Citrus Sinensis ID: 001380

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------109
MIAMKLLSSPPASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVTKVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELKGVQPPTPKSRSPKRLRRRSSPDAQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLPVAP
ccccccccccccccccccccEEEEccccccccccccHHHHHHccccccccccHHHHHHccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEcccHHcHHHHHHHcccccccccEEEEcccccccccccHHHHHHHHHccccccccEEEcccHHHHHHHHHcccEEEEEcccccHHHHHcccccEEEcccccccHHHHHcccccccccccHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHcccHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHccccEEEEEEcccccHHHHHccHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHccccccEEEccccHHHHHHcccccccEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEcccEEEEEEccccEEEEEcccccEEEEEEccccccccccccccccccccccEEEEccccEEEEEEccccEEEEEEccccEEEEEccccccccccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEccccEEEEEEcccccccccccccccccccccccEEEcccccEEEEEEccccEEEEEEcccccEEEEEcccccccccccccccccccccccccccccEEEEcccccEEEEEccccEEEEEEccccEEEEEEccccccccccccccccccccccEEEcccccEEEEEccccEEEEEEccccccEEEEEccccccccccccccccccccccccccEEEEEcccccccccEEEEEEccccEEEccccccEEEEEEcccccEEEccccccccccccEEEEEcccccccEEEEEEEEEEEEcccccEEEEEEEEEEcEEEcccccccEEEEEEEEcccccccccccccccc
cHHHHHcccccccEEEcccEEEEEccccccccccccHHHHHHHccccEEcccHHHEEEEcccccccccEEEccccccEEEEEEEcccccEcccccHHHHHHHHHHHHcccEEcccccccccccccHHHccccHEccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEccccEEEEcHHHHHcccccHHccEEcccccccccccccHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHccEEEEEEccccHHHHHHccccHHHHHccccEHHHHHccccccccHHccccccHHHHccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccEcccccccHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccHHHHHHHHHHccccccEEccHHHHHHHHHccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccEccccccccccccccccccEEEEEccccEEEEEEccccEEEEEccccEEEEEEEcccccccccccccHcccccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEEccccccccccccccccccccccccEEEEccccEEEEEEccccEEEEEcccccEEEEEEccccccccccccccHHcccccccEEEcccccEEEEEEccccEEEEEEccccEEEEEEccccccccccccccccccccHHHcccccccEEEcccccEEEEEccccEEEEEEccccEEEEEEcccccccccccccHccccccccEEEccccEEEEEEccccEEEEEEccccEEEEEEEEcccccccccHccccccccccccccccEEEEccccccccEEEEEEEcccccEcccccccEEEEEEccccEEEEcccccccccccEEEEEEcccccccEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEccccccEEEEEEEEEEccccccccEEEccc
miamkllssppasslslqtklfffspntkqlrpssvssalfqcgakrtvlGRRMVVKACVTKVEetdvnvsseskwgkVSAVLFDMdgvlcnseepsrRAAVDVFAEMGVEVTVedflpfmgtgeanflggvasvkgvkgfdsEAAKKRFFEIYLdkyakpnsgigfpGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSadafenlkpapdiflsaskilnvptseciVIEDALAGVQAAKAAQMRCIAVTTTLSEerlkeaspslirkeigsvslndiltggggsynekIQEHELLHAASQNSTALLkektdnwsildtgaadekgsstsglqgsrreILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLfgvnrpsfeqteggssqSERIQQFVNYISDvenrkttpivpefpakldwlntaplqfrrdlkgkVVVLDFWTYCCINCMHVLPDLEFLEkkykdmpftvvgvhsakfdnekDLEAIRNAVLRYgishpvvndgdmnlwrelgvnswptfavvgpnGKLLAQLAGEGHRKDLDDLVEAALLFYGkkklldntplplslekdndprlftsplkfpgkLAIDilnnrlfisdsnhnrivvtdldgnfivqigssgeeglrdgsfddatfnrpqglaynakKNLLYVADTENHALREIDFVNDTVRTLagngtkgsdyqggekgtsqllnspwdvcykpinEKVYIAMAGQHqiwehstvdgvtrafsgdgyernlngssslntsfaqpsgislspdFMEIYVADSESSSIRALNLktggsrllaggdpifpdnlfkfgdrdgmgsevllqhplgvycakngqiyvadsynhkikkldpasnrvstlagigkagfKDGAALAAQlsepagiieaqngnlfiadtnnNIIRYldlnkeepelqtlelkgvqpptpksrspkrlrrrsspdaqtivvdgglsnegniylkislpeeyhfskearskfsvdvepenaviidpldgnlspegsavlhfrrmspsvstgrisckvyyckedevclykpllfevpfqeevpnsppaeitlpydlkpkiltnslqlpvap
miamkllssppasslslQTKLFFFSPNTKQLRPSSVSSALFQCGakrtvlgrrMVVKACVTkveetdvnvsseskwgkvSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTttlseerlkeaspslirkeigsvslNDILTGGGGSYNEKIQEHELLHAASQNSTALLKEKTDNWSILDtgaadekgsstsglqgsrREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFeqteggssqseRIQQFVNYISDVENRKTTpivpefpakldWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVhsakfdnekDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKkklldntplplslekdndprlFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGngtkgsdyqggekGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQtlelkgvqpptpksrspkrlrrrsspdaqtivvdgglsnegNIYLKISLPEEYHFSKEARSKFSVDVEPENAviidpldgnlsPEGSAVLHFrrmspsvstgrISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKIltnslqlpvap
MIAMKllssppasslslQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVTKVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDalagvqaakaaQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELKGVQpptpksrspkrlrrrsspDAQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLPVAP
*******************KLFFF*************SALFQCGAKRTVLGRRMVVKACVTKVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS***********I*KEIGSVSLNDILTGGGG*Y***************************************************EILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNR***************IQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSL******RLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGS**********FDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGN***************QLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGD***************************FMEIYVA******IRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLN*************************************IVVDGGLSNEGNIYLKISLPEEYHFS******FSVDVEPENAVIIDPLDG*******AVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQE*********ITLPYDL***************
******************************************************************************VSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDIL***************LLHAASQNSTALLKEKTDNWSILDTGAA*********LQGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVL*****************************************EFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELKGVQP*****RSPKRLRRRSSPDAQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNS*QLP***
*************SLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVTKVE*********SKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQNSTALLKEKTDNWSILDTGA************GSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSF**********ERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELK**********************AQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLPVAP
*I**KLLSSPPASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVTKVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQNSTALLKE*TD********************QGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELKGVQPPTPKSRSPKRLRRRSSPDAQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAMKLLSSPPASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVTKVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEPELQTLELKGVQPPTPKSRSPKRLRRRSSPDAQTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLPVAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1089 2.2.26 [Sep-21-2011]
A4IF69726 NHL repeat-containing pro yes no 0.584 0.876 0.398 1e-124
Q5ZI67727 NHL repeat-containing pro yes no 0.578 0.866 0.395 1e-124
Q8NBF2726 NHL repeat-containing pro yes no 0.583 0.874 0.383 1e-123
Q8BZW8725 NHL repeat-containing pro yes no 0.588 0.884 0.386 1e-123
O33513227 Protein CbbY OS=Rhodobact no no 0.169 0.814 0.321 9e-17
P54607220 Uncharacterized protein Y yes no 0.163 0.809 0.307 2e-15
P59960695 Protein DipZ OS=Mycobacte yes no 0.156 0.244 0.281 1e-14
Q10801695 Protein DipZ OS=Mycobacte yes no 0.156 0.244 0.281 1e-14
P95649230 Protein CbbY OS=Rhodobact yes no 0.165 0.782 0.326 2e-14
Q7ADF8222 2-deoxyglucose-6-phosphat N/A no 0.168 0.824 0.314 2e-13
>sp|A4IF69|NHLC2_BOVIN NHL repeat-containing protein 2 OS=Bos taurus GN=NHLRC2 PE=2 SV=1 Back     alignment and function desciption
 Score =  447 bits (1149), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 277/695 (39%), Positives = 390/695 (56%), Gaps = 59/695 (8%)

Query: 406  SQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTA-PLQFRRDLKGKVVVLDFWTYC 464
            +Q E+      Y+  V+  +   +VPEFP  L+WLNT  P+   +DL GKVV+LDF+TYC
Sbjct: 30   TQEEKDGLVYQYLQKVDGWEQDLLVPEFPEGLEWLNTEEPISVYKDLCGKVVILDFFTYC 89

Query: 465  CINCMHVLPDLEFLEKKYKDMP-FTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDG 523
            CINC+H+LPDL  LE  Y D     +VGVHSAKF NEK L+ IR+AVLRY I+HPVVND 
Sbjct: 90   CINCIHLLPDLHALEHTYSDKDGLLIVGVHSAKFPNEKVLDNIRSAVLRYNITHPVVNDA 149

Query: 524  DMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPL 583
            D +LW+EL V+ WPT  ++GP G +L  L GEGH++ L      AL +Y  +  +    +
Sbjct: 150  DASLWQELEVSCWPTLIILGPRGNMLFSLIGEGHKEKLFLYTSIALKYYKDRGQIRANKI 209

Query: 584  PLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGE 643
             + L KD+ P    SPL FPGK+ +D ++NRL I+D+ H+RI+V   +G     IG    
Sbjct: 210  GIKLYKDSLP---PSPLLFPGKITVDHVSNRLVIADTGHHRILVVWKNGQIQYSIGGP-N 265

Query: 644  EGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSD 703
             G +DG F +++FN PQG+A     N++YVADTENH +R+ID   + V T+AG G +G+D
Sbjct: 266  PGRKDGIFSESSFNSPQGVAI--MNNIIYVADTENHLIRKIDLEAEMVSTVAGIGIQGTD 323

Query: 704  YQGGEKGTSQLLNSPWDVCYKPINEKV------YIAMAGQHQIW-----------EHSTV 746
             +GG KG  Q ++SPWDV +     +V      +IAMAG HQIW           ++   
Sbjct: 324  KEGGAKGDEQPISSPWDVVFGRSGPEVQRDNILWIAMAGTHQIWALLLDCGRLPKKNELK 383

Query: 747  DGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPD--FMEIYVADSESSSIRALNLKT 804
             G    F+G G E N N +      FAQPSG+SL+ +  +  ++VADSESS++R ++LK 
Sbjct: 384  KGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLASEGPWSCLFVADSESSTVRTVSLKD 443

Query: 805  GGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGV-YCAKNGQIYVADSYNHKIKKL 863
            G  + L GG+   P NLF FGD DG+G    LQHPLGV +  K   +YVADSYNHKIK +
Sbjct: 444  GAVKHLVGGERD-PMNLFAFGDVDGVGINARLQHPLGVTWDQKRNLLYVADSYNHKIKVV 502

Query: 864  DPASNRVSTLAGIGKAGFKDGAALA-AQLSEPAGIIEAQNGN-LFIADTNNNIIRYLDLN 921
            DP +   +TLAG G A    G++   +  +EP G+   +NG  L++ADTNN+ I+ LDL 
Sbjct: 503  DPKTKNCTTLAGTGNASNMIGSSFTDSTFNEPGGLCIGENGQLLYVADTNNHQIKVLDLE 562

Query: 922  KEE----PELQTLELKGVQPPTPKSRSPKRLRR--RSSPDAQTIVVDGGLSNEGNIYLKI 975
             +     P  ++ E   V  P    + PK L +  +S+P  +   V           L++
Sbjct: 563  TKTVSVFPVFRS-ENAVVDGPCLAGK-PKTLPKLPKSAPGIRLAPVAASPGQTLQFKLRL 620

Query: 976  SLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTG----- 1030
             LP     ++ A S + +  E    +    L G + P G   +      P++S       
Sbjct: 621  DLPSGTKLTEGASSCWFLSAEGNEWL----LQGQI-PSGE--IESISNQPTISLQIPGDC 673

Query: 1031 -------RISCKVYYCKED-EVCLYKPLLFEVPFQ 1057
                    IS  +YYC  D   C+ K +LF  P Q
Sbjct: 674  LSLEAILSISVFLYYCSSDSSACMMKGILFSQPLQ 708

Bos taurus (taxid: 9913)
>sp|Q5ZI67|NHLC2_CHICK NHL repeat-containing protein 2 OS=Gallus gallus GN=NHLRC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBF2|NHLC2_HUMAN NHL repeat-containing protein 2 OS=Homo sapiens GN=NHLRC2 PE=1 SV=1 Back     alignment and function description
>sp|Q8BZW8|NHLC2_MOUSE NHL repeat-containing protein 2 OS=Mus musculus GN=Nhlrc2 PE=2 SV=1 Back     alignment and function description
>sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|P54607|YHCW_BACSU Uncharacterized protein YhcW OS=Bacillus subtilis (strain 168) GN=yhcW PE=3 SV=1 Back     alignment and function description
>sp|P59960|DIPZ_MYCBO Protein DipZ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dipZ PE=4 SV=1 Back     alignment and function description
>sp|Q10801|DIPZ_MYCTU Protein DipZ OS=Mycobacterium tuberculosis GN=dipZ PE=1 SV=1 Back     alignment and function description
>sp|P95649|CBBY_RHOSH Protein CbbY OS=Rhodobacter sphaeroides GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|Q7ADF8|YNIC_ECO57 2-deoxyglucose-6-phosphate phosphatase OS=Escherichia coli O157:H7 GN=yniC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1089
2254505631078 PREDICTED: NHL repeat-containing protein 0.978 0.988 0.777 0.0
3565710701098 PREDICTED: NHL repeat-containing protein 0.985 0.977 0.748 0.0
2555429201016 2-deoxyglucose-6-phosphate phosphatase, 0.923 0.990 0.794 0.0
4494359441086 PREDICTED: NHL repeat-containing protein 0.986 0.988 0.739 0.0
2241250141065 predicted protein [Populus trichocarpa] 0.951 0.972 0.759 0.0
2960897881002 unnamed protein product [Vitis vinifera] 0.915 0.995 0.807 0.0
306961241055 haloacid dehalogenase-like hydrolase dom 0.887 0.915 0.755 0.0
2978481741058 hypothetical protein ARALYDRAFT_892829 [ 0.900 0.927 0.735 0.0
123230291041 hypothetical protein [Arabidopsis thalia 0.902 0.944 0.715 0.0
3831009471028 haloacid dehalogenase-like hydrolase dom 0.873 0.925 0.714 0.0
>gi|225450563|ref|XP_002277564.1| PREDICTED: NHL repeat-containing protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1689 bits (4373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 835/1074 (77%), Positives = 934/1074 (86%), Gaps = 8/1074 (0%)

Query: 12   ASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVV--KACVTKVEETDVN 69
            +SS    T  F F P +     S+  S + +  ++   L  R     KACV K+EE +V 
Sbjct: 6    SSSQRHHTTPFIFPPPSI----STPLSLIRRLSSRHVSLRHRRTAAPKACV-KLEEKNVP 60

Query: 70   VSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFL 129
             + +S+WGKVSAVLFDMDGVLCNSEEPSRRA VDVF EMGV+VT EDF+PFMGTGEANFL
Sbjct: 61   ETGKSQWGKVSAVLFDMDGVLCNSEEPSRRAGVDVFHEMGVQVTTEDFVPFMGTGEANFL 120

Query: 130  GGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASS 189
            GGVASVKGVKGFD EAAKKRFFEIYL+KYAKPNSGIGFPGALELINQCKS GLKVAVASS
Sbjct: 121  GGVASVKGVKGFDPEAAKKRFFEIYLEKYAKPNSGIGFPGALELINQCKSNGLKVAVASS 180

Query: 190  ADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDAL 249
            ADRIKVDANLAAAGLP+SMFDAIVSADAFENLKPAPDIFL+ASKIL+VP  ECIVIEDAL
Sbjct: 181  ADRIKVDANLAAAGLPLSMFDAIVSADAFENLKPAPDIFLAASKILDVPPGECIVIEDAL 240

Query: 250  AGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEH 309
            AGVQAAKAAQMRCIAVTTTL EE LK A PSLIRKEIG+VS++DILTGG    NEKIQ  
Sbjct: 241  AGVQAAKAAQMRCIAVTTTLPEETLKAAGPSLIRKEIGNVSVHDILTGGSDCPNEKIQGS 300

Query: 310  ELLHAASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLF 369
            + +++  Q S  +LKE  ++ SI +T +      S +GLQGSRR+++RYGSLG+A SCL 
Sbjct: 301  QYINSFEQTSPEVLKEGAESVSIQETNSDGGGVLSIAGLQGSRRDMVRYGSLGIALSCLA 360

Query: 370  FAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPI 429
            FAVSNWKAMQYASPKAIWN+LFGVNRP+F + E G SQ+ RIQQFVNYISD+E+R     
Sbjct: 361  FAVSNWKAMQYASPKAIWNLLFGVNRPTFGKNE-GESQTGRIQQFVNYISDLESRGNATT 419

Query: 430  VPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTV 489
            VPEFP++LDWLN+APLQ RRDLKGKVVVLDFWTYCCINCMHVLPDLEFLE KYKD PFTV
Sbjct: 420  VPEFPSQLDWLNSAPLQLRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLETKYKDKPFTV 479

Query: 490  VGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLL 549
            VGVHSAKFDNEKDLEAIRNAVLRYGI+HPVVNDGDM LWRELGVNSWPTFAVVGPNGKLL
Sbjct: 480  VGVHSAKFDNEKDLEAIRNAVLRYGINHPVVNDGDMYLWRELGVNSWPTFAVVGPNGKLL 539

Query: 550  AQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAID 609
            AQL+GEG RKDLDD+V AAL+FYG+KK+LDN+PLPLSLEK+NDPRL TSPLKFPGKLAID
Sbjct: 540  AQLSGEGRRKDLDDIVAAALIFYGEKKMLDNSPLPLSLEKENDPRLLTSPLKFPGKLAID 599

Query: 610  ILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKN 669
            ++NNRLFISDSNHNRIVVTDL+GN+I+QIGS+GEEGLRDGSFDDATFNRPQGLAYNAKKN
Sbjct: 600  VINNRLFISDSNHNRIVVTDLNGNYILQIGSTGEEGLRDGSFDDATFNRPQGLAYNAKKN 659

Query: 670  LLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEK 729
            LLYVADTENHALREIDFVN+TV+TLAGNGTKGSDYQGG KG +QLLNSPWDVC++PINE 
Sbjct: 660  LLYVADTENHALREIDFVNETVQTLAGNGTKGSDYQGGGKGATQLLNSPWDVCFEPINEI 719

Query: 730  VYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYV 789
            VYIAMAGQHQIWEH+T+DGVTRAFSGDGYERNLNG SS +TSFAQPSGISLSPD  E+Y+
Sbjct: 720  VYIAMAGQHQIWEHNTLDGVTRAFSGDGYERNLNGYSSTSTSFAQPSGISLSPDLKEVYI 779

Query: 790  ADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQ 849
            ADSESSSIRAL+LKTGGSRLLAGGD +F DNLF+FGD DG+GSEVLLQHPLGV C K+GQ
Sbjct: 780  ADSESSSIRALDLKTGGSRLLAGGDTVFSDNLFRFGDHDGVGSEVLLQHPLGVSCGKDGQ 839

Query: 850  IYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIAD 909
            IYVADSYNHKIKKLDPA+ RVSTLAG GKAGFKDG ALAAQLSEP+GI+E +NG LFIAD
Sbjct: 840  IYVADSYNHKIKKLDPATGRVSTLAGTGKAGFKDGRALAAQLSEPSGIVEVENGVLFIAD 899

Query: 910  TNNNIIRYLDLNKEEPELQTLELKGVQPPTPKSRSPKRLRRRSSPDAQTIVVDGGLSNEG 969
            TNN++IRYLDL K+E +L TLELKGVQPP PKSRS KRLRRRSS D QTI  DG  SNEG
Sbjct: 900  TNNSVIRYLDLKKKEADLVTLELKGVQPPIPKSRSLKRLRRRSSADTQTITADGTSSNEG 959

Query: 970  NIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVST 1029
            N+Y++IS+PE YHFSKEA+SKFS++ EPE  ++I PLDG LSP G A LHFRR SPS   
Sbjct: 960  NLYIRISVPEGYHFSKEAQSKFSIETEPETTMVIAPLDGILSPGGFATLHFRRSSPSAFM 1019

Query: 1030 GRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSL 1083
             R++CKVYYCKEDEVCLY+ + FEVPF++ +P S PAEI+L Y +KPK  TNSL
Sbjct: 1020 ARVNCKVYYCKEDEVCLYQSVAFEVPFRDAIPGSSPAEISLDYAVKPKTPTNSL 1073

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356571070|ref|XP_003553704.1| PREDICTED: NHL repeat-containing protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|255542920|ref|XP_002512523.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223548484|gb|EEF49975.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449435944|ref|XP_004135754.1| PREDICTED: NHL repeat-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224125014|ref|XP_002319481.1| predicted protein [Populus trichocarpa] gi|222857857|gb|EEE95404.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089788|emb|CBI39607.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30696124|ref|NP_564718.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|17529226|gb|AAL38840.1| unknown protein [Arabidopsis thaliana] gi|332195279|gb|AEE33400.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848174|ref|XP_002891968.1| hypothetical protein ARALYDRAFT_892829 [Arabidopsis lyrata subsp. lyrata] gi|297337810|gb|EFH68227.1| hypothetical protein ARALYDRAFT_892829 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|12323029|gb|AAG51506.1|AC058785_9 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|383100947|emb|CCD74491.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis halleri subsp. halleri] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1089
TAIR|locus:20107281055 AT1G56500 [Arabidopsis thalian 0.685 0.707 0.723 0.0
MGI|MGI:1914116725 Nhlrc2 "NHL repeat containing 0.466 0.700 0.446 5.2e-113
TIGR_CMR|SO_0431217 SO_0431 "HAD-superfamily hydro 0.167 0.838 0.296 3.2e-15
TIGR_CMR|DET_0395456 DET_0395 "glycoprotease family 0.190 0.453 0.320 5.9e-15
UNIPROTKB|P77247222 yniC [Escherichia coli K-12 (t 0.168 0.824 0.287 1.7e-11
UNIPROTKB|Q7ADF8222 yniC "2-deoxyglucose-6-phospha 0.168 0.824 0.287 1.7e-11
UNIPROTKB|Q9KLE8226 VC_A0798 "CbbY family protein" 0.153 0.738 0.286 1.7e-11
TIGR_CMR|VC_A0798226 VC_A0798 "haloacid dehalogenas 0.153 0.738 0.286 1.7e-11
UNIPROTKB|Q10801695 dipZ "Protein DipZ" [Mycobacte 0.185 0.290 0.280 2e-11
TIGR_CMR|BA_4427221 BA_4427 "hydrolase, haloacid d 0.167 0.823 0.251 6e-11
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2923 (1034.0 bits), Expect = 0., Sum P(2) = 0.
 Identities = 553/764 (72%), Positives = 635/764 (83%)

Query:   315 ASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLFFAVSN 374
             +++NSTA+L+E T          +D+  +S +G QGSRR+ILRYGSLG+A SC++FA +N
Sbjct:   296 STRNSTAMLEENT---------VSDK--TSANGFQGSRRDILRYGSLGIALSCVYFAATN 344

Query:   375 WKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFP 434
             WKAMQYASPKA+WN L G   PSF Q +G      R+QQFV+YI+D+E+++T   VPEFP
Sbjct:   345 WKAMQYASPKALWNALVGAKSPSFTQNQGEG----RVQQFVDYIADLESKQTATTVPEFP 400

Query:   435 AKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHS 494
             +KLDWLNTAPLQFRRDLKGKVV+LDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHS
Sbjct:   401 SKLDWLNTAPLQFRRDLKGKVVILDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHS 460

Query:   495 AKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAG 554
             AKFDNEKDL+AIRNAVLRY ISHPVVNDGDM +WRELG+NSWPTFAVV PNGK++AQ+AG
Sbjct:   461 AKFDNEKDLDAIRNAVLRYDISHPVVNDGDMYMWRELGINSWPTFAVVSPNGKVIAQIAG 520

Query:   555 EGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNR 614
             EGHRKDLDD+V AAL +YG K +LD+TPLP  LEKDNDPRL TSPLKFPGKLAID LNNR
Sbjct:   521 EGHRKDLDDVVAAALTYYGGKNVLDSTPLPTRLEKDNDPRLATSPLKFPGKLAIDTLNNR 580

Query:   615 LFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVA 674
             LFISDSNHNRI+VTDL+GNFIVQIGSSGEEG +DGSF+DA FNRPQGLAYNAKKNLLYVA
Sbjct:   581 LFISDSNHNRIIVTDLEGNFIVQIGSSGEEGFQDGSFEDAAFNRPQGLAYNAKKNLLYVA 640

Query:   675 DTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAM 734
             DTENHALREIDFVN+ V+TLAGNGTKGSDYQGG KGT QLLNSPWDVC++P+NEKVYIAM
Sbjct:   641 DTENHALREIDFVNERVQTLAGNGTKGSDYQGGRKGTKQLLNSPWDVCFEPVNEKVYIAM 700

Query:   735 AGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSES 794
             AGQHQIWE+S +DG+TR FSG+GYERNLNGS+   TSFAQPSGISL PD  E Y+ADSES
Sbjct:   701 AGQHQIWEYSVLDGITRVFSGNGYERNLNGSTPQTTSFAQPSGISLGPDLKEAYIADSES 760

Query:   795 SSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVAD 854
             SSIRAL+L+TGGSRLLAGGDP F +NLFKFGD DG+G+EVLLQHPLGV CA +GQIY+ D
Sbjct:   761 SSIRALDLQTGGSRLLAGGDPYFSENLFKFGDNDGVGAEVLLQHPLGVLCANDGQIYLTD 820

Query:   855 SYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNI 914
             SYNHKIKKLDP + RV TLAG GKAGFKDG    AQLSEPAG+   +NG LF+ADTNN++
Sbjct:   821 SYNHKIKKLDPVTKRVVTLAGTGKAGFKDGKVKGAQLSEPAGLAITENGRLFVADTNNSL 880

Query:   915 IRYLDLNK-EEPELQTLELKGVQXXXXXXXXXXXXXXXXXXDAQTIVVDGGLSNEGNIYL 973
             IRY+DLNK E+ E+ TLELKGVQ                  D + + VD   S EG++ L
Sbjct:   881 IRYIDLNKGEDSEILTLELKGVQPPTPKAKSLKRLRKRASADTKIVKVDSVTSREGDLNL 940

Query:   974 KISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRIS 1033
             KISLP+ YHFSKEARSKF VDVEPENAV IDP +G LSPEGS +LHF + S S S G+IS
Sbjct:   941 KISLPDGYHFSKEARSKFVVDVEPENAVAIDPTEGTLSPEGSTMLHFIQSSTSASVGKIS 1000

Query:  1034 CKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPK 1077
             CKVYYCKEDEVCLY+ + FEVPF+ E   S  A  T+ + + P+
Sbjct:  1001 CKVYYCKEDEVCLYQSVQFEVPFKVESELS--ASPTITFTVTPR 1042
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
MGI|MGI:1914116 Nhlrc2 "NHL repeat containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0431 SO_0431 "HAD-superfamily hydrolase, subfamily IA, variant 3 protein family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0395 DET_0395 "glycoprotease family protein/hydrolase, beta-phosphoglucomutase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|P77247 yniC [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ADF8 yniC "2-deoxyglucose-6-phosphate phosphatase" [Escherichia coli O157:H7 (taxid:83334)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KLE8 VC_A0798 "CbbY family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0798 VC_A0798 "haloacid dehalogenase/epoxide hydrolase family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q10801 dipZ "Protein DipZ" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4427 BA_4427 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1089
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 0.0
cd03012126 cd03012, TlpA_like_DipZ_like, TlpA-like family, Di 2e-59
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 2e-45
TIGR02009185 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f 8e-32
cd02966116 cd02966, TlpA_like_family, TlpA-like family; compo 8e-31
COG0546220 COG0546, Gph, Predicted phosphatases [General func 7e-30
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 5e-28
PRK10826222 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; 4e-25
TIGR01990185 TIGR01990, bPGM, beta-phosphoglucomutase 2e-24
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 3e-24
PLN02779286 PLN02779, PLN02779, haloacid dehalogenase-like hyd 4e-24
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 2e-20
PLN02940382 PLN02940, PLN02940, riboflavin kinase 3e-20
pfam1390594 pfam13905, Thioredoxin_8, Thioredoxin-like 1e-17
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 1e-16
PLN02770248 PLN02770, PLN02770, haloacid dehalogenase-like hyd 2e-15
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 2e-15
PRK13222226 PRK13222, PRK13222, phosphoglycolate phosphatase; 8e-15
TIGR01449213 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatas 4e-14
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 2e-13
PRK11587218 PRK11587, PRK11587, putative phosphatase; Provisio 3e-13
PRK10563221 PRK10563, PRK10563, 6-phosphogluconate phosphatase 6e-13
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hy 6e-12
PLN02811220 PLN02811, PLN02811, hydrolase 3e-11
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 8e-11
PRK13223272 PRK13223, PRK13223, phosphoglycolate phosphatase; 2e-10
TIGR01454205 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic 2e-10
PRK03147173 PRK03147, PRK03147, thiol-disulfide oxidoreductase 2e-09
pfam08534142 pfam08534, Redoxin, Redoxin 2e-09
TIGR01422253 TIGR01422, phosphonatase, phosphonoacetaldehyde hy 2e-09
COG3391381 COG3391, COG3391, Uncharacterized conserved protei 2e-08
PLN03243260 PLN03243, PLN03243, haloacid dehalogenase-like hyd 2e-08
TIGR01549162 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase sup 3e-08
TIGR02252203 TIGR02252, DREG-2, REG-2-like, HAD superfamily (su 6e-08
PLN02575381 PLN02575, PLN02575, haloacid dehalogenase-like hyd 7e-08
TIGR03351220 TIGR03351, PhnX-like, phosphonatase-like hydrolase 8e-08
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 1e-07
PRK13478267 PRK13478, PRK13478, phosphonoacetaldehyde hydrolas 7e-07
PRK13288214 PRK13288, PRK13288, pyrophosphatase PpaX; Provisio 1e-06
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 1e-06
TIGR01428198 TIGR01428, HAD_type_II, 2-haloalkanoic acid dehalo 1e-06
cd03011123 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, 2e-06
cd0294793 cd02947, TRX_family, TRX family; composed of two g 3e-06
pfam0143628 pfam01436, NHL, NHL repeat 4e-06
TIGR02247211 TIGR02247, HAD-1A3-hyp, epoxide hydrolase N-termin 2e-05
pfam13098105 pfam13098, Thioredoxin_2, Thioredoxin-like domain 4e-05
TIGR01993183 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleoti 4e-05
TIGR01548197 TIGR01548, HAD-SF-IA-hyp1, haloacid dehalogenase s 7e-05
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 1e-04
PRK14018521 PRK14018, PRK14018, trifunctional thioredoxin/meth 3e-04
cd03010127 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (a 4e-04
TIGR01668170 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam 4e-04
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 6e-04
pfam0143628 pfam01436, NHL, NHL repeat 0.001
COG2179175 COG2179, COG2179, Predicted hydrolase of the HAD s 0.001
PRK08942181 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p 0.002
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 0.002
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
 Score = 1933 bits (5009), Expect = 0.0
 Identities = 823/1088 (75%), Positives = 905/1088 (83%), Gaps = 33/1088 (3%)

Query: 2    IAMKLLSSPPASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRTVLGRRMVVKACVT 61
            +A+KL S P   S   +     F P    L  +S                     K+C  
Sbjct: 1    MALKLASPPSLFSWPRRHCAGDFPPA---LAFASSIRGRRSRSGVWLGKNGGARSKSCAK 57

Query: 62   KVEETDVNVSSESKWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFM 121
              E++     +  +WGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDF+PFM
Sbjct: 58   VEEKSRGAEIATEEWGKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFVPFM 117

Query: 122  GTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDKYAKPNSGIGFPGALELINQCKSKG 181
            GTGEANFLGGVASVKGVKGFD +AAKKRFFEIYL+KYAKPNSGIGFPGALELI QCK+KG
Sbjct: 118  GTGEANFLGGVASVKGVKGFDPDAAKKRFFEIYLEKYAKPNSGIGFPGALELITQCKNKG 177

Query: 182  LKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNVPTSE 241
            LKVAVASSADRIKVDANLAAAGLP+SMFDAIVSADAFENLKPAPDIFL+A+KIL VPTSE
Sbjct: 178  LKVAVASSADRIKVDANLAAAGLPLSMFDAIVSADAFENLKPAPDIFLAAAKILGVPTSE 237

Query: 242  CIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGS 301
            C+VIEDALAGVQAA+AA MRCIAVTTTLSEE LK+A PSLIRK+IG++SL+DILTGG   
Sbjct: 238  CVVIEDALAGVQAARAAGMRCIAVTTTLSEEILKDAGPSLIRKDIGNISLSDILTGG--- 294

Query: 302  YNEKIQEHELLHAASQNSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSL 361
                                   + T N + +D         S  G QGSRR+ILRYGSL
Sbjct: 295  ----------------------SDATPNVTGMDWINTILDTGSILGFQGSRRDILRYGSL 332

Query: 362  GVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPSFEQTEGGSSQSERIQQFVNYISDV 421
            G+A SCL+FA +NWKAMQYASPKA+WN LFGV+ PSF Q  G       +QQFV+YISD+
Sbjct: 333  GIALSCLYFAATNWKAMQYASPKALWNALFGVDDPSFAQNSGEG----CVQQFVSYISDL 388

Query: 422  ENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKK 481
            E++KT   VPEFP KLDWLNTAPLQFRRDLKGKVV+LDFWTYCCINCMHVLPDLEFLEKK
Sbjct: 389  ESKKTATKVPEFPPKLDWLNTAPLQFRRDLKGKVVILDFWTYCCINCMHVLPDLEFLEKK 448

Query: 482  YKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAV 541
            YKD PFTVVGVHSAKFDNEKDLEAIRNAVLRY ISHPVVNDGDM LWRELGV+SWPTFAV
Sbjct: 449  YKDQPFTVVGVHSAKFDNEKDLEAIRNAVLRYNISHPVVNDGDMYLWRELGVSSWPTFAV 508

Query: 542  VGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLK 601
            V PNGKL+AQL+GEGHRKDLDDLVEAAL +YG+KKLLD+TPLPLSLEKDNDPRL TSPLK
Sbjct: 509  VSPNGKLIAQLSGEGHRKDLDDLVEAALQYYGEKKLLDSTPLPLSLEKDNDPRLLTSPLK 568

Query: 602  FPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQG 661
            FPGKLAID+LNNRLFISDSNHNRIVVTDLDGNFIVQIGS+GEEGLRDGSF+DATFNRPQG
Sbjct: 569  FPGKLAIDLLNNRLFISDSNHNRIVVTDLDGNFIVQIGSTGEEGLRDGSFEDATFNRPQG 628

Query: 662  LAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDV 721
            LAYNAKKNLLYVADTENHALREIDFVN+TVRTLAGNGTKGSDYQGG+KGTSQ+LNSPWDV
Sbjct: 629  LAYNAKKNLLYVADTENHALREIDFVNETVRTLAGNGTKGSDYQGGKKGTSQVLNSPWDV 688

Query: 722  CYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLS 781
            C++P+NEKVYIAMAGQHQIWE++  DGVTR FSGDGYERNLNGSS  +TSFAQPSGISLS
Sbjct: 689  CFEPVNEKVYIAMAGQHQIWEYNISDGVTRVFSGDGYERNLNGSSGTSTSFAQPSGISLS 748

Query: 782  PDFMEIYVADSESSSIRALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLG 841
            PD  E+Y+ADSESSSIRAL+LKTGGSRLLAGGDP F DNLFKFGD DG+GSEVLLQHPLG
Sbjct: 749  PDLKELYIADSESSSIRALDLKTGGSRLLAGGDPTFSDNLFKFGDHDGVGSEVLLQHPLG 808

Query: 842  VYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIGKAGFKDGAALAAQLSEPAGIIEAQ 901
            V CAK+GQIYVADSYNHKIKKLDPA+ RV+TLAG GKAGFKDG AL AQLSEPAG+   +
Sbjct: 809  VLCAKDGQIYVADSYNHKIKKLDPATKRVTTLAGTGKAGFKDGKALKAQLSEPAGLALGE 868

Query: 902  NGNLFIADTNNNIIRYLDLNKEE-PELQTLELKGVQPPTPKSRSPKRLRRRSSPDAQTIV 960
            NG LF+ADTNN++IRYLDLNK E  E+ TLELKGVQPP PKS+S KRLRRRSS D Q I 
Sbjct: 869  NGRLFVADTNNSLIRYLDLNKGEAAEILTLELKGVQPPRPKSKSLKRLRRRSSADTQVIK 928

Query: 961  VDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHF 1020
            VDG  S EG++ LKISLP  YHFSKEARSKF V+VEPENAV IDP +G LSP+G A LHF
Sbjct: 929  VDGVTSLEGDLQLKISLPPGYHFSKEARSKFEVEVEPENAVDIDPDEGTLSPDGRASLHF 988

Query: 1021 RRMSPSVSTGRISCKVYYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILT 1080
            +R S S STGRISCKVYYCKEDEVCLY+ L+FEVPF+EE      + ITL Y +KPK   
Sbjct: 989  KRSSASASTGRISCKVYYCKEDEVCLYQSLVFEVPFEEENGGESSSSITLKYTVKPKAPQ 1048

Query: 1081 NSLQLPVA 1088
             SLQLP+ 
Sbjct: 1049 PSLQLPIT 1056

Length = 1057
>gnl|CDD|239310 cd03012, TlpA_like_DipZ_like, TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|236770 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|213672 TIGR01990, bPGM, beta-phosphoglucomutase Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information
>gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|215413 PLN02770, PLN02770, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|130516 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|183215 PRK11587, PRK11587, putative phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|182552 PRK10563, PRK10563, 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>gnl|CDD|178407 PLN02811, PLN02811, hydrolase Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|171912 PRK13223, PRK13223, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|130521 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|219888 pfam08534, Redoxin, Redoxin Back     alignment and domain information
>gnl|CDD|188140 TIGR01422, phosphonatase, phosphonoacetaldehyde hydrolase Back     alignment and domain information
>gnl|CDD|225926 COG3391, COG3391, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215644 PLN03243, PLN03243, haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|233463 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>gnl|CDD|215313 PLN02575, PLN02575, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|234176 TIGR03351, PhnX-like, phosphonatase-like hydrolase Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184075 PRK13478, PRK13478, phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237336 PRK13288, PRK13288, pyrophosphatase PpaX; Provisional Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|130495 TIGR01428, HAD_type_II, 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>gnl|CDD|239309 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|110440 pfam01436, NHL, NHL repeat Back     alignment and domain information
>gnl|CDD|233800 TIGR02247, HAD-1A3-hyp, epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|233675 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleotidase Back     alignment and domain information
>gnl|CDD|233462 TIGR01548, HAD-SF-IA-hyp1, haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|184456 PRK14018, PRK14018, trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>gnl|CDD|239308 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>gnl|CDD|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|110440 pfam01436, NHL, NHL repeat Back     alignment and domain information
>gnl|CDD|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1089
PLN029191057 haloacid dehalogenase-like hydrolase family protei 100.0
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.95
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.94
PRK13288214 pyrophosphatase PpaX; Provisional 99.94
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.94
COG0546220 Gph Predicted phosphatases [General function predi 99.94
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.94
PLN02575381 haloacid dehalogenase-like hydrolase 99.94
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.94
PRK13226229 phosphoglycolate phosphatase; Provisional 99.94
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.93
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.93
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.93
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.92
PRK13223272 phosphoglycolate phosphatase; Provisional 99.92
PRK11587218 putative phosphatase; Provisional 99.92
PRK13225273 phosphoglycolate phosphatase; Provisional 99.92
PLN02940382 riboflavin kinase 99.92
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.92
PRK13222226 phosphoglycolate phosphatase; Provisional 99.91
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.91
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.9
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.9
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.9
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.9
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.9
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.89
PRK09449224 dUMP phosphatase; Provisional 99.88
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.88
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.88
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.87
PLN02811220 hydrolase 99.87
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.86
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.86
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.86
PRK14988224 GMP/IMP nucleotidase; Provisional 99.86
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.86
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.86
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.85
PLN02412167 probable glutathione peroxidase 99.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.85
PTZ00056199 glutathione peroxidase; Provisional 99.85
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.84
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.84
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.83
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.83
PRK14018521 trifunctional thioredoxin/methionine sulfoxide red 99.83
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.82
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.82
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.81
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.81
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.81
PTZ00256183 glutathione peroxidase; Provisional 99.8
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.8
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.8
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.8
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.8
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.8
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.8
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.79
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.79
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.79
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.79
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.79
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.79
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.78
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.78
PHA02597197 30.2 hypothetical protein; Provisional 99.78
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.77
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.76
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.76
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.76
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.76
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.75
PLN02954224 phosphoserine phosphatase 99.75
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.75
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.74
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.74
PRK13190202 putative peroxiredoxin; Provisional 99.74
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.74
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.74
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.73
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.73
PRK13599215 putative peroxiredoxin; Provisional 99.73
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.72
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.72
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.71
PRK15000200 peroxidase; Provisional 99.71
PRK13191215 putative peroxiredoxin; Provisional 99.71
PRK06769173 hypothetical protein; Validated 99.71
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.7
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.7
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.7
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.69
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.69
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.69
PRK11133322 serB phosphoserine phosphatase; Provisional 99.69
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.69
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.68
PRK13189222 peroxiredoxin; Provisional 99.67
PRK13728181 conjugal transfer protein TrbB; Provisional 99.67
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.67
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.67
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.66
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.66
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.66
PTZ00253199 tryparedoxin peroxidase; Provisional 99.66
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.65
COG3391381 Uncharacterized conserved protein [Function unknow 99.65
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.65
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.64
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.64
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.62
PRK11028330 6-phosphogluconolactonase; Provisional 99.62
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.61
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.6
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.59
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.58
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.58
PRK11028330 6-phosphogluconolactonase; Provisional 99.57
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.55
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.55
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.55
PRK10444248 UMP phosphatase; Provisional 99.54
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.53
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.52
COG3391381 Uncharacterized conserved protein [Function unknow 99.51
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.51
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.51
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.5
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.5
PLN02645311 phosphoglycolate phosphatase 99.5
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.49
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.49
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.49
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.49
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.48
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.47
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.47
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.47
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.45
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.45
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 99.44
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.43
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.43
KOG12141289 consensus Nidogen and related basement membrane pr 99.43
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.43
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.42
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.42
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.41
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.41
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 99.41
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.4
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.38
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.37
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.37
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.36
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.35
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.35
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.34
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.34
PHA02530300 pseT polynucleotide kinase; Provisional 99.34
KOG12141289 consensus Nidogen and related basement membrane pr 99.33
PHA02278103 thioredoxin-like protein 99.32
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.31
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.3
PRK09381109 trxA thioredoxin; Provisional 99.29
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.28
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.28
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.27
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.27
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.26
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.25
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.25
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.24
PRK10996139 thioredoxin 2; Provisional 99.24
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.24
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.23
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.23
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.23
COG3118304 Thioredoxin domain-containing protein [Posttransla 99.22
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 99.22
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.2
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.2
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.19
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 99.19
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 99.19
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 99.18
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.18
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 99.18
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.17
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.16
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.15
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.15
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.15
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.15
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.14
KOG0855211 consensus Alkyl hydroperoxide reductase, thiol spe 99.14
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.13
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.13
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.13
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.13
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.12
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.11
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.11
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.1
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.1
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.1
PRK11590211 hypothetical protein; Provisional 99.09
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.08
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.08
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.08
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.06
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 99.06
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.05
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 99.04
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.03
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.03
PRK08238479 hypothetical protein; Validated 99.0
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 99.0
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 98.99
PTZ0005198 thioredoxin; Provisional 98.98
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.97
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.97
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.97
KOG0852196 consensus Alkyl hydroperoxide reductase, thiol spe 98.97
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.96
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 98.96
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.96
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.96
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.93
COG4229229 Predicted enolase-phosphatase [Energy production a 98.93
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 98.92
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.91
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.9
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 98.9
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 98.9
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.9
PTZ00445219 p36-lilke protein; Provisional 98.9
KOG1651171 consensus Glutathione peroxidase [Posttranslationa 98.89
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 98.88
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.87
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.84
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.83
KOG2792280 consensus Putative cytochrome C oxidase assembly p 98.83
PRK01158230 phosphoglycolate phosphatase; Provisional 98.82
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.8
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.8
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.79
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.76
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.76
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.75
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 98.75
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.75
PTZ00102477 disulphide isomerase; Provisional 98.74
PRK05137435 tolB translocation protein TolB; Provisional 98.74
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.73
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.71
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 98.71
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 98.7
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 98.69
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.69
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.69
PRK02888635 nitrous-oxide reductase; Validated 98.68
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.68
PLN02309457 5'-adenylylsulfate reductase 98.66
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.65
PRK04922433 tolB translocation protein TolB; Provisional 98.64
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.61
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.61
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.61
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.61
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.6
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 98.6
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.58
PRK04792448 tolB translocation protein TolB; Provisional 98.58
PRK02889427 tolB translocation protein TolB; Provisional 98.57
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.57
KOG0279315 consensus G protein beta subunit-like protein [Sig 98.57
PRK00178430 tolB translocation protein TolB; Provisional 98.56
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.56
PRK04043419 tolB translocation protein TolB; Provisional 98.56
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.55
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.55
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.54
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 98.54
PRK03629429 tolB translocation protein TolB; Provisional 98.54
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 98.52
PRK10513270 sugar phosphate phosphatase; Provisional 98.52
PTZ00062204 glutaredoxin; Provisional 98.52
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.52
KOG0854224 consensus Alkyl hydroperoxide reductase, thiol spe 98.5
PTZ00102477 disulphide isomerase; Provisional 98.46
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.46
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.46
PRK01742429 tolB translocation protein TolB; Provisional 98.44
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.43
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 98.42
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.39
PRK10976266 putative hydrolase; Provisional 98.39
cd02958114 UAS UAS family; UAS is a domain of unknown functio 98.39
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.38
PHA0212575 thioredoxin-like protein 98.37
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 98.36
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.34
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.32
PRK04792448 tolB translocation protein TolB; Provisional 98.32
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 98.3
PRK05137435 tolB translocation protein TolB; Provisional 98.29
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 98.29
PRK02888635 nitrous-oxide reductase; Validated 98.29
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.28
PRK01029428 tolB translocation protein TolB; Provisional 98.28
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 98.26
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 98.25
PRK04922433 tolB translocation protein TolB; Provisional 98.24
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.23
COG4359220 Uncharacterized conserved protein [Function unknow 98.22
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.21
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.2
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.19
PLN02887580 hydrolase family protein 98.19
KOG0286343 consensus G-protein beta subunit [General function 98.19
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.18
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.18
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.17
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.17
PRK02889427 tolB translocation protein TolB; Provisional 98.16
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.16
PRK03629429 tolB translocation protein TolB; Provisional 98.15
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.14
PHA03398303 viral phosphatase superfamily protein; Provisional 98.13
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.13
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 98.13
COG4087152 Soluble P-type ATPase [General function prediction 98.13
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.11
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.11
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.11
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.11
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.1
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 98.1
TIGR01522884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.07
PRK00178430 tolB translocation protein TolB; Provisional 98.06
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.05
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 98.04
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 98.04
PRK10671834 copA copper exporting ATPase; Provisional 98.04
KOG0266456 consensus WD40 repeat-containing protein [General 98.03
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 98.03
KOG0279315 consensus G protein beta subunit-like protein [Sig 98.01
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.01
KOG1215877 consensus Low-density lipoprotein receptors contai 97.99
PF13728215 TraF: F plasmid transfer operon protein 97.98
smart00594122 UAS UAS domain. 97.97
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.96
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 97.96
PRK04043419 tolB translocation protein TolB; Provisional 97.93
TIGR02739256 TraF type-F conjugative transfer system pilin asse 97.91
PTZ00421493 coronin; Provisional 97.9
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 97.9
PLN00181793 protein SPA1-RELATED; Provisional 97.89
PLN00181793 protein SPA1-RELATED; Provisional 97.87
KOG0315311 consensus G-protein beta subunit-like protein (con 97.86
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.86
PRK01742429 tolB translocation protein TolB; Provisional 97.85
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.85
KOG0266456 consensus WD40 repeat-containing protein [General 97.84
COG4996164 Predicted phosphatase [General function prediction 97.84
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 97.84
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 97.83
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 97.82
KOG4277468 consensus Uncharacterized conserved protein, conta 97.81
COG4232569 Thiol:disulfide interchange protein [Posttranslati 97.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.79
KOG0263707 consensus Transcription initiation factor TFIID, s 97.78
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.77
PRK13703248 conjugal pilus assembly protein TraF; Provisional 97.77
KOG0318603 consensus WD40 repeat stress protein/actin interac 97.76
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.76
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 97.75
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 97.7
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 97.7
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 97.69
PF13449326 Phytase-like: Esterase-like activity of phytase 97.69
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.68
PRK01029428 tolB translocation protein TolB; Provisional 97.64
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.64
KOG0293519 consensus WD40 repeat-containing protein [Function 97.63
PTZ00421493 coronin; Provisional 97.63
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 97.63
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.62
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.62
KOG0282503 consensus mRNA splicing factor [Function unknown] 97.61
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.6
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.6
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.59
KOG0315311 consensus G-protein beta subunit-like protein (con 97.58
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.57
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.57
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 97.56
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 97.56
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 97.56
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.55
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.55
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 97.53
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.53
PTZ00420 568 coronin; Provisional 97.52
KOG0296399 consensus Angio-associated migratory cell protein 97.51
COG3823262 Glutamine cyclotransferase [Posttranslational modi 97.5
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 97.47
KOG1215877 consensus Low-density lipoprotein receptors contai 97.44
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.4
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.4
KOG0772641 consensus Uncharacterized conserved protein, conta 97.39
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.39
KOG0296399 consensus Angio-associated migratory cell protein 97.39
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.39
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 97.39
PTZ00420568 coronin; Provisional 97.36
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 97.33
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 97.33
COG3700237 AphA Acid phosphatase (class B) [General function 97.28
TIGR01116917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.28
COG2143182 Thioredoxin-related protein [Posttranslational mod 97.24
KOG0295406 consensus WD40 repeat-containing protein [Function 97.22
PF13449326 Phytase-like: Esterase-like activity of phytase 97.2
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 97.16
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 97.15
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 97.15
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.13
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 97.09
COG2503274 Predicted secreted acid phosphatase [General funct 97.08
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.08
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.07
PRK10877232 protein disulfide isomerase II DsbC; Provisional 97.07
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.05
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 97.05
KOG2055514 consensus WD40 repeat protein [General function pr 97.04
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 97.03
KOG1731606 consensus FAD-dependent sulfhydryl oxidase/quiesci 96.98
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.96
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 96.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 96.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 96.94
COG4946668 Uncharacterized protein related to the periplasmic 96.91
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 96.91
PRK14010673 potassium-transporting ATPase subunit B; Provision 96.9
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.9
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.89
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 96.88
KOG0310487 consensus Conserved WD40 repeat-containing protein 96.87
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.87
PRK01122679 potassium-transporting ATPase subunit B; Provision 96.85
KOG2048 691 consensus WD40 repeat protein [General function pr 96.84
PLN02645311 phosphoglycolate phosphatase 96.84
KOG0772641 consensus Uncharacterized conserved protein, conta 96.83
KOG0263707 consensus Transcription initiation factor TFIID, s 96.83
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.81
KOG1273405 consensus WD40 repeat protein [General function pr 96.79
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 96.79
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 96.78
KOG1273405 consensus WD40 repeat protein [General function pr 96.77
KOG0293519 consensus WD40 repeat-containing protein [Function 96.77
TIGR01517941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 96.74
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 96.73
KOG0282503 consensus mRNA splicing factor [Function unknown] 96.7
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 96.69
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 96.67
PRK10517902 magnesium-transporting ATPase MgtA; Provisional 96.65
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 96.65
KOG0310487 consensus Conserved WD40 repeat-containing protein 96.64
KOG0289506 consensus mRNA splicing factor [General function p 96.63
TIGR015231053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 96.6
KOG0289506 consensus mRNA splicing factor [General function p 96.59
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 96.59
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 96.58
KOG2106626 consensus Uncharacterized conserved protein, conta 96.57
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 96.56
PLN02382413 probable sucrose-phosphatase 96.55
KOG0645312 consensus WD40 repeat protein [General function pr 96.54
TIGR01524867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 96.53
PRK15122903 magnesium-transporting ATPase; Provisional 96.5
TIGR01647755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 96.49
KOG1407313 consensus WD40 repeat protein [Function unknown] 96.47
KOG1274 933 consensus WD40 repeat protein [General function pr 96.47
KOG1407313 consensus WD40 repeat protein [Function unknown] 96.44
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 96.44
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 96.44
KOG1274 933 consensus WD40 repeat protein [General function pr 96.43
KOG0641350 consensus WD40 repeat protein [General function pr 96.41
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 96.38
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 96.37
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 96.28
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 96.26
COG0474917 MgtA Cation transport ATPase [Inorganic ion transp 96.25
PRK13616591 lipoprotein LpqB; Provisional 96.25
COG5276370 Uncharacterized conserved protein [Function unknow 96.21
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.2
KOG0286343 consensus G-protein beta subunit [General function 96.18
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
Probab=100.00  E-value=2.5e-141  Score=1340.81  Aligned_cols=1052  Identities=78%  Similarity=1.205  Sum_probs=931.0

Q ss_pred             cccccCCCCCCCccccccccccCCCCCCCCCCCCCcccccccCcccc-ccccc--cccccccccc-ccccccCCCCCCCC
Q 001380            2 IAMKLLSSPPASSLSLQTKLFFFSPNTKQLRPSSVSSALFQCGAKRT-VLGRR--MVVKACVTKV-EETDVNVSSESKWG   77 (1089)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~--~~~~~~~~~~-~~~~~~~~~~~~~~   77 (1089)
                      ||++|+++|+++++++   +++.++.++   +..+++++.+.+.+.. .+.++  +..+.+.... .+....... ..++
T Consensus         1 ~~~~~~~~~~~~~~~~---~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~   73 (1057)
T PLN02919          1 MALKLASPPSLFSWPR---RHCAGDFPP---ALAFASSIRGRRSRSGVWLGKNGGARSKSCAKVEEKSRGAEIAT-EEWG   73 (1057)
T ss_pred             CCccccCCcccccCcc---cCccCCCCc---ccccchhhcCchhhccceeccccccccceeeehhhhCCCCccCC-CcCC
Confidence            8999999999988884   444222222   3444445444333322 22222  1112221111 222233333 5678


Q ss_pred             CceEEEEecCCcccCCchHHHHHHHHHHHHcCCCCCHHhHhhhcCCCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHH
Q 001380           78 KVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYLDK  157 (1089)
Q Consensus        78 ~~k~ViFD~DGTL~d~~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (1089)
                      ++++|+|||||||+|+...+.+++.++++++|++++.+++..+++.+...++..+....++.....++..+++.+.+.+.
T Consensus        74 ~ikaVIFDlDGTLiDS~~~~~~a~~~~~~~~G~~it~e~~~~~~G~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  153 (1057)
T PLN02919         74 KVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVEDFVPFMGTGEANFLGGVASVKGVKGFDPDAAKKRFFEIYLEK  153 (1057)
T ss_pred             CCCEEEECCCCCeEeChHHHHHHHHHHHHHcCCCCCHHHHHHHhCCCHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999998888888899998888887776665554445555566666666655


Q ss_pred             hcCCCCCCCCccHHHHHHHHHhCCCeEEEEcCCChHhHHHHHHHCCCCCCCccEEEEcCCccCCCCCHHHHHHHHHHcCC
Q 001380          158 YAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKILNV  237 (1089)
Q Consensus       158 ~~~~~~~~~~pG~~~lL~~Lk~~Gi~vaIvSn~~~~~~~~~l~~~gl~~~~fd~i~~~~~~~~~KP~~~~~~~~l~~lgv  237 (1089)
                      +.......++||+.++|++|+++|++++|+||.....++..++++++...+||.+++++++...||+|++|.++++++|+
T Consensus       154 ~~~~~~~~~~pG~~elL~~Lk~~G~~l~IvSn~~~~~~~~~L~~~gl~~~~Fd~iv~~~~~~~~KP~Pe~~~~a~~~lgv  233 (1057)
T PLN02919        154 YAKPNSGIGFPGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPLSMFDAIVSADAFENLKPAPDIFLAAAKILGV  233 (1057)
T ss_pred             hhhcccCccCccHHHHHHHHHhCCCeEEEEeCCcHHHHHHHHHHcCCChhHCCEEEECcccccCCCCHHHHHHHHHHcCc
Confidence            54332335799999999999999999999999999999999999999436899999999999999999999999999999


Q ss_pred             CCCcEEEEcCChhhHHHHHHcCCeEEEEcCCCCHHHHhhcCCcEEecCcccCCHHHHHhccCCCCcchhhhhhhhhcccc
Q 001380          238 PTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDILTGGGGSYNEKIQEHELLHAASQ  317 (1089)
Q Consensus       238 ~p~~~v~VGD~~~Di~aA~~aG~~~i~V~~g~~~~~l~~~~~d~vi~dl~el~i~~ll~~~~~~~~~~~~~~~~~~~~~~  317 (1089)
                      .|++||||||+..|+++|+++||++|+|.++...+++...+|+++++++.++.+.+++....+.+..             
T Consensus       234 ~p~e~v~IgDs~~Di~AA~~aGm~~I~v~~~~~~~~L~~~~a~~vi~~l~el~~~~~~~~~~~~~~~-------------  300 (1057)
T PLN02919        234 PTSECVVIEDALAGVQAARAAGMRCIAVTTTLSEEILKDAGPSLIRKDIGNISLSDILTGGSDATPN-------------  300 (1057)
T ss_pred             CcccEEEEcCCHHHHHHHHHcCCEEEEECCCCCHHHHhhCCCCEEECChHHCCHHHHHhcCCCCCCC-------------
Confidence            9999999999999999999999999999998888888889999999999999999999888543211             


Q ss_pred             CchhhccccCCCCcccccCCCCCCCcccCCCcccchhhhhhhhhhhHHHHhhhhccccccccccCHHHHHHhhhcCCCcc
Q 001380          318 NSTALLKEKTDNWSILDTGAADEKGSSTSGLQGSRREILRYGSLGVAFSCLFFAVSNWKAMQYASPKAIWNVLFGVNRPS  397 (1089)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lg~~~~~l~~~~~~~~~~~~~~p~~l~~~~~~~~~p~  397 (1089)
                       .        .+..|+....+.+.   ..+++++||+|+||++||+|++|++++..+|++|+|++|+.+++.|.+...|.
T Consensus       301 -~--------~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (1057)
T PLN02919        301 -V--------TGMDWINTILDTGS---ILGFQGSRRDILRYGSLGIALSCLYFAATNWKAMQYASPKALWNALFGVDDPS  368 (1057)
T ss_pred             -c--------cchhhhcccccccc---ccCcccchhhhhhhhhhhhhhhhheeeccchhhhhhcCHHHHHHHHhccCchh
Confidence             1        12233343333333   35999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCChHHHHHHHHHHHHhhccCCCCCCCCCCccccCCCCCceeecccccCCCEEEEEEecCCCcchhhhhhhHHH
Q 001380          398 FEQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEF  477 (1089)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~P~f~~~~~~~~g~~~~l~~~~~gk~vll~Fwa~wC~~C~~~~p~l~~  477 (1089)
                      |+..+...    .++.+.+++..++....|+++|+|+..+.|++|+++++.++++||+|||+|||+||++|++++|.|++
T Consensus       369 ~~~~~~~~----~~~~~~~~i~~~~~~~~g~~~p~f~~~~~~~~g~~~~l~~~lkGK~vll~FWAsWC~pC~~e~P~L~~  444 (1057)
T PLN02919        369 FAQNSGEG----CVQQFVSYISDLESKKTATKVPEFPPKLDWLNTAPLQFRRDLKGKVVILDFWTYCCINCMHVLPDLEF  444 (1057)
T ss_pred             hhhccchh----HHHHHHHHHHhhhccccCCcCCCCcccccccCCccccchhhcCCCEEEEEEECCcChhHHhHhHHHHH
Confidence            98877765    69999999999999999999999999888999999998568999999999999999999999999999


Q ss_pred             HHHHcCCCCEEEEEEeCCCCCChhcHHHHHHHHHHcCCccceeecCChhHHHHhCCCceeEEEEECCCCcEEEEecCCCc
Q 001380          478 LEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGH  557 (1089)
Q Consensus       478 l~~~~~~~~v~vi~v~~~~~~~~~~~~~~~~~~~~~~~~~~v~~d~~~~l~~~~~v~~~Pt~~lid~~G~i~~~~~G~~~  557 (1089)
                      ++++|+++++.||+|++.+++.+++.+++++++++++++||++.|.+.+++++|+|.++|+++|||++|++++++.|+..
T Consensus       445 l~~~y~~~~~~vvgV~~~~~D~~~~~~~~~~~~~~~~i~~pvv~D~~~~~~~~~~V~~iPt~ilid~~G~iv~~~~G~~~  524 (1057)
T PLN02919        445 LEKKYKDQPFTVVGVHSAKFDNEKDLEAIRNAVLRYNISHPVVNDGDMYLWRELGVSSWPTFAVVSPNGKLIAQLSGEGH  524 (1057)
T ss_pred             HHHHcCCCCeEEEEEecccccccccHHHHHHHHHHhCCCccEEECCchHHHHhcCCCccceEEEECCCCeEEEEEecccC
Confidence            99999988999999998888887889999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHhcccccccCCCCCcccccCCCCCCCCCCCCCCceEEEeecCCeEEEEeCCCCEEEEEeCCCCEEEE
Q 001380          558 RKDLDDLVEAALLFYGKKKLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFIVQ  637 (1089)
Q Consensus       558 ~~~l~~~l~~~l~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~P~~vavd~~~g~L~vsd~~~~~I~~~~~~g~~~~~  637 (1089)
                      .+.++++|+.++.+++.++++++.++|..++.+++++..+++|.+|+++++|+.+|+|||+|+++|||++++.+|+++..
T Consensus       525 ~~~l~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~~P~gvavd~~~g~lyVaDs~n~rI~v~d~~G~~i~~  604 (1057)
T PLN02919        525 RKDLDDLVEAALQYYGEKKLLDSTPLPLSLEKDNDPRLLTSPLKFPGKLAIDLLNNRLFISDSNHNRIVVTDLDGNFIVQ  604 (1057)
T ss_pred             HHHHHHHHHHHHHhhccccccccCCCcccccccCCcccccccCCCCceEEEECCCCeEEEEECCCCeEEEEeCCCCEEEE
Confidence            99999999999999999999999999999999999999899999999999998789999999999999999999999999


Q ss_pred             EecCCCCCCCCCCCCccccCCcceeEEeeCCCEEEEEECCCCEEEEEECCCCeEEEEecCCCCCCCCCCCCcccccccCC
Q 001380          638 IGSSGEEGLRDGSFDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNDTVRTLAGNGTKGSDYQGGEKGTSQLLNS  717 (1089)
Q Consensus       638 i~~~g~~g~~dG~~~~~~f~~P~gla~d~~g~~lyVaD~~n~~I~~~d~~~g~v~~~ag~g~~~~~~~~~~~~~~~~l~~  717 (1089)
                      +++.+..|+.||.+..+.|+.|+||+++++++.|||+|++||+|+++|+.++.++++++.|..+..+.++..+..+.+++
T Consensus       605 ig~~g~~G~~dG~~~~a~f~~P~GIavd~~gn~LYVaDt~n~~Ir~id~~~~~V~tlag~G~~g~~~~gg~~~~~~~ln~  684 (1057)
T PLN02919        605 IGSTGEEGLRDGSFEDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNETVRTLAGNGTKGSDYQGGKKGTSQVLNS  684 (1057)
T ss_pred             EccCCCcCCCCCchhccccCCCcEEEEeCCCCEEEEEeCCCceEEEEecCCCEEEEEeccCcccCCCCCChhhhHhhcCC
Confidence            98877889999999999999999999999998899999999999999999999999999998887766666666677999


Q ss_pred             ceeEEEecCCCEEEEEECCCcEEEEEECCCCeEEEEeCCCccccCCCCCCCCccccCCceEEEcCCCCEEEEEeCCCCeE
Q 001380          718 PWDVCYKPINEKVYIAMAGQHQIWEHSTVDGVTRAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSSI  797 (1089)
Q Consensus       718 P~~la~~~~g~~lyvad~~~~~I~~~~~~~g~~~~~~g~g~~~~~~g~~~~~~~~~~P~glav~~~g~~lyvad~~~~~I  797 (1089)
                      |++|+++++++.+||+|.++|+|+++|..++.+..+.|.|.....++.......+.+|+||+++++|++|||+|+++++|
T Consensus       685 P~gVa~dp~~g~LyVad~~~~~I~v~d~~~g~v~~~~G~G~~~~~~g~~~~~~~~~~P~GIavspdG~~LYVADs~n~~I  764 (1057)
T PLN02919        685 PWDVCFEPVNEKVYIAMAGQHQIWEYNISDGVTRVFSGDGYERNLNGSSGTSTSFAQPSGISLSPDLKELYIADSESSSI  764 (1057)
T ss_pred             CeEEEEecCCCeEEEEECCCCeEEEEECCCCeEEEEecCCccccCCCCccccccccCccEEEEeCCCCEEEEEECCCCeE
Confidence            99999999777999999999999999999999999999887766666655556789999999999998899999999999


Q ss_pred             EEEEcCCCCeEEEecCCCCCCCCccccCCCCCccccccccCceEEEEccCCcEEEEeCCCCEEEEEeCCCCeEEEEeccC
Q 001380          798 RALNLKTGGSRLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPLGVYCAKNGQIYVADSYNHKIKKLDPASNRVSTLAGIG  877 (1089)
Q Consensus       798 ~~~~~~~~~~~~~~g~~~~~~~~l~~~g~~dg~~~~~~l~~P~gva~~~~G~lyVaD~~n~~I~~~d~~~~~v~t~~g~g  877 (1089)
                      ++++++++....++++++..+.+++.||+.+|.+..+.+++|.||+++++|++||+|++||+|+++|++++.+.+++|+|
T Consensus       765 rv~D~~tg~~~~~~gg~~~~~~~l~~fG~~dG~g~~~~l~~P~Gvavd~dG~LYVADs~N~rIrviD~~tg~v~tiaG~G  844 (1057)
T PLN02919        765 RALDLKTGGSRLLAGGDPTFSDNLFKFGDHDGVGSEVLLQHPLGVLCAKDGQIYVADSYNHKIKKLDPATKRVTTLAGTG  844 (1057)
T ss_pred             EEEECCCCcEEEEEecccccCcccccccCCCCchhhhhccCCceeeEeCCCcEEEEECCCCEEEEEECCCCeEEEEeccC
Confidence            99999988888888888888888999999999888899999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCcccccccCCCceEEEccCCcEEEEECCCCEEEEEeCCCCCc-eEEEEeecccCCCCCCCCCcccccccCCCCC
Q 001380          878 KAGFKDGAALAAQLSEPAGIIEAQNGNLFIADTNNNIIRYLDLNKEEP-ELQTLELKGVQPPTPKSRSPKRLRRRSSPDA  956 (1089)
Q Consensus       878 ~~g~~~g~~~~~~l~~P~gi~vd~~G~lyVad~~n~~I~~~~~~~~~~-~~~~l~~~~~~~p~~~~~~~~~~~~~~~~~~  956 (1089)
                      ..|+.+|....++|++|.||+++++|+|||+|++||+|+++++.+... .+.++++.++++|.+..+.+.++.++++.++
T Consensus       845 ~~G~~dG~~~~a~l~~P~GIavd~dG~lyVaDt~Nn~Irvid~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  924 (1057)
T PLN02919        845 KAGFKDGKALKAQLSEPAGLALGENGRLFVADTNNSLIRYLDLNKGEAAEILTLELKGVQPPRPKSKSLKRLRRRSSADT  924 (1057)
T ss_pred             CcCCCCCcccccccCCceEEEEeCCCCEEEEECCCCEEEEEECCCCccceeEeeccccccCCCCcccchhhhhhcccccC
Confidence            999999988899999999999999999999999999999999988743 4678888999999987777788777777899


Q ss_pred             ceEEecCCCccceEEEEEEEcCCCcccCcCCCceeEEEecCCCeEEecCCCCccCCCCceEEEeeecCCCcceEEEEEEE
Q 001380          957 QTIVVDGGLSNEGNIYLKISLPEEYHFSKEARSKFSVDVEPENAVIIDPLDGNLSPEGSAVLHFRRMSPSVSTGRISCKV 1036 (1089)
Q Consensus       957 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1036 (1089)
                      .++.++++....+++++++.||+||||+++|+|||.++.+|.+.+.+.|.+|.++.+|+++++++|...+..+.+|+|++
T Consensus       925 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1004 (1057)
T PLN02919        925 QVIKVDGVTSLEGDLQLKISLPPGYHFSKEARSKFEVEVEPENAVDIDPDEGTLSPDGRASLHFKRSSASASTGRISCKV 1004 (1057)
T ss_pred             ceeecCCcccccceEEEEEECCCCCccCcCCCceeEEEeccCCceEecCCCceECCCCeEEEEEeeCCCccceeeEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999988888999999999


Q ss_pred             EeecCCCCccccceEEeeeeeeccCCCCCeeeeeeeeeccCCCCCCcccccCC
Q 001380         1037 YYCKEDEVCLYKPLLFEVPFQEEVPNSPPAEITLPYDLKPKILTNSLQLPVAP 1089 (1089)
Q Consensus      1037 ~~c~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1089 (1089)
                      |||++|++|+||++.|+|||+++...+.+++++|+|+|||+++++++|+++++
T Consensus      1005 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1057 (1057)
T PLN02919       1005 YYCKEDEVCLYQSLVFEVPFEEENGGESSSSITLKYTVKPKAPQPSLQLPITR 1057 (1057)
T ss_pred             EEecCCcEEEEEeEEEeeeeeeccCCCCCcceeEEEEeccCCCCccccccccC
Confidence            99999999999999999999976778999999999999999999999998875

>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>KOG0854 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1089
2hyx_A352 Structure Of The C-Terminal Domain Of Dipz From Myc 1e-15
3e58_A214 Crystal Structure Of Putative Beta-Phosphoglucomuta 8e-12
1te2_A226 Putative Phosphatase Ynic From Escherichia Coli K12 2e-09
4g9b_A243 Crystal Structure Of Beta-Phosphoglucomutase Homolo 8e-09
2l5o_A153 Solution Structure Of A Putative Thioredoxin From N 1e-08
3qyp_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 4e-08
3qub_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 4e-08
3quq_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 5e-08
3s6j_A233 The Crystal Structure Of A Hydrolase From Pseudomon 5e-08
3r9k_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 5e-08
1o03_A221 Structure Of Pentavalent Phosphorous Intermediate O 1e-07
3qu5_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 2e-07
3qut_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 2e-07
4ex6_A237 Crystal Structure Of The Alnumycin P Phosphatase Al 2e-07
3fm9_A221 Analysis Of The Structural Determinants Underlying 2e-07
4eek_A259 Crystal Structure Of Had Family Hydrolase Dr_1622 F 4e-07
3qu4_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 4e-07
4gib_A250 2.27 Angstrom Crystal Structure Of Beta-Phosphogluc 7e-07
1lvh_A221 The Structure Of Phosphorylated Beta-phosphoglucomu 9e-07
3c71_A143 Struture Of A Resa Variant With A Dsba-Like Active 1e-06
3c73_A140 Structure Of Cehc Variant Resa Length = 140 1e-06
2h1b_A143 Resa E80q Length = 143 2e-06
3nas_A233 The Crystal Structure Of Beta-Phosphoglucomutase Fr 2e-06
1st9_A143 Crystal Structure Of A Soluble Domain Of Resa In Th 2e-06
2b5x_A148 Solution Structure Of A Thioredoxin-Like Protein In 6e-06
3or5_A165 Crystal Structure Of Thiol:disulfide Interchange Pr 9e-06
2nyv_A222 X-Ray Crystal Structure Of A Phosphoglycolate Phosp 1e-05
3dv9_A247 Putative Beta-Phosphoglucomutase From Bacteroides V 2e-05
2h19_A143 Crystal Structure Of Resa Cys77ala Variant Length = 3e-05
2h1a_A143 Resa C74a Variant Length = 143 3e-05
2yy6_A213 Crystal Structure Of The Phosphoglycolate Phosphata 3e-05
3kbb_A216 Crystal Structure Of Putative Beta-Phosphoglucomuta 5e-05
2hi0_A240 Crystal Structure Of Putative Phosphoglycolate Phos 6e-05
1l0q_A391 Tandem Yvtn Beta-Propeller And Pkd Domains From An 6e-05
3hrp_A409 Crystal Structure Of Structural Genomics Protein Of 9e-05
4evm_A138 1.5 Angstrom Crystal Structure Of Soluble Domain Of 2e-04
2h1g_A143 Resa C74aC77A Length = 143 3e-04
3l5k_A250 The Crystal Structure Of Human Haloacid Dehalogenas 3e-04
2fdr_A229 Crystal Structure Of Conserved Haloacid Dehalogenas 3e-04
3kcm_A154 The Crystal Structure Of Thioredoxin Protein From G 5e-04
2f9s_A151 2nd Crystal Structure Of A Soluble Domain Of Resa I 7e-04
1jfu_A186 Crystal Structure Of The Soluble Domain Of Tlpa Fro 7e-04
>pdb|2HYX|A Chain A, Structure Of The C-Terminal Domain Of Dipz From Mycobacterium Tuberculosis Length = 352 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 74/174 (42%), Gaps = 4/174 (2%)
Query: 399 EQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNTA---PLQFRRDLKGKV 455
           EQ   G   + +  Q  N        ++    P+      WLNT    P+  +  L+GKV
Sbjct: 26  EQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLK-SLRGKV 84
Query: 456 VVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGI 515
           V++DFW Y CINC   +P +    + YKD    V+GVH+ ++  EK    +       GI
Sbjct: 85  VLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGI 144
Query: 516 SHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAAL 569
           S+P+  D +   W       WP   ++   G +     GEG     + LV   L
Sbjct: 145 SYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLL 198
>pdb|3E58|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Streptococcus Thermophilus Length = 214 Back     alignment and structure
>pdb|1TE2|A Chain A, Putative Phosphatase Ynic From Escherichia Coli K12 Length = 226 Back     alignment and structure
>pdb|4G9B|A Chain A, Crystal Structure Of Beta-Phosphoglucomutase Homolog From Escherichia Coli, Target Efi-501172, With Bound Mg, Open Lid Length = 243 Back     alignment and structure
>pdb|2L5O|A Chain A, Solution Structure Of A Putative Thioredoxin From Neisseria Meningitidis Length = 153 Back     alignment and structure
>pdb|3QYP|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asn Mutant Complexed With Calcium And Phosphate Length = 243 Back     alignment and structure
>pdb|3QUB|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47ala Mutant Complexed With Sulfate Length = 243 Back     alignment and structure
>pdb|3QUQ|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|3S6J|A Chain A, The Crystal Structure Of A Hydrolase From Pseudomonas Syringae Length = 233 Back     alignment and structure
>pdb|3R9K|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asp Mutant Complexed With Sulfate, A Closed Cap Conformation Length = 243 Back     alignment and structure
>pdb|1O03|A Chain A, Structure Of Pentavalent Phosphorous Intermediate Of An Enzyme Catalyzed Phosphoryl Transfer Reaction Observed On Cocrystallization With Glucose 6-Phosphate Length = 221 Back     alignment and structure
>pdb|3QU5|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp11asn Mutant Length = 243 Back     alignment and structure
>pdb|3QUT|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13asn Mutant, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|4EX6|A Chain A, Crystal Structure Of The Alnumycin P Phosphatase Alnb Length = 237 Back     alignment and structure
>pdb|3FM9|A Chain A, Analysis Of The Structural Determinants Underlying Discrimination Between Substrate And Solvent In Beta- Phosphoglucomutase Catalysis Length = 221 Back     alignment and structure
>pdb|4EEK|A Chain A, Crystal Structure Of Had Family Hydrolase Dr_1622 From Deinococcus Radiodurans R1 (Target Efi-501256) With Bound Phosphate And Sodium Length = 259 Back     alignment and structure
>pdb|3QU4|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13ala Mutant Length = 243 Back     alignment and structure
>pdb|4GIB|A Chain A, 2.27 Angstrom Crystal Structure Of Beta-Phosphoglucomutase (Pgmb) From Clostridium Difficile Length = 250 Back     alignment and structure
>pdb|1LVH|A Chain A, The Structure Of Phosphorylated Beta-phosphoglucomutase From Lactoccocus Lactis To 2.3 Angstrom Resolution Length = 221 Back     alignment and structure
>pdb|3C71|A Chain A, Struture Of A Resa Variant With A Dsba-Like Active Site Motif (Cphc) Length = 143 Back     alignment and structure
>pdb|3C73|A Chain A, Structure Of Cehc Variant Resa Length = 140 Back     alignment and structure
>pdb|2H1B|A Chain A, Resa E80q Length = 143 Back     alignment and structure
>pdb|3NAS|A Chain A, The Crystal Structure Of Beta-Phosphoglucomutase From Bacillus Subtilis Length = 233 Back     alignment and structure
>pdb|1ST9|A Chain A, Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 143 Back     alignment and structure
>pdb|2B5X|A Chain A, Solution Structure Of A Thioredoxin-Like Protein In The Reduced Form Length = 148 Back     alignment and structure
>pdb|3OR5|A Chain A, Crystal Structure Of Thiol:disulfide Interchange Protein, Thioredoxin Family Protein From Chlorobium Tepidum Tls Length = 165 Back     alignment and structure
>pdb|2NYV|A Chain A, X-Ray Crystal Structure Of A Phosphoglycolate Phosphatase From Aquifex Aeolicus Length = 222 Back     alignment and structure
>pdb|3DV9|A Chain A, Putative Beta-Phosphoglucomutase From Bacteroides Vulgatus Length = 247 Back     alignment and structure
>pdb|2H19|A Chain A, Crystal Structure Of Resa Cys77ala Variant Length = 143 Back     alignment and structure
>pdb|2H1A|A Chain A, Resa C74a Variant Length = 143 Back     alignment and structure
>pdb|2YY6|A Chain A, Crystal Structure Of The Phosphoglycolate Phosphatase From Aquifex Aeolicus Vf5 Length = 213 Back     alignment and structure
>pdb|3KBB|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Thermotoga Maritima Length = 216 Back     alignment and structure
>pdb|2HI0|A Chain A, Crystal Structure Of Putative Phosphoglycolate Phosphatase (Yp_619066.1) From Lactobacillus Delbrueckii Subsp. Bulgaricus Atcc Baa-365 At 1.51 A Resolution Length = 240 Back     alignment and structure
>pdb|1L0Q|A Chain A, Tandem Yvtn Beta-Propeller And Pkd Domains From An Archaeal Surface Layer Protein Length = 391 Back     alignment and structure
>pdb|3HRP|A Chain A, Crystal Structure Of Structural Genomics Protein Of Unknown Function (np_812590.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.70 A Resolution Length = 409 Back     alignment and structure
>pdb|4EVM|A Chain A, 1.5 Angstrom Crystal Structure Of Soluble Domain Of Membrane-Anchored Thioredoxin Family Protein From Streptococcus Pneumoniae Strain Canada Mdr_19a Length = 138 Back     alignment and structure
>pdb|2H1G|A Chain A, Resa C74aC77A Length = 143 Back     alignment and structure
>pdb|3L5K|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 1a (Hdhd1a) Length = 250 Back     alignment and structure
>pdb|2FDR|A Chain A, Crystal Structure Of Conserved Haloacid Dehalogenase-like Protein Of Unknown Function Atu0790 From Agrobacterium Tumefaciens Str. C58 Length = 229 Back     alignment and structure
>pdb|3KCM|A Chain A, The Crystal Structure Of Thioredoxin Protein From Geobacter Metallireducens Length = 154 Back     alignment and structure
>pdb|2F9S|A Chain A, 2nd Crystal Structure Of A Soluble Domain Of Resa In The Oxidised Form Length = 151 Back     alignment and structure
>pdb|1JFU|A Chain A, Crystal Structure Of The Soluble Domain Of Tlpa From Bradyrhizobium Japonicum Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1089
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 1e-70
1te2_A226 Putative phosphatase; structural genomics, phospha 2e-62
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 5e-62
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 1e-61
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 2e-61
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 4e-60
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 8e-59
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 6e-58
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 8e-22
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 4e-54
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 2e-52
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 2e-52
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 5e-52
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 3e-51
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 2e-50
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-26
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 8e-18
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 5e-17
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 2e-07
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 5e-49
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 2e-48
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 6e-47
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 3e-46
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 8e-46
3kya_A496 Putative phosphatase; structural genomics, joint c 2e-45
3kya_A496 Putative phosphatase; structural genomics, joint c 5e-32
3kya_A496 Putative phosphatase; structural genomics, joint c 2e-25
3kya_A496 Putative phosphatase; structural genomics, joint c 4e-11
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 7e-44
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 9e-29
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 8e-38
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 8e-37
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 1e-18
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 4e-11
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 2e-31
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 3e-31
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 4e-31
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 7e-31
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 2e-28
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 1e-15
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 4e-05
2l5o_A153 Putative thioredoxin; structural genomics, unknown 1e-30
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 3e-29
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 2e-27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-26
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-25
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-15
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-26
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 5e-24
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 5e-20
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 4e-26
3sd7_A240 Putative phosphatase; structural genomics, haloaci 4e-26
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 4e-26
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 5e-26
2zg6_A220 Putative uncharacterized protein ST2620, probable 9e-26
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 7e-25
4evm_A138 Thioredoxin family protein; structural genomics, n 2e-24
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 1e-23
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 2e-23
2hsz_A243 Novel predicted phosphatase; structural genomics, 3e-23
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 2e-22
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 4e-22
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 2e-21
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 4e-21
3raz_A151 Thioredoxin-related protein; structural genomics, 4e-21
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 4e-21
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 6e-21
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 7e-21
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 8e-21
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 2e-20
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 2e-20
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 5e-20
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-15
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-14
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 8e-20
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 1e-19
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 2e-19
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 3e-19
2lrn_A152 Thiol:disulfide interchange protein; structural ge 2e-18
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 2e-18
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 6e-18
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 7e-18
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 2e-17
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 2e-17
2ls5_A159 Uncharacterized protein; structural genomics, unkn 3e-17
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 5e-17
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 6e-17
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 1e-16
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 2e-16
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 2e-16
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 2e-16
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 3e-16
2lrt_A152 Uncharacterized protein; structural genomics, thio 4e-16
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 4e-16
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-16
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-14
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 3e-13
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-08
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 2e-04
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 5e-16
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 9e-16
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 1e-15
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 3e-15
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 9e-15
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 3e-13
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-12
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-11
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 4e-15
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 3e-14
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 1e-13
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-05
2p11_A231 Hypothetical protein; putative haloacid dehalogena 6e-14
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 6e-14
3ib6_A189 Uncharacterized protein; structural genomics, unkn 1e-13
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 2e-13
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 2e-13
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 3e-13
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 7e-11
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 8e-07
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 3e-13
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 1e-12
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 9e-13
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 1e-12
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 3e-12
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 5e-12
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 2e-09
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 1e-05
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 1e-11
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 2e-11
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 9e-10
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 1e-05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 3e-05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 3e-04
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 2e-11
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 4e-11
2fp8_A322 Strictosidine synthase; six bladed beta propeller 8e-11
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 2e-10
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 4e-10
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 2e-09
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 3e-09
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 1e-08
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-08
3v65_B386 Low-density lipoprotein receptor-related protein; 9e-06
3v65_B386 Low-density lipoprotein receptor-related protein; 3e-05
2qe8_A343 Uncharacterized protein; structural genomics, join 2e-08
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 2e-08
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 3e-08
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 2e-06
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 3e-05
3p5b_L400 Low density lipoprotein receptor variant; B-propel 6e-08
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-06
3p5b_L400 Low density lipoprotein receptor variant; B-propel 7e-06
2l57_A126 Uncharacterized protein; structural genomics, unkn 7e-08
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 3e-07
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 3e-06
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 4e-07
2p4o_A306 Hypothetical protein; putative lactonase, structur 1e-06
2p4o_A306 Hypothetical protein; putative lactonase, structur 3e-04
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 1e-06
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 3e-06
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 3e-06
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 6e-06
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 3e-05
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 6e-06
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-05
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-04
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 4e-05
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-04
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 5e-05
2o2x_A218 Hypothetical protein; structural genomics, joint c 7e-05
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 9e-05
2kuc_A130 Putative disulphide-isomerase; structural genomics 9e-05
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 2e-04
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 2e-04
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 3e-04
3f9u_A172 Putative exported cytochrome C biogenesis-related; 3e-04
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 4e-04
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 4e-04
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 5e-04
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 5e-04
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 8e-04
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 8e-04
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 8e-04
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 Back     alignment and structure
 Score =  239 bits (610), Expect = 1e-70
 Identities = 72/333 (21%), Positives = 115/333 (34%), Gaps = 45/333 (13%)

Query: 399 EQTEGGSSQSERIQQFVNYISDVENRKTTPIVPEFPAKLDWLNT---APLQFRRDLKGKV 455
           EQ   G   + +  Q  N        ++    P+      WLNT    P+  +  L+GKV
Sbjct: 26  EQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLK-SLRGKV 84

Query: 456 VVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTVVGVHSAKFDNEKDLEAIRNAVLRYGI 515
           V++DFW Y CINC   +P +    + YKD    V+GVH+ ++  EK    +       GI
Sbjct: 85  VLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGI 144

Query: 516 SHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLLAQLAGEGHRKDLDDLVEAALLFYGKK 575
           S+P+  D +   W       WP   ++   G +     GEG     + LV   L      
Sbjct: 145 SYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPG 204

Query: 576 KLLDNTPLPLSLEKDNDPRLFTSPLKFPGKLAIDILNNRLFISDSNHNRIVVTDLDGNFI 635
             L       +   D  PR   +P  + G                   ++V         
Sbjct: 205 VKLPQPSSTTT--PDLTPRAALTPETYFG-----------------VGKVV--------- 236

Query: 636 VQIGSSGEEGLRDGSFDDATFNRPQGLAYNA-------KKNLLYVADTENHALREIDFVN 688
                 G     +GS   A F+ P  LA N+         +        N A  ++++  
Sbjct: 237 ---NYGGGGAYDEGS---AVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHA 290

Query: 689 DTVRTLAGNGTKGSDYQGGEKGTSQLLNSPWDV 721
             V  + G     +  + G+  T  +   P   
Sbjct: 291 KDVYIVVGGTGTLTVVRDGKPATLPISGPPTTH 323
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Length = 164 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Length = 151 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Length = 154 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Length = 165 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Length = 143 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Length = 183 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Length = 150 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Length = 154 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Length = 144 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Length = 240 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Length = 144 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Length = 143 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Length = 165 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Length = 296 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Length = 355 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Length = 187 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Length = 255 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Length = 255 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Length = 201 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Length = 328 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Length = 305 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Length = 314 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1089
3kya_A496 Putative phosphatase; structural genomics, joint c 99.97
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.97
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.97
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.96
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.95
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.95
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.95
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.94
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.93
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.93
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.93
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.93
3kya_A496 Putative phosphatase; structural genomics, joint c 99.93
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.92
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.92
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.92
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.92
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.92
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.92
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.92
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.92
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.91
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.91
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.91
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.91
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.91
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.91
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.91
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.91
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.91
3v65_B386 Low-density lipoprotein receptor-related protein; 99.91
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.91
3v65_B386 Low-density lipoprotein receptor-related protein; 99.91
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.91
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 99.91
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.9
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.9
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.9
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.9
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.9
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.9
1te2_A226 Putative phosphatase; structural genomics, phospha 99.9
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.9
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.89
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.89
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.89
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.89
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.89
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.89
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.89
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.89
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.89
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.89
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.88
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.88
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.88
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.88
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.88
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.88
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.88
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.88
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.88
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.88
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.87
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.87
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.87
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.87
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.87
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.87
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.87
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.87
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.87
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.87
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.87
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.87
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.87
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.87
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.86
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.86
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.86
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.86
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.86
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.86
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.86
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.86
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.86
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.86
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.86
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.86
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 99.86
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.86
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.86
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.85
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.85
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 99.85
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.85
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.85
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.85
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.85
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.85
3raz_A151 Thioredoxin-related protein; structural genomics, 99.85
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.85
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.85
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.85
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.85
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.85
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.85
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.85
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.85
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.84
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.84
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.84
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 99.84
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.84
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.84
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.84
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.84
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.84
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.84
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.84
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.84
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.84
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.84
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.84
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.84
4evm_A138 Thioredoxin family protein; structural genomics, n 99.84
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.84
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.83
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.83
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.83
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.83
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.83
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.83
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.83
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.83
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.83
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.82
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.82
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.82
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.82
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.82
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.82
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.82
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.82
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.82
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.82
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.82
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.82
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.82
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.82
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.82
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.82
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.82
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.82
2qe8_A343 Uncharacterized protein; structural genomics, join 99.82
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.81
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.81
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.81
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.81
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.81
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.81
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.81
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.81
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.81
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.81
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.81
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.81
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.81
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.81
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.81
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.8
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.8
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.8
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.8
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.8
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.8
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.8
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.8
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.8
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.8
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.8
2ls5_A159 Uncharacterized protein; structural genomics, unkn 99.67
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.79
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.79
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.79
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.79
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 99.78
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.78
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.78
3me7_A170 Putative uncharacterized protein; electron transfe 99.78
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.77
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.77
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.77
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.77
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.77
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.77
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.76
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.76
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.76
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.76
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.76
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.75
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 99.75
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.75
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.75
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.75
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.74
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.73
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.73
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.73
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.73
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.73
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.73
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.72
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.72
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.71
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.71
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.71
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.71
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.71
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.71
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.7
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.7
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 99.52
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.69
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 99.69
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.69
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.68
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.68
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.68
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.68
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.67
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.66
2qe8_A343 Uncharacterized protein; structural genomics, join 99.66
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.66
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.65
3fvv_A232 Uncharacterized protein; unknown function, structu 99.65
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.64
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.64
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.64
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.64
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.63
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.63
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.63
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.62
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.62
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.62
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.62
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.61
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.6
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.6
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.59
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.58
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.58
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.58
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.57
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.57
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.57
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.57
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.57
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.56
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.56
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.55
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.55
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.55
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.31
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.54
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.53
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.53
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.53
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.52
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.52
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.52
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.52
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.51
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.51
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.5
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.5
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.5
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.5
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.5
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.5
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.5
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.5
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.49
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.49
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.49
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.49
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.49
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.49
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.48
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.48
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.48
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.47
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.47
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.47
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.47
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.46
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.46
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.44
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.44
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.43
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.43
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.43
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.43
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.42
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.41
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.41
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.41
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.4
2qsi_A137 Putative hydrogenase expression/formation protein; 99.4
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.4
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.39
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.39
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.39
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.39
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.39
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.39
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 99.38
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.38
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.38
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.38
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.37
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.37
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.37
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.37
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.37
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.36
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.36
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.36
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.36
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.36
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.36
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.36
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.36
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.36
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.35
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.35
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.35
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.35
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.34
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.34
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.34
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.34
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.34
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.34
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.33
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.33
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.33
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.33
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.33
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.33
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.32
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.32
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.32
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.32
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.32
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.31
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.31
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.31
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.31
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.31
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.3
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.3
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.3
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.3
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.29
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.29
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.28
2ece_A462 462AA long hypothetical selenium-binding protein; 99.28
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.28
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.28
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.28
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.28
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.28
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.28
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.28
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.27
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.27
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.27
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.27
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.27
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.26
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.26
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.26
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.26
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.26
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.26
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.25
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.25
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.25
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.25
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.25
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.24
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.24
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.23
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.23
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.23
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.22
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.22
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 98.86
2ece_A462 462AA long hypothetical selenium-binding protein; 99.22
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.22
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.21
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.2
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.2
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.19
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.19
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.18
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.18
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.18
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.18
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.17
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.17
1mek_A120 Protein disulfide isomerase; electron transport, r 99.16
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.15
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 99.14
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.14
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.13
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.13
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.12
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.12
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.11
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.11
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.09
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.09
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 98.68
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.08
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 99.08
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.08
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.07
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.06
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.04
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.04
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.04
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.04
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.03
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.03
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.02
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.02
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.02
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.01
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.0
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.99
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.98
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.97
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.96
3t58_A519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.96
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.96
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.94
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.94
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.94
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.93
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.93
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.93
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.92
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.91
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.89
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.87
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.87
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.86
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.86
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.86
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 98.84
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.84
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.84
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.83
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.81
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.81
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 98.8
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.78
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.78
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.77
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.76
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.76
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.76
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.75
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.75
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.75
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.75
3qcp_A470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 98.74
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.74
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 98.73
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.73
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.73
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.73
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.72
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.71
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.97  E-value=2.7e-30  Score=301.67  Aligned_cols=278  Identities=21%  Similarity=0.292  Sum_probs=224.2

Q ss_pred             CCCCCCCceEEEee-cCCeEEEEeCCCCEEEEEeCCCCEEEEEecCCCCCCCCCCCCccccCCcceeEE-------eeCC
Q 001380          597 TSPLKFPGKLAIDI-LNNRLFISDSNHNRIVVTDLDGNFIVQIGSSGEEGLRDGSFDDATFNRPQGLAY-------NAKK  668 (1089)
Q Consensus       597 ~~~l~~P~~vavd~-~~g~L~vsd~~~~~I~~~~~~g~~~~~i~~~g~~g~~dG~~~~~~f~~P~gla~-------d~~g  668 (1089)
                      ...|..|.+|++|| .+++|||++..+++|.++|+.++.+.++...+.          ..|++|.+|++       +++|
T Consensus       135 ~~~~~~p~~la~dp~~~~~Lyv~~~~~~~i~~ID~~~~~v~~l~~~~~----------~~~~~p~~ia~~~~~~~~d~~G  204 (496)
T 3kya_A          135 CCGFSDNGRLAFDPLNKDHLYICYDGHKAIQLIDLKNRMLSSPLNINT----------IPTNRIRSIAFNKKIEGYADEA  204 (496)
T ss_dssp             CBCCCSEEEEEEETTEEEEEEEEEETEEEEEEEETTTTEEEEEECCTT----------SSCSBEEEEEECCCBTTTBCTT
T ss_pred             ccccCCCCEEEEccCCCCEEEEEECCCCeEEEEECCCCEEEEEEccCc----------cccCCCcEEEEeecccccCCCC
Confidence            45688999999998 479999999999999999999888877765432          13779999999       9999


Q ss_pred             CEEEEEECCC------CEEEEEECCC-CeE------EEEecCCCCCCCCCCCCcccccccCCceeEEEecCCCEEEEEEC
Q 001380          669 NLLYVADTEN------HALREIDFVN-DTV------RTLAGNGTKGSDYQGGEKGTSQLLNSPWDVCYKPINEKVYIAMA  735 (1089)
Q Consensus       669 ~~lyVaD~~n------~~I~~~d~~~-g~v------~~~ag~g~~~~~~~~~~~~~~~~l~~P~~la~~~~g~~lyvad~  735 (1089)
                      +.|||+|..+      +.|..++... |.+      .+++                  .+..|++++++|+++.||+++.
T Consensus       205 ~~lyvad~~~~~~~~~~~V~~i~r~~~G~~~~~~~~~~v~------------------~~~~p~giavdp~~g~LYvtd~  266 (496)
T 3kya_A          205 EYMIVAIDYDGKGDESPSVYIIKRNADGTFDDRSDIQLIA------------------AYKQCNGATIHPINGELYFNSY  266 (496)
T ss_dssp             CEEEEEECCCTTGGGEEEEEEEECCTTSCCSTTSCEEEEE------------------EESCCCCEEECTTTCCEEEEET
T ss_pred             CEEEEEeCCCCCcccCceEEEEecCCCCceeecccceeec------------------cCCCceEEEEcCCCCeEEEEEC
Confidence            9999999876      4577886543 221      1221                  2458999999998889999999


Q ss_pred             CCcEEEEEECC-------CCeE------------EEEeCCCccccCCCCCCCCccccCCceEEEcCCCCEEEEEeCCCCe
Q 001380          736 GQHQIWEHSTV-------DGVT------------RAFSGDGYERNLNGSSSLNTSFAQPSGISLSPDFMEIYVADSESSS  796 (1089)
Q Consensus       736 ~~~~I~~~~~~-------~g~~------------~~~~g~g~~~~~~g~~~~~~~~~~P~glav~~~g~~lyvad~~~~~  796 (1089)
                      ++++|+++|+.       ++.+            ..+...             ..-.+|.+|+++++|+.|||+|+.+++
T Consensus       267 ~~g~V~r~d~~~~~~~~~tg~~~tp~~~~~~g~~~~l~~~-------------~~~~~p~~ia~~p~G~~lYvaD~~~h~  333 (496)
T 3kya_A          267 EKGQVFRLDLVDYFKTIKNGGSWDPIVKNNPNTFKQLFTI-------------ADPSWEFQIFIHPTGKYAYFGVINNHY  333 (496)
T ss_dssp             TTTEEEEECHHHHHHHHHTTCCCCCBGGGCTTTEEEEEEC-------------SSSSCCEEEEECTTSSEEEEEETTTTE
T ss_pred             CCCEEEEEecccccccccCceeecccccccccccceeEec-------------CCCCCceEEEEcCCCCEEEEEeCCCCE
Confidence            99999999987       5554            111100             112468999999999889999999999


Q ss_pred             EEEEEcCCCC--e---EEEecCCCCCCCCccccCCCCCccccccccCce-EEEEc-------cCCcEEEEeCCCCEEEEE
Q 001380          797 IRALNLKTGG--S---RLLAGGDPIFPDNLFKFGDRDGMGSEVLLQHPL-GVYCA-------KNGQIYVADSYNHKIKKL  863 (1089)
Q Consensus       797 I~~~~~~~~~--~---~~~~g~~~~~~~~l~~~g~~dg~~~~~~l~~P~-gva~~-------~~G~lyVaD~~n~~I~~~  863 (1089)
                      |++++.++..  +   .+++|..       -..|..||.+..++|++|. +++++       .+|+|||||+.||+|++|
T Consensus       334 I~kid~dg~~~~~~~~~~~aG~~-------g~~G~~DG~~~~a~f~~P~~gv~vd~~~~~~~~~g~lyVaD~~N~rIr~i  406 (496)
T 3kya_A          334 FMRSDYDEIKKEFITPYNFVGGY-------KQSGYRDDVGTEARMNNPCQGVFVKNPDYTGEEEYDFYFVDRLNFCVRKV  406 (496)
T ss_dssp             EEEEEEETTTTEECCCEEEEEBT-------TBCCCBCCBGGGCBCSSEEEEEEEECTTCCSSCCEEEEEEEGGGTEEEEE
T ss_pred             EEEEecCCCcceecccEEecCCC-------CCCcccCCcccccccCCCeEEEEEccccccccCCCeEEEEECCCCEEEEE
Confidence            9998876432  2   4566631       1235568899999999999 88887       678999999999999999


Q ss_pred             eCCCCeEEEEeccCCC---------CCCCC-cccccccCCCceEEEccC-CcEEEEECCCCEEEEEeCCCC
Q 001380          864 DPASNRVSTLAGIGKA---------GFKDG-AALAAQLSEPAGIIEAQN-GNLFIADTNNNIIRYLDLNKE  923 (1089)
Q Consensus       864 d~~~~~v~t~~g~g~~---------g~~~g-~~~~~~l~~P~gi~vd~~-G~lyVad~~n~~I~~~~~~~~  923 (1089)
                      +++ |.++|++|.|..         |+.+| .+..++|+.|.||++|++ |+|||+|+.||||+++++++.
T Consensus       407 ~~~-G~v~TiaG~g~~~~~~~~~~~G~~dG~~~~~a~f~~P~gIavd~~~g~lyVaD~~N~rIrki~~~~~  476 (496)
T 3kya_A          407 TPE-GIVSTYAGRGASTSLADGNQWGTDDGDLREVARFRDVSGLVYDDVKEMFYVHDQVGHTIRTISMEQE  476 (496)
T ss_dssp             CTT-CBEEEEEESCTTHHHHHSCSCCCCCEETTTTCCCSSEEEEEEETTTTEEEEEETTTTEEEEEEECCC
T ss_pred             eCC-CCEEEEecccccccccCccccccCCCCchhhhhcCCCcEEEEECCCCEEEEEeCCCCEEEEEECCCC
Confidence            975 699999998763         67777 688999999999999996 999999999999999999987
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1089
d2b5xa1143 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase 3e-22
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 2e-21
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 2e-20
d2b0ca1197 c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc 7e-20
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 2e-19
d1zd3a1225 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal 4e-18
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 6e-18
d2fy6a1143 c.47.1.10 (A:33-175) Peptide methionine sulfoxide 1e-17
d1o08a_221 c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu 6e-17
d2fdra1222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 8e-17
d2hcfa1228 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {C 1e-16
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 5e-16
d2hsza1224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 9e-16
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 1e-15
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 2e-09
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 2e-06
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 0.001
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 2e-15
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 9e-15
d1zrna_220 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse 1e-13
d1u7pa_164 c.108.1.17 (A:) Magnesium-dependent phosphatase-1, 4e-13
d1z6na1166 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps 1e-12
d1i5ga_144 c.47.1.10 (A:) Tryparedoxin II {Crithidia fascicul 1e-12
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 2e-12
d2g80a1225 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast 2e-12
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 2e-12
d1z5ye1136 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG 1e-11
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 2e-11
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 4e-10
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 9e-10
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-11
d2ah5a1210 c.108.1.6 (A:1-210) predicted phosphatase SP0104 { 2e-11
d1lu4a_134 c.47.1.10 (A:) Soluble secreted antigen MPT53 {Myc 8e-11
d1zzoa1134 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacteri 5e-10
d1knga_144 c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY 2e-09
d2gfha1247 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas 4e-09
d1o73a_144 c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei 5e-09
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 7e-09
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 7e-08
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 2e-05
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 4e-07
d1v04a_340 b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PO 6e-07
d1x42a1230 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A 1e-06
d1st9a_137 c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA 1e-06
d1jfua_176 c.47.1.10 (A:) Membrane-anchored thioredoxin-like 2e-06
d1o8xa_144 c.47.1.10 (A:) Tryparedoxin I {Crithidia fascicula 2e-06
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 6e-06
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 0.002
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-05
d2cvba1187 c.47.1.10 (A:2-188) Probable thiol-disulfide isome 5e-05
d1j97a_210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 7e-05
d2b7ka1169 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco 9e-05
d1xwaa_111 c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m 9e-05
d1uula_194 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 1e-04
d1wvia_253 c.108.1.14 (A:) Putative phosphatase SMU.1415c {St 1e-04
d1nnla_217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 1e-04
d1wp0a1160 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco 2e-04
d2c4na1250 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId 2e-04
d1pjxa_314 b.68.6.1 (A:) Diisopropylfluorophosphatase (phosph 3e-04
d2fwha1117 c.47.1.1 (A:428-544) Thiol:disulfide interchange p 3e-04
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 4e-04
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 5e-04
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 5e-04
d1syra_103 c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas 6e-04
d1e2ya_167 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 8e-04
d1xzoa1172 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 0.002
d2ifqa1105 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien 0.004
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 0.004
d2fpwa1161 c.108.1.19 (A:3-163) Histidine biosynthesis bifunc 0.004
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: thiol:disulfide oxidoreductase YkuV
species: Bacillus subtilis [TaxId: 1423]

 Score = 91.9 bits (227), Expect = 3e-22
 Identities = 33/138 (23%), Positives = 55/138 (39%), Gaps = 2/138 (1%)

Query: 430 VPEFPAKLDWLNTAPLQFRRDLKGKVVVLDFWTYCCINCMHVLPDLEFLEKKYKDMPFTV 489
           +PE   +  WLN    +  + +  K  ++ FW+  C  C   +P +     KY+D    V
Sbjct: 7   MPELTGEKAWLNGEVTR-EQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVV 65

Query: 490 VGVHSAKFDNEKDLEAIRNAVLRYGISHPVVNDGDMNLWRELGVNSWPTFAVVGPNGKLL 549
             VH  + +++ D   I+     + I+ P+  D D  L         P + V    G+L 
Sbjct: 66  A-VHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLR 124

Query: 550 AQLAGEGHRKDLDDLVEA 567
              AG    K L+  V  
Sbjct: 125 HFQAGGSGMKMLEKRVNR 142
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Length = 228 Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Length = 144 Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Length = 144 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 340 Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Length = 176 Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Length = 144 Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Length = 187 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Length = 169 Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Length = 314 Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Length = 167 Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Length = 172 Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1089
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.96
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.95
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.94
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.93
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.93
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.93
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.93
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.92
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.92
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.92
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.91
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.91
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.9
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.9
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.9
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.9
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.88
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.88
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.88
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.87
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.87
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.86
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.86
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.85
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.85
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.85
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.85
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.85
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.84
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.83
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.83
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.81
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.81
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.81
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.8
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.8
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.8
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.8
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.8
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.79
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.79
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.77
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.77
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.76
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.76
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.75
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.75
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.74
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.73
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.73
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.72
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.72
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.71
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.69
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.69
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.68
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.67
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.66
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.65
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.65
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.65
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.65
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.65
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.63
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.63
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.63
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.62
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.62
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.61
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.61
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.6
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.58
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.57
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.57
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.54
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.53
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.51
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.47
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.47
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.47
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.44
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.44
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.43
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.43
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.42
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.42
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.41
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.39
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.37
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.37
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.36
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.36
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.36
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.36
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.34
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.34
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.31
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.3
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.29
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.27
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.26
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.26
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.25
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.24
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.2
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.17
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.16
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.16
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.16
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.15
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.14
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.14
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.12
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.12
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.12
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.12
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.11
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.11
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.06
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.03
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.01
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.01
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.96
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.96
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.93
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.92
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 98.91
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.88
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.88
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.87
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.8
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 98.8
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.8
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.79
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 98.78
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.77
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.75
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 98.74
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.74
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.72
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.71
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.69
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.68
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.63
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.6
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.59
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.58
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.58
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.57
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 98.55
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.53
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.51
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.41
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.4
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.39
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.38
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.37
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.32
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.3
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.3
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.28
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.28
d1wjka_100 Thioredoxin-like structure containing protein C330 98.26
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.24
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.24
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.2
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 98.18
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.16
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.14
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.11
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 98.09
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.08
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.08
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.04
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 97.85
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 97.85
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.79
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.73
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.63
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 97.59
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 97.57
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.55
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.51
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.4
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 97.39
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.38
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 97.34
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 97.32
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.23
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.22
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 97.21
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 97.13
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.11
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.02
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.86
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 96.79
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.78
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 96.74
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.66
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.61
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 96.52
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 96.46
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.46
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.24
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.17
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 96.08
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.05
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.79
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 95.48
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.27
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.24
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.03
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.88
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.86
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 94.4
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 93.88
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 93.37
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 93.11
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 92.98
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 91.68
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.56
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 90.7
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.26
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 89.86
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 89.71
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 89.58
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 88.43
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.34
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 87.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 87.7
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 85.92
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 84.38
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 82.85
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 81.45
d2axoa1225 Hypothetical protein Atu2684 {Agrobacterium tumefa 81.21
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 80.31
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.12
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=3.4e-28  Score=256.26  Aligned_cols=216  Identities=26%  Similarity=0.401  Sum_probs=186.5

Q ss_pred             CCceEEEEecCCcccCCchHHHHHHHHHHHHcCCCCCHH-hHhhhcCCCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHH
Q 001380           77 GKVSAVLFDMDGVLCNSEEPSRRAAVDVFAEMGVEVTVE-DFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRFFEIYL  155 (1089)
Q Consensus        77 ~~~k~ViFD~DGTL~d~~~~~~~a~~~~~~~~g~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (1089)
                      ++|++||||+||||+|+.+.+..++.++++++|++++.+ ++..+.+..........................++.+.+.
T Consensus         1 ~~i~a~iFD~DGTL~dt~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (218)
T d1te2a_           1 RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAI   80 (218)
T ss_dssp             CCCCEEEECCBTTTBCCHHHHHHHHHHHHHHTTCCGGGGGGSCCCTTCCHHHHHHHHHHHSCCSSSCHHHHHHHHHHHHH
T ss_pred             CcceEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHhCCCccchhhhhhhcccccchhHHHHHHHHHHHHH
Confidence            368999999999999999999999999999999987654 5566677777766666666555555566666666666666


Q ss_pred             HHhcCCCCCCCCccHHHHHHHHHhCCCeEEEEcCCChHhHHHHHHHCCCCCCCccEEEEcCCccCCCCCHHHHHHHHHHc
Q 001380          156 DKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFDAIVSADAFENLKPAPDIFLSASKIL  235 (1089)
Q Consensus       156 ~~~~~~~~~~~~pG~~~lL~~Lk~~Gi~vaIvSn~~~~~~~~~l~~~gl~~~~fd~i~~~~~~~~~KP~~~~~~~~l~~l  235 (1089)
                      +.+....  .++||+.++|+.|+++|++++|+||+.+..++..++.+|+. .+|+.++++++++..||+|++|+.+++++
T Consensus        81 ~~~~~~~--~~~pg~~~~l~~L~~~g~~~~i~T~~~~~~~~~~l~~~~l~-~~F~~i~~~~~~~~~Kp~~~~~~~~~~~l  157 (218)
T d1te2a_          81 SLVEETR--PLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLR-DSFDALASAEKLPYSKPHPQVYLDCAAKL  157 (218)
T ss_dssp             HHHHHHC--CBCTTHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHHTTCG-GGCSEEEECTTSSCCTTSTHHHHHHHHHH
T ss_pred             Hhhhccc--cccchHHHHHHHhhhcccccccccccccccccccccccccc-ccccccccccccccchhhHHHHHHHHHHc
Confidence            5554433  67999999999999999999999999999999999999996 99999999999999999999999999999


Q ss_pred             CCCCCcEEEEcCChhhHHHHHHcCCeEEEEcCCCCHHHHhhcCCcEEecCcccCCHHHHH
Q 001380          236 NVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLSEERLKEASPSLIRKEIGSVSLNDIL  295 (1089)
Q Consensus       236 gv~p~~~v~VGD~~~Di~aA~~aG~~~i~V~~g~~~~~l~~~~~d~vi~dl~el~i~~ll  295 (1089)
                      |++|++|+||||+.+|+.+|+++||.+|+|..+....+.....|+++++++.||++.+||
T Consensus       158 ~~~~~~~l~igD~~~di~aA~~~G~~~i~v~~~~~~~~~~~~~a~~~i~~l~el~~~~l~  217 (218)
T d1te2a_         158 GVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLL  217 (218)
T ss_dssp             TSCGGGEEEEESSHHHHHHHHHTTCEEEECCCTTTTTCGGGGGSSEECSCGGGCCHHHHH
T ss_pred             CCCchhcEEEeeCHHHHHHHHHcCCEEEEECCCCCccchhhcCCCEEECChhhCCHhhcC
Confidence            999999999999999999999999999999887654555557899999999999888886
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure