~~~~~~l~~~--~r~~~ld~v--iGr~~~i~~l~~~l~~---~~~~~vlL~G~pG~GKT  205 (854)
T 1qvr_A          134 ELRGGRTV-QTEHAESTYNALEQYGIDLTRL--AAEGKLDPV--IGRDEEIRRVIQILLR---RTKNNPVLIGEPGVGKT  205 (854)
T ss_dssp             SSCSCCSS-CSSCCCCCCSHHHHHEEEHHHH--HHTTCSCCC--CSCHHHHHHHHHHHHC---SSCCCCEEEECTTSCHH
T ss_pred             Hhcccccc-ccccccccchhHHHHHHhHHHH--HhcCCCccc--CCcHHHHHHHHHHHhc---CCCCceEEEcCCCCCHH
Confidence            76433211 0010011 1   1455566542  355678888  6999999999999999   999999999999998  


Q ss_pred             -HHHHHHHHHhcCCCCCCCccccCcEEEEeechhhhhhcCCccHHHHHHHHHHHHHHhhccCCCcEEEEeCcchhhhcCC
Q 001355          243 -ALKGFVESVNGGKVGLFPRQIYGLDVVCVEYEINEFVGGRVNVEMMMLKFKEVESAVGRCSGPGVVVNYGELKVLVSDS  321 (1093)
Q Consensus       243 -a~~~~~~~i~~~~~g~vp~~L~~~~v~~l~~e~~~~~a~~~~r~e~e~rlkel~~~v~~~~~~gvil~igdl~~~v~~~  321 (1093)
                       .+++++.++..+   ++|..|++.+++.++  ++.+++|..++++++.+++.+...+... ++++||||||+|++++.+
T Consensus       206 ~la~~la~~l~~~---~~p~~l~~~~~~~l~--~~~l~~g~~~~g~~~~~l~~~~~~~~~~-~~~~iL~IDEi~~l~~~~  279 (854)
T 1qvr_A          206 AIVEGLAQRIVKG---DVPEGLKGKRIVSLQ--MGSLLAGAKYRGEFEERLKAVIQEVVQS-QGEVILFIDELHTVVGAG  279 (854)
T ss_dssp             HHHHHHHHHHHHT---CSCTTSTTCEEEEEC--C-----------CHHHHHHHHHHHHHTT-CSSEEEEECCC-------
T ss_pred             HHHHHHHHHHhcC---CCchhhcCCeEEEee--hHHhhccCccchHHHHHHHHHHHHHHhc-CCCeEEEEecHHHHhccC
Confidence             499999999885   899999999999999  9999999999999999999999988864 678999999999999887


Q ss_pred             CcchHHHHHHHHHHhhhcCCCCCcEEEEEecccHHHHHhhhhcCCCCCCCCcceeeeccCCCC-----CCCcccC----C
Q 001355          322 VSTEAARFVVSQLTSLLKSGNGEKLWLIGAAMSYETYLKMLAKFPGLDNDWDLQLLPIHWKSS-----LMGSFVP----F  392 (1093)
Q Consensus       322 ~~~~~~~~~v~el~~Ll~~~~~g~lwliG~a~T~~tY~k~~~~~PslE~~w~Lq~v~i~~~~s-----l~~s~~~----~  392 (1093)
                      ..++..+. .+.+..++.   +|++++||+ ||+.+|++ +..+|+|.++|+.  |.|++-+.     +...+..    .
T Consensus       280 ~~~g~~~~-~~~L~~~l~---~~~i~~I~a-t~~~~~~~-~~~d~aL~rRf~~--i~l~~p~~~e~~~iL~~~~~~~~~~  351 (854)
T 1qvr_A          280 KAEGAVDA-GNMLKPALA---RGELRLIGA-TTLDEYRE-IEKDPALERRFQP--VYVDEPTVEETISILRGLKEKYEVH  351 (854)
T ss_dssp             -------------HHHHH---TTCCCEEEE-ECHHHHHH-HTTCTTTCSCCCC--EEECCCCHHHHHHHHHHHHHHHHHH
T ss_pred             CccchHHH-HHHHHHHHh---CCCeEEEEe-cCchHHhh-hccCHHHHhCCce--EEeCCCCHHHHHHHHHhhhhhhhhh
Confidence            65444432 223444444   689999999 69999999 8999999999964  55541110     0000000    0


Q ss_pred             CCCCCCCC--------------CCCCCccCC----------CCccchhhHHHhhHHHHHHHHhhhcCCCccccccccCCc
Q 001355          393 GGFFSSPP--------------DFKNPVRSK----------SHYSTLCYLCTEKLEQEVAALLKLESSDSVTDQCLDNLT  448 (1093)
Q Consensus       393 ~g~~s~~~--------------~~~~p~~~~----------~~~~~~C~~C~~~~E~e~~~~~~~~~~~s~~~~~~~~lP  448 (1093)
                      .++.-++.              +-..|-...          ......++.+.+.+++++.++.....             
T Consensus       352 ~~~~i~~~al~~~~~ls~r~i~~~~lp~kai~lldea~a~~~~~~~~~p~~l~~~~~~~~~~~~~~~-------------  418 (854)
T 1qvr_A          352 HGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIERE-------------  418 (854)
T ss_dssp             TTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHH-------------
T ss_pred             cCCCCCHHHHHHHHHHHhhhcccccChHHHHHHHHHHHHHHHhhccCCchhHHHHHHHHHHHHHHHH-------------
Confidence            01000000              000000000          00012344555555655554443210             


Q ss_pred             hhhhhcccCCC-CCCccccccchhHHHHHHHHHHHHHHHHHhhhcccCCCCCcccccccccchhhHHHHHhhccCCCCCC
Q 001355          449 SSDRIAALDTS-KGVGTAKAKDDVTALNAKIMELQRKWNDTCQSLHRTQLVPKLDIRQRSHVQLSEFVRLMANRKGSSSK  527 (1093)
Q Consensus       449 ~WLq~~~~~~~-~~~~~~~~kd~~~~~~~~~~~L~kkW~~~c~~lh~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~s~  527 (1093)
                       .|....+..+ .++.  +.+++...+..++..|.++|...|..++.-+.+..    .     .++........   ...
T Consensus       419 -~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~-----~~~~~~~~~~~---~~~  483 (854)
T 1qvr_A          419 -ALKKEKDPDSQERLK--AIEAEIAKLTEEIAKLRAEWEREREILRKLREAQH----R-----LDEVRREIELA---ERQ  483 (854)
T ss_dssp             -HHSSCSSHHHHSCTH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----H-----HHHHHHHHHHH---TTT
T ss_pred             -HHHhccccccHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----H-----HHHHhhhHHHH---Hhc
Confidence             1111100000 1111  11335556777788899999999998864321100    0     00000000000   000


Q ss_pred             CCCcccCCCCCCCCCcccccccccccccccCcccccccccccccCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001355          528 YPSLCESQCTNPSPGAHMLSQNISSAEQNATIPLSSEANNVNFQSRLPINSSTKPQSNNDEHLLPPHPLADLYKPHEHTS  607 (1093)
Q Consensus       528 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s  607 (1093)
                       ..+.            .    .+.... ...|...        ..+.......           .              
T Consensus       484 -~~~~------------~----~~~~~~-~~~~~~~--------~~~~~~~~~~-----------~--------------  512 (854)
T 1qvr_A          484 -YDLN------------R----AAELRY-GELPKLE--------AEVEALSEKL-----------R--------------  512 (854)
T ss_dssp             -TCHH------------H----HHHHHT-THHHHHH--------HHHHHHHHHS-----------S--------------
T ss_pred             -ccHH------------H----HHHHhh-hhhHHHH--------HHHHHHHhhh-----------c--------------
Confidence             0000            0    000000 0000000        0000000000           0              


Q ss_pred             cccccceeecccCCccCCCccccCCCccccccccccccCCcccccccccCCccccccccCCCCCCCCCCCCCHHHHHHHH
Q 001355          608 FSFLASVTTDLGLGKIYPSTRQEANTPKLIDNKEQCFSGSISAEFDAVSEGTFHNVVQSSSCSAPHTGEPFDPRDYKTLR  687 (1093)
Q Consensus       608 p~~~~~V~tdL~Lg~~~~s~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~s~~~~~ss~~~~~~~~~~~d~e~lk~L~  687 (1093)
                             ..|+.            .+                   .+....+...+++|+++|..++. +.+.+.+..+.
T Consensus       513 -------~~~~~------------~~-------------------~v~~~~l~~~v~~~~~ip~~~~~-~~~~~~l~~l~  553 (854)
T 1qvr_A          513 -------GARFV------------RL-------------------EVTEEDIAEIVSRWTGIPVSKLL-EGEREKLLRLE  553 (854)
T ss_dssp             -------SCSSC------------CS-------------------EECHHHHHHHHHTTSSCHHHHTT-CCHHHHHHSHH
T ss_pred             -------ccccc------------cC-------------------CcCHHHHHHHHHHHhCCChHhhc-HHHHHHHHHHH
Confidence                   00000            00                   01123344555666776655443 33555677788


Q ss_pred             HHHhcccCccHHHHHHHHHHHHHHHhcCCCCCCCCCCCCeEEEeeCCCCChHHHHHHHHHHHhccCCCceEEeecCCccc
Q 001355          688 IALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGKLIHVDVSSEQR  767 (1093)
Q Consensus       688 ~~L~e~ViGQdeai~~Ia~aI~~~rsg~~~~~~~~~k~~~~LLf~Gp~GvGKT~lAraLA~~lfgs~~~fv~id~s~~~~  767 (1093)
                      +.|.++|+||++++..|..+|.+.+.|+..+++|.    .++||+||+|||||++|++||+.+++...+|+.+||+.+..
T Consensus       554 ~~l~~~viG~~~a~~~l~~~i~~~~~g~~~~~~p~----~~vLl~Gp~GtGKT~lA~~la~~~~~~~~~~i~i~~~~~~~  629 (854)
T 1qvr_A          554 EELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPI----GSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYME  629 (854)
T ss_dssp             HHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCS----EEEEEBSCSSSSHHHHHHHHHHHHHSSGGGEEEECTTTCCS
T ss_pred             HHHhcccCCcHHHHHHHHHHHHHHhcccCCCCCCc----eEEEEECCCCCCHHHHHHHHHHHhcCCCCcEEEEechhccc
Confidence            88999999999999999999999999887665443    58999999999999999999999999899999999998643


Q ss_pred             cCCCCccccCCCccccccccccchhhhHHHHHHHhCCceEEEEcccccccCHHHHHHHhhhhcCCeEecCCCeEeecCCc
Q 001355          768 VSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGM  847 (1093)
Q Consensus       768 ~~~~~si~~~~~l~G~~~g~~g~~~~~~l~eal~~~p~~VI~LDEVDkiad~~vq~~Ll~aLe~Gr~~d~~G~~V~l~na  847 (1093)
                      .   +..   ..++|.+++|+|+...+.++++++.+|++||||||||+ +++.+|+.|+++|++|++++..|+.++++|+
T Consensus       630 ~---~~~---s~l~g~~~~~~G~~~~g~l~~~~~~~~~~vl~lDEi~~-l~~~~~~~Ll~~l~~~~~~~~~g~~vd~~~~  702 (854)
T 1qvr_A          630 K---HAV---SRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEK-AHPDVFNILLQILDDGRLTDSHGRTVDFRNT  702 (854)
T ss_dssp             S---GGG---GGC--------------CHHHHHHHCSSEEEEESSGGG-SCHHHHHHHHHHHTTTEECCSSSCCEECTTE
T ss_pred             h---hHH---HHHcCCCCCCcCccccchHHHHHHhCCCeEEEEecccc-cCHHHHHHHHHHhccCceECCCCCEeccCCe
Confidence            2   111   35677778888877777899999999999999999999 9999999999999999999999999999999


Q ss_pred             EEEEecCCCCCCCccCCCCCCCcchHHHHHhhhhhhhhhcccccccccccCCCCcccccCCCCCCCchhhhcccCCCCCC
Q 001355          848 IFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPESRRKRKRTDDGD  927 (1093)
Q Consensus       848 I~IlTSN~~~~~~~~~~~~~~~~f~eekil~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~kRk~~~~~~  927 (1093)
                      +||+|||.+.                +.+.+..        ++                                   ..
T Consensus       703 iiI~tsn~~~----------------~~~~~~~--------~~-----------------------------------~~  723 (854)
T 1qvr_A          703 VIILTSNLGS----------------PLILEGL--------QK-----------------------------------GW  723 (854)
T ss_dssp             EEEEECCTTH----------------HHHHHHH--------HT-----------------------------------TC
T ss_pred             EEEEecCcCh----------------HHHhhhc--------cc-----------------------------------cc
Confidence            9999999741                0110000        00                                   00


Q ss_pred             CCccchhhhhhhhccccCCCCcccccccccCCccCCchhhhhccccChHHHhhccccccccCCCChHHHHHHHHHHHHHH
Q 001355          928 SPINSQKQVDDSFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLLAEKILREIQPK 1007 (1093)
Q Consensus       928 ~~~~~~k~~~~~~~~~lDLNl~~~e~e~~~~~~~~~~d~~~e~~~~~~~efl~rId~~VvF~pld~~~l~~ii~~~i~~~ 1007 (1093)
                      .+..+...+                              .......|.|+|++|||.++.|.|++.+++..++...+...
T Consensus       724 ~~~~l~~~v------------------------------~~~~~~~f~~~l~~Rl~~~i~~~pl~~edi~~i~~~~l~~~  773 (854)
T 1qvr_A          724 PYERIRDEV------------------------------FKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYL  773 (854)
T ss_dssp             CHHHHHHHH------------------------------HHHHHTTSCHHHHHTCSBCCBCCCCCHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHH------------------------------HHHHHhhCCHHHHHhcCeEEeCCCCCHHHHHHHHHHHHHHH
Confidence            000001111                              12235579999999999999999999999999999999888


Q ss_pred             HHHhcCCCceeecCHHHHHHHHhcCCchh-hHHHHHHHHHHHHHHHHHHHHhhcCCCCCeEEEEE
Q 001355         1008 FQRAFGFEVLLEIDYEILVQILAATWLSD-RKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLV 1071 (1093)
Q Consensus      1008 ~~~~~~~~~~L~Id~~vle~Ll~~~~~~~-~~r~ie~wve~vl~~~l~e~~~~~~~~~~~~VkLv 1071 (1093)
                      ..++...++.+.|+++++++|+.+.|... +.|.+++.|+..+...+.+.........+..|++.
T Consensus       774 ~~~~~~~~~~~~~~~~a~~~L~~~~~~~~gn~R~L~~~i~~~~~~~~~~~i~~~~~~~~~~~~~~  838 (854)
T 1qvr_A          774 RARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVD  838 (854)
T ss_dssp             HHHHHTTTCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEE
T ss_pred             HHHHHhCCceEEECHHHHHHHHHcCCCCCCChHHHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEE
Confidence            88876667789999999999999999432 34445555555554444444444443345566554
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1093
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 1e-21
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 3e-12
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 5e-08
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 1e-04
d1qvra1145 a.174.1.1 (A:4-148) N-terminal domain of ClpB (hea 7e-04
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score = 94.8 bits (235), Expect = 1e-21
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 684 KTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIA 743
             L   L ++V  QDEAI  ++ A+ R R G    +   ++      FLGP  VGK ++A
Sbjct: 15  LRLEEELHKRVVGQDEAIRAVADAIRRARAG----LKDPNRPIGSFLFLGPTGVGKTELA 70

Query: 744 SALAEIVFGNKGKLIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSK 803
             LA  +F  +  +I +D++        + +              G      + +  R +
Sbjct: 71  KTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPP------GYVGYEEGGQLTEAVRRR 124

Query: 804 PYSVVFLEDLDKAADPIVQSSLTKAISTGKFTDSYGRDVSISGMIFVATSTI 855
           PYSV+  ++++K A P V + L + +  G+ TDS+GR V     + + TS +
Sbjct: 125 PYSVILFDEIEK-AHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNL 175
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1093
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.97
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.96
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.96
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.95
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.83
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.73
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 99.7
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.61
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 99.59
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 99.36
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.34
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.26
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.22
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.2
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.12
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.11
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.09
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.06
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.04
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.03
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.03
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.01
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.98
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.85
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.57
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.49
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.49
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.48
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.22
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.19
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.97
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.83
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.62
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.39
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.27
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.18
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.86
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.73
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.62
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.49
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.43
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.41
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.3
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.21
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.2
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.14
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.12
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.09
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.93
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.89
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.87
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.82
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.77
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.73
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.62
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.57
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.53
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.5
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.41
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 94.23
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.2
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.2
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.19
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.12
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.98
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.9
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.9
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.73
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.71
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.7
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.46
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.19
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.97
d1okkd2207 GTPase domain of the signal recognition particle r 92.75
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.69
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 92.61
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.27
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.24
d1ls1a2207 GTPase domain of the signal sequence recognition p 92.12
d2qy9a2211 GTPase domain of the signal recognition particle r 92.1
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.1
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.97
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 91.97
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.93
d1vmaa2213 GTPase domain of the signal recognition particle r 91.87
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.74
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.81
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.0
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.98
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.71
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 88.99
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.98
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.85
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.75
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.37
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.76
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 87.74
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 87.41
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 86.95
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.45
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.02
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.7
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 84.58
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.17
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.23
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 83.19
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 82.88
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 82.28
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 82.25
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.01
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 81.97
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.96
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 81.68
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.36
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 80.2
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 80.14
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=4.7e-38  Score=351.68  Aligned_cols=298  Identities=20%  Similarity=0.268  Sum_probs=227.7

Q ss_pred             CCCHHHHHHHHHHHhcccCccHHHHHHHHHHHHHHHhcCCCCCCCCCCCCeEEEeeCCCCChHHHHHHHHHHHhccCCCc
Q 001355          677 PFDPRDYKTLRIALAEKVGWQDEAICTISQAVSRWRIGNGRDVGSNSKRGIWLAFLGPDKVGKKKIASALAEIVFGNKGK  756 (1093)
Q Consensus       677 ~~d~e~lk~L~~~L~e~ViGQdeai~~Ia~aI~~~rsg~~~~~~~~~k~~~~LLf~Gp~GvGKT~lAraLA~~lfgs~~~  756 (1093)
                      +.+.+++..|++.|.++|+||++|++.|+.+|.+++.|+..+++|.    .++||+||+|+|||++|+.||+.+||...+
T Consensus         8 ~~~~~~l~~l~~~L~~~v~GQ~~ai~~v~~~i~~~~~~l~~~~kp~----~~~lf~Gp~G~GKt~lak~la~~l~~~~~~   83 (315)
T d1qvra3           8 EGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPI----GSFLFLGPTGVGKTELAKTLAATLFDTEEA   83 (315)
T ss_dssp             CCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCS----EEEEEBSCSSSSHHHHHHHHHHHHHSSGGG
T ss_pred             HHHHHHHHHHHHHhcCeEeCHHHHHHHHHHHHHHHhcCCCCCCCCc----eEEEEECCCcchHHHHHHHHHHHhcCCCcc
Confidence            4678899999999999999999999999999999999988775543    589999999999999999999999999999


Q ss_pred             eEEeecCCccccCCCCccccCCCccccccccccchhhhHHHHHHHhCCceEEEEcccccccCHHHHHHHhhhhcCCeEec
Q 001355          757 LIHVDVSSEQRVSQPNSIFDCQNIDFCDCKLRGKVLVDYIYQEFRSKPYSVVFLEDLDKAADPIVQSSLTKAISTGKFTD  836 (1093)
Q Consensus       757 fv~id~s~~~~~~~~~si~~~~~l~G~~~g~~g~~~~~~l~eal~~~p~~VI~LDEVDkiad~~vq~~Ll~aLe~Gr~~d  836 (1093)
                      |+++||+.|.+..   .+   ..++|.++||+|+...+.|.++++++|++||||||||| +++.+++.|++++++|++++
T Consensus        84 ~~~~~~~~~~~~~---~~---~~L~g~~~gyvG~~~~~~l~~~~~~~p~~Vvl~DEieK-~~~~v~~~ll~~l~~g~~~~  156 (315)
T d1qvra3          84 MIRIDMTEYMEKH---AV---SRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEK-AHPDVFNILLQILDDGRLTD  156 (315)
T ss_dssp             EEEECTTTCCSSG---GG---GGC--------------CHHHHHHHCSSEEEEESSGGG-SCHHHHHHHHHHHTTTEECC
T ss_pred             eEEEeccccccch---hh---hhhcCCCCCCcCcccCChHHHHHHhCCCcEEEEehHhh-cCHHHHHHHHHHhccCceeC
Confidence            9999999876432   21   46788889999988888999999999999999999999 99999999999999999999


Q ss_pred             CCCeEeecCCcEEEEecCCCCCCCccCCCCCCCcchHHHHHhhhhhhhhhcccccccccccCCCCcccccCCCCCCCchh
Q 001355          837 SYGRDVSISGMIFVATSTILKGKHSVHPQTTPVKFSEEIILGAKRWQMQTAISHGFADAARGSGMNVKVTPRKENSNPES  916 (1093)
Q Consensus       837 ~~G~~V~l~naI~IlTSN~~~~~~~~~~~~~~~~f~eekil~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~s~~~~  916 (1093)
                      .+|+.++++|+|||+|||+|  +.              .+....       ..+                          
T Consensus       157 ~~gr~v~~~~~i~i~tsnlG--~~--------------~i~~~~-------~~~--------------------------  187 (315)
T d1qvra3         157 SHGRTVDFRNTVIILTSNLG--SP--------------LILEGL-------QKG--------------------------  187 (315)
T ss_dssp             SSSCCEECTTEEEEEECCTT--HH--------------HHHHHH-------HTT--------------------------
T ss_pred             CCCcEecCcceEEEEecccC--hH--------------HHhhhc-------ccc--------------------------
Confidence            99999999999999999985  11              111100       000                          


Q ss_pred             hhcccCCCCCCCCccchhhhhhhhccccCCCCcccccccccCCccCCchhhhhccccChHHHhhccccccccCCCChHHH
Q 001355          917 RRKRKRTDDGDSPINSQKQVDDSFRSYLDLNLPADEAEEDTSSEKFDSDTICENSGAWLEDFFDQTDAIAVFQPLNFDLL  996 (1093)
Q Consensus       917 ~~kRk~~~~~~~~~~~~k~~~~~~~~~lDLNl~~~e~e~~~~~~~~~~d~~~e~~~~~~~efl~rId~~VvF~pld~~~l  996 (1093)
                                . .   ..+..                          .+......+.|.|||++|||.+|+|+|++.+++
T Consensus       188 ----------~-~---~~~~~--------------------------~~~~~~l~~~f~pEflnRid~Ii~F~~L~~~~~  227 (315)
T d1qvra3         188 ----------W-P---YERIR--------------------------DEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQI  227 (315)
T ss_dssp             ----------C-C---HHHHH--------------------------HHHHHHHHTTSCHHHHHTCSBCCBCCCCCHHHH
T ss_pred             ----------c-c---hhhhh--------------------------HHHHHHHHhhcCHHHHhcCCeeeeccchhhhhh
Confidence                      0 0   00000                          001123456899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCceeecCHHHHHHHHhcCCchh-hHHHHHHHHHHHHHHHHHHHHhhcCCCCCeEEEEEeec
Q 001355          997 AEKILREIQPKFQRAFGFEVLLEIDYEILVQILAATWLSD-RKKAIENWIENVVLRSFYEVRRKHHFTAGSVVKLVAHE 1074 (1093)
Q Consensus       997 ~~ii~~~i~~~~~~~~~~~~~L~Id~~vle~Ll~~~~~~~-~~r~ie~wve~vl~~~l~e~~~~~~~~~~~~VkLv~~~ 1074 (1093)
                      .+++..++.+...++...++.+.++++++++|+..+|.+. |+|.|++.|++.+.+.|.+.....+...+.+|++...+
T Consensus       228 ~~I~~~~l~~l~~rl~~~~i~l~i~~~~~~~L~~~~y~~~~GAR~L~r~Ie~~i~~~La~~iL~~~~~~g~~i~i~~~~  306 (315)
T d1qvra3         228 RQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGP  306 (315)
T ss_dssp             HHHHHHHHHHHHHHHHTTTCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEECCT
T ss_pred             HHHHHHHHHHHHHHHHhccccccccHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEEEEC
Confidence            9999999999999998889999999999999999988554 55555555555555555444444444446778766433
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure