Citrus Sinensis ID: 001416

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080-
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
ccEEcccccccccEEEEEEcccccEEEEEcccccEEEcccccccEEEEEEccccccEEEEEEcccEEEEEEEcccccccEEEEcccEEEEEEEcccEEEEEcccccccccccccccEEccccEEccccccccccEEEEEEcccEEEEEEEccccccccEEEEcccccEEEEEccccccccccEEEEEEccccEEEEEccccEEEEEccccccccEEEEEEEEccccccEEEEEcccccEEEEEccccccccccccccccccccccEEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccccEEEEEEEEccccccccEEEEEEcccEEEEEcccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEccEEEEEEEccccccccccccccccccccEEEEEEcccEEEEEEEccccccccccccccEEEcccccccccccHHccccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEcccccEEEEEccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEcccccccEEEEcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEcccccEEEEEEEEEEEEEEccccEEEEcccccccccccEEEEEEEEEEccccEEEEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEcccccccccccEEEEEEEccEEEEEEcccEEEEEcccccccEEEHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHccccHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccEEEcccccc
ccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccHHHHHcccccHHHccccHcccccccccccccccccccEEEEEEccEEEEEEEHHHcHcccccHHHcccccEEHHHHcccccccccEEEEEccccEEEEEEccccEEEEEccccccccEEEEHEHHcccccEEEEEcccccEEEEEEcccccccHHHcccEEEEcccccEEEEEEEEccccccEEEEEccccEEEEEEcccHHHHHHccccccHHHHcHHHcccccccccHEEEEcccccEEEEEccccccccccHHHHHccccHHHHccccccEEEEEEEccccccEEEEEEccEEEEEEccccccccccccccccccccccEEEEEEccccccccEcccccccccccccccccccccccccccccEEccccEEEEcccccccccEEEEcccccEEEEEEccccEEEEEEEcccEEEccccccEEEEcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEccccccHHHEEEcccccccEEEEcccHHEEEEEEcccccccccHHHHHcccccccccccccccccccEccccccccccccccccccEEEEEcccccccccccccccEEEEccccEEEEEEEccEEEEEEcccHHHEEcccccccccHHHHHccEEEEEccccEEEEEEEccccEEEHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHcccccccEEEEEEHccccccccccEEEccccccccccccccHHHHHHccccEEEEccccEEEEEccccHccccccccEEEEEccccEEEEEEHccccHEEcccccccEHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHcccc
mlrlkafrptndkivkiqlhpthpwlvtadasdhvsVWNWEHRQVIYELkaggvdqrRLVGAKLEKLAegelehkgkpteamrggsvkqvnfyddDVRFWQLWRNRAaaaeaptavsnvtsgfaspppstkgrhfLVICCVNKAIFLDLVTmrgrdipkqeldnkslvCMEFlsrsavgdvplvafgssdGVIRVLSMISWKLVRRytgghkgsISCLMTFMASSGEALLVSGGSDGLLILWSAdhgqdsrelvpklslkahdggVVAVELSrvmggspqlitigadktLAIWDTVsfkelrrikpvpklachsvaswchprapnldiltcvkdshiwaiehptysaltrplcelsslvppqvlahhKKLRVYCMVAHSLQPHLVATGTNVGVIisefdprslpavaplptpsgsrdhsaVYIVERELKLVNFQlssaanpslgnngslsetgrlkgdlpdALQIKQIKkhistpvphdsysilsvsssgkylavvwpdipyfsvykvsdwsivdsgsarlLAWDTCRDRFAILEsaltprlpiipkggssRKAKEAAAAAAAAQAAAASAASSATVQARILlddgtsnilmrsiggssepviglhgGALLGVAYrtsrrispiaaTAIStiqsmplsgfgssglssfttfddgfssqkspaeaapqnfqlyswetfqpvggllpqpewtawdqTVEYCAFAYQHYIVISSLcpqyrylgdvaipyatgavwhrrqlfvvtptTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQdriklrppmLQVVRLASfqhaasvppfltmpkqtkvegddsmmpkdiEERKVNEIAVGGGGVAVAVtrfpteqkrpigplvvvGVKDGVLWLIDRYMCAHalslshpgircrcLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMgyatealhlpgisKRLEFDLAMQSNDLKRALQCLITmsnsrdigqdhpgldlndilTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
mlrlkafrptndkivkiqLHPTHPWLVTADASDHVSVWNWEHRQVIYElkaggvdqrRLVGAKLEKlaegelehkgkpteamrggsvkqvNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSrsavgdvplvafGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELsrvmggspqlitigadktlAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVaplptpsgsrdHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKkhistpvphdSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAIlesaltprlpiipKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFqhaasvppfltmpkqtkvegddsmMPKDIEERKVNEIAVGGGGVAVAVTrfpteqkrpigplvvvGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNsrdigqdhpGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRlanhgeltrlsvrfgn
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVgakleklaegelehkgkPTEAMRGGSVKQVNFYDDDVRFWQLWRNRaaaaeaptaVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEaaaaaaaaqaaaasaassaTVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTsrrispiaataistiQSMPlsgfgssglssfttfddgfssQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVetmkmkeemklkeVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIavggggvavavTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
**********NDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKL**********************VKQVNFYDDDVRFWQLWRNRAAAA*********************GRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDP*******************AVYIVERELKLVNFQL*****************************IKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPII********************************QARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQS*********************************NFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETM******************HGELALIAV**********IKLRPPMLQVVRLASFQHAA*****************************VNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELT********
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP****AHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTP*GSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESAL************************AAQ**AASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISP*********************************************FQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVE**********************ELALIAVE***************MLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRF**
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVS*************KGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKG****************************VQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDD***********APQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGE*******T**MRGGSVKQVNFYDDDVRFWQLWRNRAA**E*******************KGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKG************************SSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQ*********************FSS*******APQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMK***********HGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQ******DSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1081 2.2.26 [Sep-21-2011]
Q8C092801 Transcription initiation yes no 0.097 0.131 0.338 3e-05
Q15542800 Transcription initiation yes no 0.097 0.131 0.330 5e-05
Q54S79942 WD repeat-containing prot no no 0.113 0.130 0.319 0.0001
Q68FJ6363 p21-activated protein kin N/A no 0.091 0.272 0.321 0.0002
Q5BDJ5446 Probable cytosolic iron-s no no 0.063 0.154 0.366 0.0005
Q6TNS2368 p21-activated protein kin no no 0.092 0.271 0.298 0.0005
Q9NWT1392 p21-activated protein kin no no 0.092 0.255 0.298 0.0007
>sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=2 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 63/121 (52%), Gaps = 16/121 (13%)

Query: 184 VAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWS 243
           VA GS+D  +R+  +++   VR +TG HKG I  L TF  S     L +G +DG ++LW 
Sbjct: 643 VATGSADRTVRLWDVLNGNCVRIFTG-HKGPIHSL-TF--SPNGRFLATGATDGRVLLWD 698

Query: 244 ADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGA-DKTLAIWDTV-SFKEL 301
             HG    E      LK H   V ++  SR      +++  G+ D T+ +WD V +F++L
Sbjct: 699 IGHGLMVGE------LKGHTDTVCSLRFSR----DGEILASGSMDNTVRLWDAVKAFEDL 748

Query: 302 R 302
            
Sbjct: 749 E 749
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription. TAF5/TAFII100 interacts strongly with the histone H4-related TAF6/TAFII80 and the histone H3-related TAF9/TAFII31, as well as a stable complex comprised of both TAF5/TAFII80 and TAF6/TAFII31. Apparently weaker interactions of TAF5/TAFII100 with TBP, TAF1/TAFII250, TAF11/TAFII28, and TAF12/TAFII20, but not TAF7/TAFII55, also have been observed.
Mus musculus (taxid: 10090)
>sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 Back     alignment and function description
>sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 Back     alignment and function description
>sp|Q68FJ6|PK1IP_XENLA p21-activated protein kinase-interacting protein 1-like OS=Xenopus laevis GN=pak1ip1 PE=2 SV=1 Back     alignment and function description
>sp|Q5BDJ5|CIAO1_EMENI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cia1 PE=3 SV=2 Back     alignment and function description
>sp|Q6TNS2|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1081
449463194 1343 PREDICTED: uncharacterized protein LOC10 0.995 0.801 0.864 0.0
225439033 1296 PREDICTED: uncharacterized protein LOC10 0.999 0.833 0.888 0.0
296085801 1340 unnamed protein product [Vitis vinifera] 0.999 0.805 0.888 0.0
255560317 1330 conserved hypothetical protein [Ricinus 0.997 0.810 0.873 0.0
145358405 1377 transducin/WD40 domain-containing protei 0.993 0.779 0.841 0.0
110740051 1377 hypothetical protein [Arabidopsis thalia 0.993 0.779 0.841 0.0
297812667 1376 hypothetical protein ARALYDRAFT_489332 [ 0.993 0.780 0.839 0.0
1107412551161 hypothetical protein [Arabidopsis thalia 0.993 0.925 0.841 0.0
356505707 1352 PREDICTED: uncharacterized protein LOC10 0.993 0.794 0.848 0.0
115438929 1377 Os01g0653800 [Oryza sativa Japonica Grou 0.988 0.776 0.802 0.0
>gi|449463194|ref|XP_004149319.1| PREDICTED: uncharacterized protein LOC101213309 [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1889 bits (4892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 935/1081 (86%), Positives = 1012/1081 (93%), Gaps = 5/1081 (0%)

Query: 1    MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLV 60
            MLRL+AFRP+++KIVKIQ+HPTHPWLVTADASDHVSVWNWEHRQVIYELKAGG+DQRRLV
Sbjct: 1    MLRLRAFRPSSEKIVKIQMHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGIDQRRLV 60

Query: 61   GAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVT 120
            GAKLEKLAEG+L+ KGKP EA+RGGSVKQVNFYDDDVRFWQLWRNR+AAAEAP+AV+ VT
Sbjct: 61   GAKLEKLAEGDLDSKGKPAEAIRGGSVKQVNFYDDDVRFWQLWRNRSAAAEAPSAVNQVT 120

Query: 121  SGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGD 180
            S  ++P PSTKGRHFLVICC NKAIFLDLVTMRGRD+PKQ+LDNKSL+CMEFLSRS+ GD
Sbjct: 121  SALSTPAPSTKGRHFLVICCENKAIFLDLVTMRGRDVPKQDLDNKSLLCMEFLSRSSGGD 180

Query: 181  VPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLI 240
             PLVAFG SDGVIRVLSM++WKLVRRYTGGHKGSISCLMTFMASSGEALLVSG SDGLL+
Sbjct: 181  GPLVAFGGSDGVIRVLSMLTWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGASDGLLV 240

Query: 241  LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKE 300
            LWSAD+ QDSRELVPKLSLKAHDGGVVAVELSRV+GG+PQLITIGADKTLAIWDT+SFKE
Sbjct: 241  LWSADNSQDSRELVPKLSLKAHDGGVVAVELSRVIGGAPQLITIGADKTLAIWDTISFKE 300

Query: 301  LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360
            LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP
Sbjct: 301  LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360

Query: 361  PQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSA 420
            PQVLA +KK+RVYCM+AH LQPHLVATGTN+GVIISE D RSLPAVAPLPTPSG R+HSA
Sbjct: 361  PQVLAPNKKVRVYCMIAHPLQPHLVATGTNIGVIISELDARSLPAVAPLPTPSGGREHSA 420

Query: 421  VYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDS 480
            VYIVERELKL+NFQLS   NPSLGNNGSLSE GRLKGD  + LQ+KQ+KKHISTPVPHD+
Sbjct: 421  VYIVERELKLLNFQLSHTTNPSLGNNGSLSEGGRLKGD--ELLQVKQVKKHISTPVPHDA 478

Query: 481  YSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTP 540
            YS+LS+SSSGKYLA++WPDIPYFS+YKVSDWSIVDSGSARLLAWDTCRDRFA+LESA+ P
Sbjct: 479  YSVLSISSSGKYLAIIWPDIPYFSIYKVSDWSIVDSGSARLLAWDTCRDRFALLESAIPP 538

Query: 541  RLPIIPKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSE 600
            R P IPKGGSSR+AKEAAAAAA A AAAASAASSA+VQ RILLDDGTSNILMRSIG  SE
Sbjct: 539  RFPTIPKGGSSRRAKEAAAAAAQAAAAAASAASSASVQVRILLDDGTSNILMRSIGSRSE 598

Query: 601  PVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKS 660
            PV+GLHGGALLGVAYRTSRRISP+AATAIST   MPLSGFG+SG+SSFT+FDDGFSS KS
Sbjct: 599  PVVGLHGGALLGVAYRTSRRISPVAATAIST---MPLSGFGNSGVSSFTSFDDGFSSLKS 655

Query: 661  PAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLG 720
             AE  P NFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSL PQYRYLG
Sbjct: 656  SAETTPPNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLRPQYRYLG 715

Query: 721  DVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAE 780
            DVAIP+ATGAVWHRRQLFV TPTTIECVFVD GVA ID+ET +MKEEMKLK+ Q++A+AE
Sbjct: 716  DVAIPHATGAVWHRRQLFVATPTTIECVFVDCGVAPIDIETRRMKEEMKLKDAQAKAIAE 775

Query: 781  HGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMM 840
            HGELALI V+  QTA Q+RI LRPPMLQVVRLAS+Q A SVPPFL++PKQ+K + DDSMM
Sbjct: 776  HGELALITVDGPQTATQERITLRPPMLQVVRLASYQQAPSVPPFLSLPKQSKADADDSMM 835

Query: 841  PKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALS 900
             KD EERK NEIAVGGGGV+VAVTRFP EQKRP+GPLVVVGV+DGVLWLIDRYM AHALS
Sbjct: 836  QKDFEERKANEIAVGGGGVSVAVTRFPAEQKRPVGPLVVVGVRDGVLWLIDRYMSAHALS 895

Query: 901  LSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 960
            L+HPGIRCRCLAAYGD+VSAVKWASRLGREHHDDLAQFMLGMGYA EALHLPGISKRLEF
Sbjct: 896  LNHPGIRCRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYAAEALHLPGISKRLEF 955

Query: 961  DLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKE 1020
            DLAMQ NDLKRALQCL+TMSNSRD+GQD+ GLDLNDIL+LTTKKE++VE  QGIVKFAKE
Sbjct: 956  DLAMQGNDLKRALQCLLTMSNSRDMGQDNAGLDLNDILSLTTKKEDMVETFQGIVKFAKE 1015

Query: 1021 FLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRFG 1080
            FLDLIDAADATGQA+IAREALKRLAAAGS+KGALQGHE+RGLALRLANHGELTRLS    
Sbjct: 1016 FLDLIDAADATGQADIAREALKRLAAAGSLKGALQGHEIRGLALRLANHGELTRLSGLVN 1075

Query: 1081 N 1081
            N
Sbjct: 1076 N 1076

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225439033|ref|XP_002263744.1| PREDICTED: uncharacterized protein LOC100248418 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085801|emb|CBI31125.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560317|ref|XP_002521175.1| conserved hypothetical protein [Ricinus communis] gi|223539622|gb|EEF41206.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|145358405|ref|NP_197859.4| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332005968|gb|AED93351.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110740051|dbj|BAF01929.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297812667|ref|XP_002874217.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. lyrata] gi|297320054|gb|EFH50476.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|110741255|dbj|BAF02178.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356505707|ref|XP_003521631.1| PREDICTED: uncharacterized protein LOC100777567 [Glycine max] Back     alignment and taxonomy information
>gi|115438929|ref|NP_001043744.1| Os01g0653800 [Oryza sativa Japonica Group] gi|55296497|dbj|BAD68693.1| WD-40 repeat family protein-like [Oryza sativa Japonica Group] gi|113533275|dbj|BAF05658.1| Os01g0653800 [Oryza sativa Japonica Group] gi|218188769|gb|EEC71196.1| hypothetical protein OsI_03104 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1081
TAIR|locus:2176836 1377 AT5G24710 "AT5G24710" [Arabido 0.988 0.776 0.764 0.0
POMBASE|SPBC16C6.13c796 sec27 "coatomer beta' subunit 0.095 0.129 0.298 1.4e-06
FB|FBgn0025724 914 beta'Cop "beta'-coatomer prote 0.100 0.119 0.282 1.6e-06
ASPGD|ASPL0000006005853 AN5972 [Emericella nidulans (t 0.036 0.045 0.365 1.5e-05
UNIPROTKB|F1S845542 TAF5 "Uncharacterized protein" 0.096 0.191 0.341 3.1e-05
UNIPROTKB|I3LC69647 WDR81 "Uncharacterized protein 0.090 0.151 0.293 7.6e-05
ZFIN|ZDB-GENE-051120-180756 taf5 "TAF5 RNA polymerase II, 0.091 0.130 0.350 0.00018
SGD|S000003105889 SEC27 "Essential beta'-coat pr 0.034 0.041 0.405 0.00026
TAIR|locus:2012971407 AT1G71840 "AT1G71840" [Arabido 0.107 0.285 0.272 0.00051
UNIPROTKB|E2RE41801 TAF5 "Uncharacterized protein" 0.096 0.129 0.341 0.0007
TAIR|locus:2176836 AT5G24710 "AT5G24710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4282 (1512.4 bits), Expect = 0., P = 0.
 Identities = 823/1077 (76%), Positives = 898/1077 (83%)

Query:     1 MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLV 60
             MLR +AFR TN KIVKIQ+HPTHPWLVTAD SDHVSVWNWEHRQVIYELKAGGVD+RRLV
Sbjct:     1 MLRARAFRQTNGKIVKIQVHPTHPWLVTADDSDHVSVWNWEHRQVIYELKAGGVDERRLV 60

Query:    61 XXXXXXXXXXXXXXXXXPTEAMRGGSVKQVNFYDDDVRFWQLWRNRXXXXXXXXXVSNVT 120
                              PTEA+RGGSVKQV FYDDDVR+WQLWRNR         V+++T
Sbjct:    61 GAKLEKLAEGESDYKAKPTEAIRGGSVKQVKFYDDDVRYWQLWRNRSAAAESPSAVNHLT 120

Query:   121 SGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGD 180
             S F SP PSTKGRHFLVICC NKAIFLDLVTMRGRD+PKQELDNKSL+CMEFLSRS+ GD
Sbjct:   121 SAFTSPAPSTKGRHFLVICCENKAIFLDLVTMRGRDVPKQELDNKSLLCMEFLSRSSGGD 180

Query:   181 VPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLI 240
              PLVAFGS+DGVIRVLSMI+WKL RRYTGGHKGSI CLM FMASSGEALLVSGGSDGLL+
Sbjct:   181 GPLVAFGSTDGVIRVLSMITWKLARRYTGGHKGSIYCLMNFMASSGEALLVSGGSDGLLV 240

Query:   241 LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKE 300
             LWSADHG DSRELVPKLSLKAHDGGVVAVELSRV G +PQLITIGADKTLAIWDT++FKE
Sbjct:   241 LWSADHGADSRELVPKLSLKAHDGGVVAVELSRVSGSAPQLITIGADKTLAIWDTMTFKE 300

Query:   301 LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360
             LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIW+IEHPTYSALTRPLCELSSLVP
Sbjct:   301 LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWSIEHPTYSALTRPLCELSSLVP 360

Query:   361 PQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSA 420
             PQVLA H+KLRVYCMVAH LQPHLVATGTNVG+I+SEFDPR++P+ APLP   GSR++SA
Sbjct:   361 PQVLATHRKLRVYCMVAHPLQPHLVATGTNVGIIVSEFDPRAIPSAAPLPALPGSRENSA 420

Query:   421 VYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDS 480
             +YI+ RELKL+NFQLS+ ANPSLGNN +LSE+G  KGD  + L +KQ KK I  PVPHDS
Sbjct:   421 IYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQTKKQIVAPVPHDS 480

Query:   481 YSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTP 540
             YS+LSVSSSGKY+AVVWPDI YFS+YKVSDWSIVDSGSARLLAWDTCRDRFAILES L  
Sbjct:   481 YSVLSVSSSGKYVAVVWPDILYFSIYKVSDWSIVDSGSARLLAWDTCRDRFAILESVLPH 540

Query:   541 RLPIIPKGGSSRKAKEXXXXXXXXXXXXXXXXXXXTVQARILLDDGTSNILMRSIGGSSE 600
             R+PIIPKGGSSRKAKE                   +VQ RILLDDGTSNILMRS+GG SE
Sbjct:   541 RMPIIPKGGSSRKAKEAAAAAAQAAAAASAASSA-SVQVRILLDDGTSNILMRSVGGRSE 599

Query:   601 PVIGLHGGALLGVAYRTXXXXXXXXXXXXXXXQSMPXXXXXXXXXXXXXXXXXXXXXQKS 660
             PVIGLHGGALLG+ YRT               QSMP                     QKS
Sbjct:   600 PVIGLHGGALLGIGYRTSRRISPVAATAISTIQSMPLSGFGNSNVSSFSSYDDGFSSQKS 659

Query:   661 PAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLG 720
              AE+AP N+QLYSWE F+PVGG+LPQPEWTAWDQTVEYCAFAYQ Y+VISSL PQYRYLG
Sbjct:   660 -AESAPLNYQLYSWENFEPVGGMLPQPEWTAWDQTVEYCAFAYQQYMVISSLRPQYRYLG 718

Query:   721 DVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVXXXXXXXXXXXXXVQSRAVAE 780
             DVAI +ATGAVWHRRQLFV TPTTIECVFVDAGV+ ID+              Q+RAVAE
Sbjct:   719 DVAIAHATGAVWHRRQLFVATPTTIECVFVDAGVSEIDIETRKMKEEMKLKEAQARAVAE 778

Query:   781 HGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMM 840
             HGELALI VE SQ A Q+RI LRPPMLQVVRLASFQ+A SVPPFL++P+Q++ + DD M 
Sbjct:   779 HGELALITVEGSQAAKQERISLRPPMLQVVRLASFQNAPSVPPFLSLPRQSRGDSDDIM- 837

Query:   841 PKDIEERKVNEIXXXXXXXXXXXTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALS 900
                 +ER+VNE+           TRFP EQKRP+GPLVV GV+DGVLWLIDRYMCAHA+S
Sbjct:   838 ----DERRVNEVAVGGGGVSVAVTRFPVEQKRPVGPLVVAGVRDGVLWLIDRYMCAHAIS 893

Query:   901 LSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 960
             L+HPGIRCRCLAAYGD+VSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF
Sbjct:   894 LNHPGIRCRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 953

Query:   961 DLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLT-TKKENIVEAVQGIVKFAK 1019
             DLAMQSNDLKRAL CL+TMSNS+DIGQD  GLDL+DIL+LT TKKE++VEAV+GIVKFAK
Sbjct:   954 DLAMQSNDLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAK 1013

Query:  1020 EFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLS 1076
             EFLDLIDAADATG A+IAREALKRLA AGSVKGALQGHELRGL+LRLANHGELTRLS
Sbjct:  1014 EFLDLIDAADATGHADIAREALKRLATAGSVKGALQGHELRGLSLRLANHGELTRLS 1070
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
POMBASE|SPBC16C6.13c sec27 "coatomer beta' subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0025724 beta'Cop "beta'-coatomer protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006005 AN5972 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1S845 TAF5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC69 WDR81 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051120-180 taf5 "TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000003105 SEC27 "Essential beta'-coat protein of the COPI coatomer" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2012971 AT1G71840 "AT1G71840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE41 TAF5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033606001
SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (1271 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1081
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-11
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-07
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 75.4 bits (186), Expect = 1e-14
 Identities = 62/317 (19%), Positives = 100/317 (31%), Gaps = 55/317 (17%)

Query: 4   LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELK--AGGVDQRRLVG 61
            +  +     +  +   P    L T      + VW+ E  +++  LK   G V       
Sbjct: 2   RRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAAS- 60

Query: 62  AKLEKLAEGELEH--------KGKPTEAMRG--GSVKQVNFYDDD-----------VRFW 100
           A    LA G  +          G+    + G    V  V F  D            ++ W
Sbjct: 61  ADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVW 120

Query: 101 QLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFL-DLVTMRGRDIPK 159
            +                V S   SP        F+     +  I L DL T +      
Sbjct: 121 DV-ETGKCLTTLRGHTDWVNSVAFSPDG-----TFVASSSQDGTIKLWDLRTGK----CV 170

Query: 160 QELD--NKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISC 217
             L      +  + F       D   +   SSDG I++  + + K +    G H+  ++ 
Sbjct: 171 ATLTGHTGEVNSVAFS-----PDGEKLLSSSSDGTIKLWDLSTGKCLGTLRG-HENGVNS 224

Query: 218 LMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGG 277
           +     S    LL SG  DG + +W      D R      +L  H   V ++        
Sbjct: 225 VAF---SPDGYLLASGSEDGTIRVW------DLRTGECVQTLSGHTNSVTSL---AWSPD 272

Query: 278 SPQLITIGADKTLAIWD 294
             +L +  AD T+ IWD
Sbjct: 273 GKRLASGSADGTIRIWD 289

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1081
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG1023484 consensus Natriuretic peptide receptor, guanylate 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 99.98
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.98
KOG0645312 consensus WD40 repeat protein [General function pr 99.98
KOG0295406 consensus WD40 repeat-containing protein [Function 99.98
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.98
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.95
KOG0286343 consensus G-protein beta subunit [General function 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.95
KOG0315311 consensus G-protein beta subunit-like protein (con 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.94
KOG0295406 consensus WD40 repeat-containing protein [Function 99.94
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.94
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.92
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.92
KOG0645312 consensus WD40 repeat protein [General function pr 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG2106626 consensus Uncharacterized conserved protein, conta 99.91
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.91
KOG0641350 consensus WD40 repeat protein [General function pr 99.91
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.91
PLN00181793 protein SPA1-RELATED; Provisional 99.91
KOG2096420 consensus WD40 repeat protein [General function pr 99.91
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.91
KOG0772641 consensus Uncharacterized conserved protein, conta 99.91
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.9
KOG2048691 consensus WD40 repeat protein [General function pr 99.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.9
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.9
KOG0283712 consensus WD40 repeat-containing protein [Function 99.9
KOG0300481 consensus WD40 repeat-containing protein [Function 99.9
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.9
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
KOG4171 671 consensus Adenylate/guanylate kinase [Nucleotide t 99.89
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.89
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.89
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.89
PTZ00421493 coronin; Provisional 99.88
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.88
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.88
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.88
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.88
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.87
KOG0301745 consensus Phospholipase A2-activating protein (con 99.87
PTZ00421493 coronin; Provisional 99.87
KOG0289506 consensus mRNA splicing factor [General function p 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.87
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.87
PTZ00420568 coronin; Provisional 99.87
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.87
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.87
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.87
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.86
KOG1539910 consensus WD repeat protein [General function pred 99.86
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.86
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.86
KOG0643327 consensus Translation initiation factor 3, subunit 99.86
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.85
KOG2055514 consensus WD40 repeat protein [General function pr 99.85
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.85
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.85
PTZ00420568 coronin; Provisional 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.84
KOG1539910 consensus WD repeat protein [General function pred 99.84
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.84
KOG0301745 consensus Phospholipase A2-activating protein (con 99.84
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.84
KOG0641350 consensus WD40 repeat protein [General function pr 99.84
KOG0289506 consensus mRNA splicing factor [General function p 99.84
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.84
KOG0646476 consensus WD40 repeat protein [General function pr 99.83
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.83
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.83
KOG0283712 consensus WD40 repeat-containing protein [Function 99.83
KOG0269839 consensus WD40 repeat-containing protein [Function 99.83
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.83
KOG0300481 consensus WD40 repeat-containing protein [Function 99.82
KOG0639705 consensus Transducin-like enhancer of split protei 99.82
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.82
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.82
KOG0639705 consensus Transducin-like enhancer of split protei 99.82
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.81
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.81
KOG0294362 consensus WD40 repeat-containing protein [Function 99.81
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.81
KOG4283397 consensus Transcription-coupled repair protein CSA 99.81
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG0772641 consensus Uncharacterized conserved protein, conta 99.8
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.8
KOG2048691 consensus WD40 repeat protein [General function pr 99.8
KOG1274933 consensus WD40 repeat protein [General function pr 99.79
KOG4328498 consensus WD40 protein [Function unknown] 99.79
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.79
KOG0294362 consensus WD40 repeat-containing protein [Function 99.78
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.78
KOG0269839 consensus WD40 repeat-containing protein [Function 99.78
KOG2106626 consensus Uncharacterized conserved protein, conta 99.78
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
KOG0646476 consensus WD40 repeat protein [General function pr 99.77
KOG0267825 consensus Microtubule severing protein katanin p80 99.76
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.76
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.76
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.76
KOG1274933 consensus WD40 repeat protein [General function pr 99.75
KOG0302440 consensus Ribosome Assembly protein [General funct 99.74
KOG0267825 consensus Microtubule severing protein katanin p80 99.73
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.72
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.71
KOG2096420 consensus WD40 repeat protein [General function pr 99.71
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.7
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.7
KOG1273405 consensus WD40 repeat protein [General function pr 99.7
KOG4283397 consensus Transcription-coupled repair protein CSA 99.7
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.69
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.69
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.69
KOG0270463 consensus WD40 repeat-containing protein [Function 99.69
KOG1273405 consensus WD40 repeat protein [General function pr 99.68
KOG0270463 consensus WD40 repeat-containing protein [Function 99.68
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.67
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.67
KOG4227609 consensus WD40 repeat protein [General function pr 99.66
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.65
COG2319466 FOG: WD40 repeat [General function prediction only 99.65
KOG4328498 consensus WD40 protein [Function unknown] 99.64
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.64
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.63
KOG2055514 consensus WD40 repeat protein [General function pr 99.62
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.62
KOG0303472 consensus Actin-binding protein Coronin, contains 99.62
KOG1963792 consensus WD40 repeat protein [General function pr 99.61
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.61
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.6
KOG1188376 consensus WD40 repeat protein [General function pr 99.59
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.56
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.56
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.55
KOG06441113 consensus Uncharacterized conserved protein, conta 99.54
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.54
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.54
KOG1188376 consensus WD40 repeat protein [General function pr 99.54
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.53
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.52
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.52
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.51
KOG1334559 consensus WD40 repeat protein [General function pr 99.51
KOG0649325 consensus WD40 repeat protein [General function pr 99.51
COG2319466 FOG: WD40 repeat [General function prediction only 99.49
KOG1963792 consensus WD40 repeat protein [General function pr 99.48
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.47
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.47
PRK11028330 6-phosphogluconolactonase; Provisional 99.46
PHA02988283 hypothetical protein; Provisional 99.45
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.45
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.44
KOG06441113 consensus Uncharacterized conserved protein, conta 99.44
KOG0303472 consensus Actin-binding protein Coronin, contains 99.43
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.43
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.43
KOG2139445 consensus WD40 repeat protein [General function pr 99.41
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.39
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.39
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.36
KOG1310758 consensus WD40 repeat protein [General function pr 99.36
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.35
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.35
KOG0771398 consensus Prolactin regulatory element-binding pro 99.34
PRK11028330 6-phosphogluconolactonase; Provisional 99.34
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.33
PTZ00283496 serine/threonine protein kinase; Provisional 99.33
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.31
KOG2110391 consensus Uncharacterized conserved protein, conta 99.3
KOG1310758 consensus WD40 repeat protein [General function pr 99.3
PRK01742429 tolB translocation protein TolB; Provisional 99.29
PRK01742429 tolB translocation protein TolB; Provisional 99.28
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.27
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.25
KOG2321703 consensus WD40 repeat protein [General function pr 99.25
KOG4227609 consensus WD40 repeat protein [General function pr 99.24
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.24
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.24
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.23
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.22
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.22
KOG2110391 consensus Uncharacterized conserved protein, conta 99.21
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.21
KOG1409404 consensus Uncharacterized conserved protein, conta 99.21
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.2
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.2
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.2
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.2
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.19
KOG0771398 consensus Prolactin regulatory element-binding pro 99.18
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.18
KOG2139445 consensus WD40 repeat protein [General function pr 99.17
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.17
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.16
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.15
KOG2111346 consensus Uncharacterized conserved protein, conta 99.15
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.15
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.14
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.14
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.14
KOG0198313 consensus MEKK and related serine/threonine protei 99.14
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.14
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.14
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.13
KOG1334559 consensus WD40 repeat protein [General function pr 99.13
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.13
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.12
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.12
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.11
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.11
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.1
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.1
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.09
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.09
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.07
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.07
PRK03629429 tolB translocation protein TolB; Provisional 99.07
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.06
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.06
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.05
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.05
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.05
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.05
KOG2111346 consensus Uncharacterized conserved protein, conta 99.05
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.04
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.04
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.03
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.03
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.03
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.03
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.02
PRK03629429 tolB translocation protein TolB; Provisional 99.02
KOG2321703 consensus WD40 repeat protein [General function pr 99.02
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.01
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.01
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.01
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.01
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.01
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.01
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.01
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.0
KOG0578550 consensus p21-activated serine/threonine protein k 99.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.0
PRK04922433 tolB translocation protein TolB; Provisional 98.99
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.99
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.99
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.99
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 98.99
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 98.99
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.98
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 98.98
KOG0200609 consensus Fibroblast/platelet-derived growth facto 98.98
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.97
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.97
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.97
PTZ00267478 NIMA-related protein kinase; Provisional 98.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 98.96
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 98.96
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 98.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.95
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.95
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.95
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.95
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.95
PRK05137435 tolB translocation protein TolB; Provisional 98.95
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.94
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.94
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.94
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.94
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.94
PRK04922433 tolB translocation protein TolB; Provisional 98.94
PRK02889427 tolB translocation protein TolB; Provisional 98.94
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 98.93
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.93
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.93
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.93
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.93
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 98.93
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.92
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.92
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.92
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.92
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.92
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.92
KOG2052513 consensus Activin A type IB receptor, serine/threo 98.92
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.91
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.91
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.91
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.91
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.9
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.9
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.9
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.9
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.89
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 98.89
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.89
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.89
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 98.89
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.89
KOG0581364 consensus Mitogen-activated protein kinase kinase 98.89
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.89
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.89
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.88
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.88
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 98.88
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.87
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.87
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 98.87
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.86
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.86
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.86
PTZ00263329 protein kinase A catalytic subunit; Provisional 98.86
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.85
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 98.85
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 98.85
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.85
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.85
KOG4547541 consensus WD40 repeat-containing protein [General 98.85
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.84
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.84
KOG0595429 consensus Serine/threonine-protein kinase involved 98.84
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.84
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.84
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.84
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.84
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.84
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.84
KOG4547541 consensus WD40 repeat-containing protein [General 98.84
PRK02889427 tolB translocation protein TolB; Provisional 98.83
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.83
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 98.82
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.82
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.82
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.82
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.82
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.82
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.81
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 98.81
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.81
KOG0195448 consensus Integrin-linked kinase [Signal transduct 98.81
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.81
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.81
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.81
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.81
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 98.8
PRK05137435 tolB translocation protein TolB; Provisional 98.8
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 98.8
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.8
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.79
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 98.79
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 98.79
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.79
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 98.79
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 98.79
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.79
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.79
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.79
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.79
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.78
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.78
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.78
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.78
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 98.78
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 98.77
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.77
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.77
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.77
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.77
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 98.76
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.76
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.76
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.76
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.76
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.76
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.75
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 98.75
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.75
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.75
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.75
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.74
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.74
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.74
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.74
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.74
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.74
KOG2315566 consensus Predicted translation initiation factor 98.74
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 98.74
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.74
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 98.73
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 98.73
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 98.73
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.73
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.72
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.72
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.72
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.72
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.71
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.71
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.71
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 98.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.71
COG4946668 Uncharacterized protein related to the periplasmic 98.71
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 98.71
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.7
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 98.7
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 98.7
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 98.7
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 98.7
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.69
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.69
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.69
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 98.69
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.68
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.68
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 98.68
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 98.67
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.67
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.67
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.66
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.66
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.66
PRK04792448 tolB translocation protein TolB; Provisional 98.65
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.65
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.65
PHA03209357 serine/threonine kinase US3; Provisional 98.65
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.65
PRK00178430 tolB translocation protein TolB; Provisional 98.65
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.65
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.65
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.64
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.64
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 98.64
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.64
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 98.64
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.64
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.63
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.63
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 98.63
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.63
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.63
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 98.62
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.62
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.62
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.62
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=2e-97  Score=812.56  Aligned_cols=747  Identities=21%  Similarity=0.283  Sum_probs=619.1

Q ss_pred             ceeeCCCCCceEEEEEcCCCCEEEEEeCCCcEEEEECCCCcEEEEEecCCccceEEeccCCCeEEEeecCCCCCceeeec
Q 001416            4 LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMR   83 (1081)
Q Consensus         4 l~~l~gH~~~V~~lafsp~g~~Lasgs~dg~I~IWd~~t~~~i~~~~~~~~~~v~~vs~~~~~lasg~~d~~~~~~~~l~   83 (1081)
                      .++|..|+++|++++|||..+|++++..+|.|.|||++|+..+++|+...                              
T Consensus         6 krk~~~rSdRVKsVd~HPtePw~la~LynG~V~IWnyetqtmVksfeV~~------------------------------   55 (794)
T KOG0276|consen    6 KRKFQSRSDRVKSVDFHPTEPWILAALYNGDVQIWNYETQTMVKSFEVSE------------------------------   55 (794)
T ss_pred             hhHhhccCCceeeeecCCCCceEEEeeecCeeEEEecccceeeeeeeecc------------------------------
Confidence            46788899999999999999999999999999999999999999998432                              


Q ss_pred             CCceEEEEEeCCeEEEEEcCCCccccccccccccCCCCCeeecccCCCCCeEEEEEecCcEEE-EEecCCCccccccccc
Q 001416           84 GGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIF-LDLVTMRGRDIPKQEL  162 (1081)
Q Consensus        84 g~~V~~v~f~Dg~IriWdl~~~~~~~~~~~~~~~h~~~~V~sl~fsp~g~~~l~s~s~d~~i~-wd~~t~~~~~~~~~~~  162 (1081)
                       -                                    +|++..|.+.. .++++|+||..++ |+++|++  .+..++.
T Consensus        56 -~------------------------------------PvRa~kfiaRk-nWiv~GsDD~~IrVfnynt~e--kV~~FeA   95 (794)
T KOG0276|consen   56 -V------------------------------------PVRAAKFIARK-NWIVTGSDDMQIRVFNYNTGE--KVKTFEA   95 (794)
T ss_pred             -c------------------------------------chhhheeeecc-ceEEEecCCceEEEEecccce--eeEEeec
Confidence             2                                    34555566654 4999999999886 9999974  6788999


Q ss_pred             CCCCeeEEEEeeccccCCCCEEEEEECCCeEEEEEcC-CCeEEEEEecccccceEEEEEeeeCCCCCEEEEEeCCCcEEE
Q 001416          163 DNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMI-SWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLIL  241 (1081)
Q Consensus       163 ~~~~I~~ia~~p~~~sp~~~~l~sgs~Dg~I~lwd~~-~~~~~~~~~~~h~~~V~~l~w~~~s~d~~~l~sgs~Dg~V~v  241 (1081)
                      |.++|+|++.     +|..++++++|+|.+|++||++ .+.+.++|+ ||.++|++++  ++|.|.+.|+|+|.|++|++
T Consensus        96 H~DyIR~iav-----HPt~P~vLtsSDDm~iKlW~we~~wa~~qtfe-GH~HyVMqv~--fnPkD~ntFaS~sLDrTVKV  167 (794)
T KOG0276|consen   96 HSDYIRSIAV-----HPTLPYVLTSSDDMTIKLWDWENEWACEQTFE-GHEHYVMQVA--FNPKDPNTFASASLDRTVKV  167 (794)
T ss_pred             cccceeeeee-----cCCCCeEEecCCccEEEEeeccCceeeeeEEc-CcceEEEEEE--ecCCCccceeeeeccccEEE
Confidence            9999999999     5789999999999999999997 568888887 9999999998  38999999999999999999


Q ss_pred             EEcCCCCcccccccceeecccCCcEEEEEEeeecCCCCEEEEEECCCeEEEEECCCCceeeEecCCCccccCCCCeEEEe
Q 001416          242 WSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHP  321 (1081)
Q Consensus       242 Wd~~~~~~~~~~~~~~~l~~h~~~V~~v~fsp~~~~~~~Lvsgs~Dg~V~iWDl~t~~~~~~~~~~~~~~~h~~~v~~v~  321 (1081)
                      |.+.+..      +.+++++|+++|+|++|.+. +|.++|+||++|.+|+|||+++.+|++++      .+|..+|.++.
T Consensus       168 Wslgs~~------~nfTl~gHekGVN~Vdyy~~-gdkpylIsgaDD~tiKvWDyQtk~CV~TL------eGHt~Nvs~v~  234 (794)
T KOG0276|consen  168 WSLGSPH------PNFTLEGHEKGVNCVDYYTG-GDKPYLISGADDLTIKVWDYQTKSCVQTL------EGHTNNVSFVF  234 (794)
T ss_pred             EEcCCCC------CceeeeccccCcceEEeccC-CCcceEEecCCCceEEEeecchHHHHHHh------hcccccceEEE
Confidence            9998876      67789999999999999984 57799999999999999999999998875      89999999999


Q ss_pred             ecCCCCEE-EEECCc--eEEEeccCCcccccccccccCCCCCCeEEccCCCccEEEEEEeCCCCeEEEEEECCCeEEEEe
Q 001416          322 RAPNLDIL-TCVKDS--HIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEF  398 (1081)
Q Consensus       322 ~spd~~ll-s~s~D~--~IWdi~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~V~~l~~sp~~~~llatgs~dG~Il~iw  398 (1081)
                      |||..+++ +||+||  |||+..  +++.+.             ++. .+.+||||++.++. .+.++.|.++|.| .+=
T Consensus       235 fhp~lpiiisgsEDGTvriWhs~--Ty~lE~-------------tLn-~gleRvW~I~~~k~-~~~i~vG~Deg~i-~v~  296 (794)
T KOG0276|consen  235 FHPELPIIISGSEDGTVRIWNSK--TYKLEK-------------TLN-YGLERVWCIAAHKG-DGKIAVGFDEGSV-TVK  296 (794)
T ss_pred             ecCCCcEEEEecCCccEEEecCc--ceehhh-------------hhh-cCCceEEEEeecCC-CCeEEEeccCCcE-EEE
Confidence            99999965 899998  689876  444332             343 34459999999997 6668999999997 333


Q ss_pred             CCCCCCCCcccCCCCCCCCceEEEEecCcEEEEEEeecCCCCCCCCCCcccCCCCCcCCCchhHHhhhhcccccccccCC
Q 001416          399 DPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPH  478 (1081)
Q Consensus       399 d~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~l~~~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~  478 (1081)
                      -.++.|.+.      .+....++|...++++-.+...-..       .. --.+|.......+++       .-+..+| 
T Consensus       297 lgreeP~vs------Md~~gKIiwa~~~ei~~~~~ks~~~-------~~-ev~DgErL~LsvKeL-------gs~eiyP-  354 (794)
T KOG0276|consen  297 LGREEPAVS------MDSNGKIIWAVHSEIQAVNLKSVGA-------QK-EVTDGERLPLSVKEL-------GSVEIYP-  354 (794)
T ss_pred             ccCCCCcee------ecCCccEEEEcCceeeeeeceeccC-------cc-cccCCccccchhhhc-------cccccch-
Confidence            234333333      3334458999999987555432211       11 123454443333332       1233455 


Q ss_pred             CCCCeEEEccCCCEEEEecCCCCceEEEEecCeEEeecCceeEEEEecCcccceecccccCCCCCCCCCCCCchhHHHHH
Q 001416          479 DSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEAA  558 (1081)
Q Consensus       479 ~~~~~l~~S~~G~~lav~~~~~~~~~i~~~~~~~~~~~G~~~~~aW~~~~~~~a~l~~~~~~~~~~~~~~~~~~~~~~~~  558 (1081)
                         +.++|||+|||++||  |+|+|+||+..+||++++|+++.|+|+.++|.||++|+....++        +|+|||.+
T Consensus       355 ---q~L~hsPNGrfV~Vc--gdGEyiIyTala~RnK~fG~~~eFvw~~dsne~avRes~~~vki--------~knfke~k  421 (794)
T KOG0276|consen  355 ---QTLAHSPNGRFVVVC--GDGEYIIYTALALRNKAFGSGLEFVWAADSNEFAVRESNGNVKI--------FKNFKEHK  421 (794)
T ss_pred             ---HHhccCCCCcEEEEe--cCccEEEEEeeehhhcccccceeEEEcCCCCeEEEEecCCceEE--------Eecceecc
Confidence               589999999999998  99999999999999999999999999999999999998655543        56677772


Q ss_pred             HHHHHHHHHHHHhhccccEEEEEEecCCccceEEeecCCCCCCceeeecceeEEEEEeeccccCcccccccccccccccc
Q 001416          559 AAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLS  638 (1081)
Q Consensus       559 ~~~~~~~~a~~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~  638 (1081)
                                           ++..+               ...+.||||+||||++.                      
T Consensus       422 ---------------------si~~~---------------~~~e~i~gg~Llg~~ss----------------------  443 (794)
T KOG0276|consen  422 ---------------------SIRPD---------------MSAEGIFGGPLLGVRSS----------------------  443 (794)
T ss_pred             ---------------------ccccc---------------cceeeecCCceEEEEeC----------------------
Confidence                                 11111               23578999999999998                      


Q ss_pred             ccCCCCCccccccCCCCCCCCCCCCCCCccEEEEeeccccccCCCCCCcceeeecccCceEEEeeeeEEEEEecCccccc
Q 001416          639 GFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRY  718 (1081)
Q Consensus       639 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~l~~~~~~~~k~v~w~~~~~~~~~~~~~~~~v~~y~~~~gs  718 (1081)
                                                  .+++||||++++|+|+|++.+|+++|+++|.+|+++..+++||++|+.. ..
T Consensus       444 ----------------------------~~~~fydW~~~~lVrrI~v~~k~v~w~d~g~lVai~~d~Sfyil~~n~d-~v  494 (794)
T KOG0276|consen  444 ----------------------------DFLCFYDWESGELVRRIEVTSKHVYWSDNGELVAIAGDDSFYILKFNAD-AV  494 (794)
T ss_pred             ----------------------------CeEEEEEcccceEEEEEeeccceeEEecCCCEEEEEecCceeEEEecHH-HH
Confidence                                        7999999999999999999999999999999999999999999999876 21


Q ss_pred             ccccccccccceeeEeeeeeEeccCceEEEeeeCCccccchhhhhhhhhhhhHHhhhhHhhhccceeeeeecccchhhhc
Q 001416          719 LGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQD  798 (1081)
Q Consensus       719 l~d~~~~~~~~~~w~~~~~~~~t~~~i~~~~~~~gm~~lh~s~~hg~l~s~nc~vd~rwv~k~~d~gl~~~~~~~~~~~~  798 (1081)
                      +.-+            +.-...++++|+.+|.+-             -+-+++|..|.||   +|+++|+          
T Consensus       495 ~~a~------------e~g~~v~eeGiedAfevL-------------gE~sE~v~tg~Wv---gD~fiyt----------  536 (794)
T KOG0276|consen  495 ANAV------------EQGIEVTEEGIEDAFEVL-------------GEVSESVKTGKWV---GDCFIYT----------  536 (794)
T ss_pred             HHHH------------hcCCCCcchhHHHHHHHH-------------hhhhhheeeceee---eeEEEEe----------
Confidence            1110            111123566777777662             2447899999999   6887664          


Q ss_pred             ccccCCcchhhhhhhccccCCCCCCCcCCCccccccCCCCCCcccccccceeeeeecCCcceeeecCCCCCCCCCCCCcE
Q 001416          799 RIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLV  878 (1081)
Q Consensus       799 ~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~dvys~~i~~~~~~~~~~~~~~~~~~~~~~~~~~p~~  878 (1081)
                                                                      -..++++|++||+.+++.|++       +|+|
T Consensus       537 ------------------------------------------------ts~nrlnY~vgGe~~~v~h~~-------~~my  561 (794)
T KOG0276|consen  537 ------------------------------------------------TSNNRLNYLVGGETYTVAHLD-------RIMY  561 (794)
T ss_pred             ------------------------------------------------ecccceeEEcCCceEEEEEec-------cchh
Confidence                                                            233456789999999999999       9999


Q ss_pred             Eeee--ecCeEEEEeccccccccCCCCcccceecccccccHHHHHhhhcccCcccHHHHHHHHHhcCcHHHHhccccchH
Q 001416          879 VVGV--KDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISK  956 (1081)
Q Consensus       879 ~~~~--~~~~~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~i~~~l~~~~~~~yA~~le~lv~  956 (1081)
                      ++|+  +++++||.||++++++|.+.+.+++||++++++|+..+...++.++++++.++++||+++||.+.|++|. .++
T Consensus       562 lLgy~~~~~rvYL~Dke~nVi~y~l~l~vleyqt~vmrrd~~~a~~vLp~I~k~~rt~va~Fle~~g~~e~AL~~s-~D~  640 (794)
T KOG0276|consen  562 LLGYVANDNRVYLHDKELNVISYKILLEVLEYQTLVLRRDLEVADGVLPTIPKEIRTKVAHFLESQGMKEQALELS-TDP  640 (794)
T ss_pred             heeeeecCCEEEEeecccceEeEeeehHHHHHHHHhhhccccccccccccCchhhhhhHHhHhhhccchHhhhhcC-CCh
Confidence            9996  8999999999999999999999999999999999999999999999999999999999999999999998 699


Q ss_pred             HHHHHHHHhhhhHHHHhhhhcccchhhhcCC--------------CCCcccccccccccccccchHHHHhhhHHHH----
Q 001416          957 RLEFDLAMQSNDLKRALQCLITMSNSRDIGQ--------------DHPGLDLNDILTLTTKKENIVEAVQGIVKFA---- 1018 (1081)
Q Consensus       957 ert~~L~~ek~k~~~ll~~~lp~~va~~l~~--------------~~~ti~fsdivgft~~~s~p~~vv~~ln~ly---- 1018 (1081)
                      ++||+|+++.|+++.+...++..+...+|+|              .+|.-..-|.+|+.-.++.--.. ++|+.|.    
T Consensus       641 d~rFelal~lgrl~iA~~la~e~~s~~Kw~~Lg~~al~~~~l~lA~EC~~~a~d~~~LlLl~t~~g~~-~~l~~la~~~~  719 (794)
T KOG0276|consen  641 DQRFELALKLGRLDIAFDLAVEANSEVKWRQLGDAALSAGELPLASECFLRARDLGSLLLLYTSSGNA-EGLAVLASLAK  719 (794)
T ss_pred             hhhhhhhhhcCcHHHHHHHHHhhcchHHHHHHHHHHhhcccchhHHHHHHhhcchhhhhhhhhhcCCh-hHHHHHHHHHH
Confidence            9999999999999999999999999888888              57888899999998222222222 4455554    


Q ss_pred             ------HHHHHHhhhhhhhchhhhHHHHHHHHhhcccchhhccchhhccccccccccccceeeeccc
Q 001416         1019 ------KEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSVRF 1079 (1081)
Q Consensus      1019 ------t~fd~ii~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1079 (1081)
                            ..|.+-...-|+.+|.+|+.+..|.|+|+.+++.||++.+.+.+.|   |+-.|++.+.++
T Consensus       720 ~~g~~N~AF~~~~l~g~~~~C~~lLi~t~r~peAal~ArtYlps~vs~iv~~---wk~~l~k~~~k~  783 (794)
T KOG0276|consen  720 KQGKNNLAFLAYFLSGDYEECLELLISTQRLPEAALFARTYLPSQVSRIVEL---WKEDLSKVSEKA  783 (794)
T ss_pred             hhcccchHHHHHHHcCCHHHHHHHHHhcCcCcHHHHHHhhhChHHHHHHHHH---HHHHhhhhhhhh
Confidence                  6899999999999999999999999999999999999999999999   888888776654

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4171 consensus Adenylate/guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1081
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.002
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 9e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.002
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 73.2 bits (178), Expect = 2e-14
 Identities = 35/314 (11%), Positives = 85/314 (27%), Gaps = 43/314 (13%)

Query: 11  NDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKA--GGVDQRRLVGAKLEKLA 68
              + ++  HP    +V+A     + VW++E       LK     V       +     +
Sbjct: 17  RSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLAS 76

Query: 69  EGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNV--------- 119
                                     +      +       + +      +         
Sbjct: 77  CSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCV 136

Query: 120 ------TSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGR-------------DIPKQ 160
                         P+  G                + T   +                 +
Sbjct: 137 KTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPE 196

Query: 161 ELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMT 220
              +         ++ +    P +  GS D  I++  + +   +    G H   +  ++ 
Sbjct: 197 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVG-HDNWVRGVLF 255

Query: 221 FMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQ 280
               SG   ++S   D  L +W   + +         +L AH+  V +++  +    +P 
Sbjct: 256 ---HSGGKFILSCADDKTLRVWDYKNKR------CMKTLNAHEHFVTSLDFHK---TAPY 303

Query: 281 LITIGADKTLAIWD 294
           ++T   D+T+ +W+
Sbjct: 304 VVTGSVDQTVKVWE 317
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1081
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.9
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.89
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.83
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.83
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.8
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.79
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.79
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.79
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.79
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.79
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.76
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.75
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.74
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.74
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.72
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.72
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.72
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.72
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.71
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.71
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.69
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.69
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.63
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.62
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.61
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.59
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.58
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.56
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.54
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.53
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.52
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.5
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.5
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.48
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.47
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.47
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.44
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.43
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.42
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.4
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.4
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.35
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.34
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.33
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.32
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.31
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.31
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.26
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.23
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.2
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.2
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.2
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.18
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.18
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.13
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.12
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.11
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.11
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.1
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.07
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.07
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.07
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.06
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.06
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.05
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.01
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.98
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.93
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.92
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.89
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.88
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.88
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.85
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.78
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.7
d1azsb_199 Adenylyl cyclase IIC1, domain C2a {Rat (Rattus nor 98.67
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.65
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.64
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.63
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.58
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.54
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.49
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.44
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.35
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.18
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.06
d1azsa_190 Adenylyl cyclase VC1, domain C1a {Dog (Canis famil 97.87
d1wc1a_197 Adenylate cyclase CyaC {Spirulina platensis [TaxId 97.86
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.71
d1fx2a_ 235 Receptor-type monomeric adenylyl cyclase {Trypanos 97.45
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.27
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.16
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.06
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.18
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.66
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 95.61
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 92.92
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 92.51
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.51
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 89.25
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 89.23
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 87.98
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 86.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 86.01
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.7e-40  Score=258.62  Aligned_cols=287  Identities=17%  Similarity=0.286  Sum_probs=237.3

Q ss_pred             CEEECCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCEEEEEECCCCCCEEEECCCCCEEEEEECCCCCCCEEEEC
Q ss_conf             10517889846999994899899999689929999778891899982377461488646888699820478897226504
Q 001416            4 LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMR   83 (1081)
Q Consensus         4 l~~l~gH~~~V~~iafsp~g~~Lasgs~dg~I~IWd~~t~~~i~~~~~~~~~~v~~vs~~~~~Lasg~~d~~~~~~~~l~   83 (1081)
                      ...|+||++.|++++|+|++++|+||+.||+|+|||+.+++++.++..                                
T Consensus        10 ~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~--------------------------------   57 (317)
T d1vyhc1          10 KYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKG--------------------------------   57 (317)
T ss_dssp             SCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECC--------------------------------
T ss_pred             CEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEEC--------------------------------
T ss_conf             489858888768999938989999993899299998999979999957--------------------------------


Q ss_pred             CCCEEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEECCCEE-EEEECCCCCCCCCCCCC
Q ss_conf             99637999959959999968886224445500147899854101278999499999569299-99902797212440025
Q 001416           84 GGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAI-FLDLVTMRGRDIPKQEL  162 (1081)
Q Consensus        84 g~~V~~v~f~Dg~I~iWdl~~~~~~~~~~~~~~~~~~~~V~si~fspdg~~~lvs~s~d~~i-~wd~~t~~~~~~~~~~~  162 (1081)
                                                        | ...|.+++|+|++. +++.+..+..+ .|+.....  .......
T Consensus        58 ----------------------------------h-~~~V~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~--~~~~~~~   99 (317)
T d1vyhc1          58 ----------------------------------H-TDSVQDISFDHSGK-LLASCSADMTIKLWDFQGFE--CIRTMHG   99 (317)
T ss_dssp             ----------------------------------C-SSCEEEEEECTTSS-EEEEEETTSCCCEEETTSSC--EEECCCC
T ss_pred             ----------------------------------C-CCCEEEEEEECCCC-CCCCCCCCCCCCCCCCCCCC--CCCCCCC
T ss_conf             ----------------------------------8-88677776301111-01111111110111001111--1111000


Q ss_pred             CCCCEEEEEEEECCCCCCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEEECCCCEEEE
Q ss_conf             89983699992212269999999997799099999389959999806556435799986527999899999589909999
Q 001416          163 DNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILW  242 (1081)
Q Consensus       163 ~~~~I~~i~~~p~~~sp~~~~l~tgs~Dg~I~iwd~~~~~~i~~~~~~h~~~V~~i~w~~~s~d~~~l~sgs~Dg~I~iW  242 (1081)
                      |...+.++.|     ++++..+++++.|+.+++||+++++.+..+. +|...+.+++   +++++.++++++.|+.|++|
T Consensus       100 ~~~~~~~~~~-----~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~-~~~~~~~~~~---~~~~~~~l~~~~~d~~v~~~  170 (317)
T d1vyhc1         100 HDHNVSSVSI-----MPNGDHIVSASRDKTIKMWEVQTGYCVKTFT-GHREWVRMVR---PNQDGTLIASCSNDQTVRVW  170 (317)
T ss_dssp             CSSCEEEEEE-----CSSSSEEEEEETTSEEEEEETTTCCEEEEEE-CCSSCEEEEE---ECTTSSEEEEEETTSCEEEE
T ss_pred             CCCCCEEEEC-----CCCCCEEEEECCCCCEEEEECCCCEEEEEEC-CCCCCCEEEE---CCCCCCEEEEEECCCEEEEE
T ss_conf             0000000001-----6998557765267523575114430346871-6777630000---16679999999279829997


Q ss_pred             ECCCCCCCCCCCCCEEECCCCCCEEEEEEEEEC-----------------CCCCEEEEEECCCEEEEEECCCCCEEEEEC
Q ss_conf             868898642101311100367767899996505-----------------998889999899809999889980566742
Q 001416          243 SADHGQDSRELVPKLSLKAHDGGVVAVELSRVM-----------------GGSPQLITIGADKTLAIWDTVSFKELRRIK  305 (1081)
Q Consensus       243 d~~~~~~~~~~~~~~~l~~h~~~V~~i~fsp~~-----------------~~~~~Lvsgs~Dg~I~iWDl~t~~~~~~~~  305 (1081)
                      +...+....      .+.+|...+.++.|+|..                 ..+.++++++.|+.|++||+.+++++.++ 
T Consensus       171 ~~~~~~~~~------~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~-  243 (317)
T d1vyhc1         171 VVATKECKA------ELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTL-  243 (317)
T ss_dssp             ETTTCCEEE------EECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEE-
T ss_pred             EECCCEEEE------EEECCCCCCEEEEEEECCCCCEEECCCCCEEEEECCCCCEEEECCCCCEEEEEECCCCCEEEEE-
T ss_conf             512540347------8824778733799863256411103456303430258861475169978999888999688999-


Q ss_pred             CCCCCCCCCCCEEEEEECCCCCEE-EEECCC--EEEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEECCCC
Q ss_conf             777324678786999646999799-997893--49991169855556663356888897287047871389999908999
Q 001416          306 PVPKLACHSVASWCHPRAPNLDIL-TCVKDS--HIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQP  382 (1081)
Q Consensus       306 ~~~~~~~h~~~v~~i~~spd~~ll-s~s~D~--~IWdi~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~V~~i~~sp~~~  382 (1081)
                           .+|...+.+++++|++.++ +++.|+  ++|++.+               ..++.++.+|.. .|++++|+|+ +
T Consensus       244 -----~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~---------------~~~~~~~~~h~~-~V~~~~~s~~-~  301 (317)
T d1vyhc1         244 -----VGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKN---------------KRCMKTLNAHEH-FVTSLDFHKT-A  301 (317)
T ss_dssp             -----ECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTT---------------SCCCEEEECCSS-CEEEEEECSS-S
T ss_pred             -----ECCCCCEEEEEECCCCCEEEEEECCCEEEEEECCC---------------CCEEEEECCCCC-CEEEEEECCC-C
T ss_conf             -----68899879999879999999997989499999999---------------919999928999-8899999499-9


Q ss_pred             EEEEEEECCCEEEEEEC
Q ss_conf             09999978994999838
Q 001416          383 HLVATGTNVGVIISEFD  399 (1081)
Q Consensus       383 ~liatgs~dG~Il~iwd  399 (1081)
                      .++++|+.||.| ++||
T Consensus       302 ~~l~s~s~Dg~i-~iWd  317 (317)
T d1vyhc1         302 PYVVTGSVDQTV-KVWE  317 (317)
T ss_dssp             SCEEEEETTSEE-EEEC
T ss_pred             CEEEEEECCCEE-EEEC
T ss_conf             999999289949-9829
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1azsb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fx2a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform [TaxId: 5691]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure