Citrus Sinensis ID: 001439


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------108
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
ccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccEEEcccccccccccccHHHcccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccHHcccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccHHHHHcccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccEEEcccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEccccccEEcccHHHHHccccccEEEcccccccccccHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHHcccccccccccccccccccEEEcccccccccccEEEEEEEEEccEEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHcEEEEEEEEEEEcccccc
cccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccHHHcccccccEEEcccccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEccccccccccccHHHcccccccEEEEccccccccccccHHHccccccEEEEcccccccccccHHHcccHHHHHHHHHHcccccccccccccccccHHHccccHEEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHHccccccEEEEEccccccccccHHHccccccccEEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHccccccEEEEccccccccccccHccccccEEEEEccccccccccHHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHcccHHHHHHcccccccccccccHcccccccccccccEEEEEEccccccccccHHHHHHccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MGGSKSKMVVMFVLLLIIFeggwsegclnHERFALLQLKLFfidpynylldwvddegatdccqwervscnntmGRVVVLDlsqthrgeywylnaslftpfqqlesldlrdndiagcveneglerlsrlSNLKMLNLVGNLFNNSILSSLARLssltsldlsanrlkgsidikgpkrlsrlnnlkvfdlsgnlfnnSILSSLARLSSLRSLLLydnrlegsidvkefdslsnleeldmsyneidnfevpqacsglrklSYLHLLRVGIRDGSKLlqsmgsfpslntldlsynnftetvttttqgfphfksLKELYMDDARIALNTSFLQIIGesmpsiqylslsnssvsnnsrtldqglcplvhlqelhmadndlrgslpwclanmtslrildvssnqligsisssplihltsiedlilsdnhfqipisleplfnhsrlkifdaENNEINAEIIeshslttpnFQLQSLLLssgyrdgitfpkflynqhdleyVRLSHIKmneefpnwllenntklrQLSLvndslvgpfrlpihshkqlrlldvsknnfqghipleIGDILSRLTVFNIsmnaldgsipssfgnmnflqfldlsnnqltgeipehLAMGCVSLRSLALsnnnleghmfsrnfnLTNLIWLQLEgnhfvgeipqslskcsslqglflsnnslsgkiprwlgNLTVLRHIimpknhiegpiplefCQLRILQIldisdnnisgslpscydfvciEQVHLSKnmlhgqlkegtffnCLTLMILDLSynhlngnipdrvdgLSQLSYLILAHNnlegevpiQLCRLNQLQLldlsnnnlhghipscfdnttlherynngsslqpfetSFVImggmdvdpkkqiLESFDFTTKSItytyqgrvpsllsgldlscnrlighippqignltkIQTLnlshnnlagpipstfsnlrniesldlsynklswkipyqlVELNTLAVFSVAYNnlsgkipeRAAQFAtfnessyegnpflcgpplpicispttmpeaspsnegdnnlidmdIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVidnliptrfch
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWErvscnntmgRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSldlsanrlkgsidikgpkrlsrlNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRlegsidvkefdslSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTtttqgfphFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSnnslsgkipRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNsilsslarlssltsldlsANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNsilsslarlsslrslllYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFtetvttttQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYlslsnssvsnnsRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVssnqligsisssPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDaenneinaeiieSHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVslrslalsnnnlEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIqlcrlnqlqlldlsnnnlHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
*******MVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSL**********TLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICIS***************NLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFC*
****KSK*VVMFVLLLIIFEGGWSE*CLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERY*****LQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCG****************************DIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
***SKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICIS***************NLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFC*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGSKSKMVVMFVLLLIIFEGGWSEGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAVLYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1077 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.644 0.591 0.297 8e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.748 0.645 0.282 1e-67
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.655 0.563 0.291 4e-63
Q9ZWC8 1166 Serine/threonine-protein no no 0.614 0.567 0.293 6e-59
Q9LJF3 1164 Receptor-like protein kin no no 0.605 0.560 0.310 2e-58
Q9LYN8 1192 Leucine-rich repeat recep no no 0.668 0.604 0.301 1e-57
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.582 0.519 0.296 1e-55
Q8L899 1207 Systemin receptor SR160 O N/A no 0.582 0.519 0.295 3e-55
Q9ZPS9 1143 Serine/threonine-protein no no 0.528 0.497 0.303 9e-55
C0LGS2 1136 Probable LRR receptor-lik no no 0.589 0.558 0.283 9e-55
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  259 bits (662), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 229/769 (29%), Positives = 357/769 (46%), Gaps = 75/769 (9%)

Query: 253  GLRKLSYLHLLRVGIRD-GSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLK 311
             +  L+YL +L +       K+   +G    LN L L  N F+ ++ +          LK
Sbjct: 91   AIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPS------GIWELK 144

Query: 312  ELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMAD 371
             ++  D R   N      + E +     L L     +N +  + + L  LVHLQ    A 
Sbjct: 145  NIFYLDLR---NNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAG 201

Query: 372  NDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEP 431
            N L GS+P  +  + +L  LD+S NQL G I      +L +++ L+L++N  +  I  E 
Sbjct: 202  NHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRD-FGNLLNLQSLVLTENLLEGDIPAE- 259

Query: 432  LFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLE 491
            + N S L   +  +N++  +I                            P  L N   L+
Sbjct: 260  IGNCSSLVQLELYDNQLTGKI----------------------------PAELGNLVQLQ 291

Query: 492  YVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQG 551
             +R+   K+    P+ L    T+L  L L  + LVGP    I   + L +L +  NNF G
Sbjct: 292  ALRIYKNKLTSSIPSSLFRL-TQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTG 350

Query: 552  HIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCV 611
              P  I + L  LTV  +  N + G +P+  G +  L+ L   +N LTG IP  ++  C 
Sbjct: 351  EFPQSITN-LRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSIS-NCT 408

Query: 612  SLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSL 671
             L+ L LS+N + G +  R F   NL ++ +  NHF GEIP  +  CS+L+ L +++N+L
Sbjct: 409  GLKLLDLSHNQMTGEI-PRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNL 467

Query: 672  SGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLP-SCYDFV 730
            +G +   +G L  LR + +  N + GPIP E   L+ L IL +  N  +G +P    +  
Sbjct: 468  TGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLT 527

Query: 731  CIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNN 790
             ++ + +  N L G + E   F+   L +LDLS N  +G IP     L  L+YL L  N 
Sbjct: 528  LLQGLRMYSNDLEGPIPE-EMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNK 586

Query: 791  LEGEVPIQLCRLNQLQLLDLSNNNLHGHIP----SCFDNTTLHERYNNGSSLQPFETSFV 846
              G +P  L  L+ L   D+S+N L G IP    +   N  L+  ++N           +
Sbjct: 587  FNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNN----------L 636

Query: 847  IMGGMDVDPKK-QILESFDFTTKSITYTYQGRVPSLLSG------LDLSCNRLIGHIPPQ 899
            + G +  +  K ++++  D +       + G +P  L        LD S N L GHIP +
Sbjct: 637  LTGTIPKELGKLEMVQEIDLSNN----LFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDE 692

Query: 900  I-GNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFS 958
            +   +  I +LNLS N+ +G IP +F N+ ++ SLDLS N L+ +IP  L  L+TL    
Sbjct: 693  VFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLK 752

Query: 959  VAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEAS 1007
            +A NNL G +PE    F   N S   GN  LCG   P  + P T+ + S
Sbjct: 753  LASNNLKGHVPESGV-FKNINASDLMGNTDLCGSKKP--LKPCTIKQKS 798




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1077
255581263912 serine-threonine protein kinase, plant-t 0.703 0.831 0.495 0.0
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.894 0.657 0.429 0.0
2240980081097 predicted protein [Populus trichocarpa] 0.931 0.914 0.4 0.0
224073422969 predicted protein [Populus trichocarpa] 0.839 0.932 0.412 1e-179
224142481781 predicted protein [Populus trichocarpa] 0.688 0.950 0.471 1e-178
2241239841016 predicted protein [Populus trichocarpa] 0.885 0.938 0.402 1e-178
224112245876 predicted protein [Populus trichocarpa] 0.794 0.977 0.398 1e-178
2240734361014 predicted protein [Populus trichocarpa] 0.893 0.948 0.397 1e-177
3594827351097 PREDICTED: receptor-like protein 12-like 0.959 0.941 0.379 1e-176
224124490981 predicted protein [Populus trichocarpa] 0.808 0.887 0.414 1e-173
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/805 (49%), Positives = 527/805 (65%), Gaps = 47/805 (5%)

Query: 282  SLNTLDLSYNNFTET----------------------VTTTTQGFPHFKSLKELYMDDAR 319
            SL  LDLSYN+F E+                      V    Q  P+F++L+ELY+D  +
Sbjct: 129  SLEVLDLSYNSFNESILSSLSEFSSLKSLNLGFNPFEVPIQAQDLPNFENLEELYLD--K 186

Query: 320  IALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLP 379
            I L  SFLQ +G  M S++ LSLS   ++     + QGLC L+HL+ L ++ N+  G LP
Sbjct: 187  IELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV-QGLCELIHLRVLDVSSNEFHGILP 244

Query: 380  WCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLK 439
            WCL+N+TSL++LD+SSNQ +G IS+SPL  L S+ DL +S+NHFQ+P SL P FNHS LK
Sbjct: 245  WCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFSLGPFFNHSNLK 304

Query: 440  IFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIK 499
                +NN I  E  E HS   P FQL S++ S GY    TFP FLY+Q++L++V LSH+ 
Sbjct: 305  HIRGQNNAIYLEA-ELHS--APRFQLISIIFS-GYGICGTFPNFLYHQNNLQFVDLSHLS 360

Query: 500  MNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGD 559
            +  EFPNWLL NNT+L  L LVN+SL G  +LP+H H  L  LD+S N+   HIPLEIG 
Sbjct: 361  LKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGT 420

Query: 560  ILSRLTVFNISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALS 619
             L +L + N+S N  DGSIPSSFGNMN L+ LDLSNNQL+G IPEHLA GC SL +L LS
Sbjct: 421  FLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILS 480

Query: 620  NNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWL 679
            NN+L+G MFS+ FNLTNL WL+L+ NHF G IP+SLSK S+L  + LS+N LSG IP W+
Sbjct: 481  NNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIMDLSDNHLSGMIPGWI 539

Query: 680  GNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSK 739
            GNL+ L+++I+  N ++GPIP+EFCQL  L++LD+++N++SG LPSC     I  VHLS+
Sbjct: 540  GNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQ 599

Query: 740  NMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQL 799
            NM+ G      F     L+ LDLS N + G IP  + G++ L  L L  N  +GE+P Q+
Sbjct: 600  NMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQI 658

Query: 800  CRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQI 859
            C L QL L+ L++NNL G IPSC        + +   SL P              P + +
Sbjct: 659  CGLYQLSLIVLADNNLSGSIPSCL-------QLDQSDSLAPDVPPVPNPLNPYYLPVRPM 711

Query: 860  LESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGP 919
                 FTTK  +Y+YQG++ S +SG+D SCN+L G IPP++GN + I +LNLS+N   GP
Sbjct: 712  Y----FTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGP 767

Query: 920  IPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFN 979
            IPSTFSNL+ IESLDLSYN L+  IP QL+EL  L+ FSVA+NNL GK P+R  QFATF 
Sbjct: 768  IPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKTPKRTGQFATFE 827

Query: 980  ESSYEGNPFLCGPPLPICIS---PTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFG 1036
             SSYEGNP LCG PLP   +    ++ P AS  +E ++N +DM+ F+ +F  SY  VI G
Sbjct: 828  VSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDE-ESNFLDMNTFYGSFIVSYTFVIIG 886

Query: 1037 IVAVLYVNARWRRRWFYLVEMWTTS 1061
            +  VLY+N +WRR WF  V++  +S
Sbjct: 887  MFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482735|ref|XP_003632821.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1077
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.819 0.883 0.332 1.6e-116
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.594 0.590 0.364 2.1e-113
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.524 0.622 0.344 2.4e-108
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.751 0.907 0.322 2.1e-100
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.765 0.844 0.326 1.4e-96
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.753 0.868 0.315 8.6e-88
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.569 0.635 0.310 2.8e-73
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.566 0.520 0.290 3.7e-58
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.569 0.490 0.283 3.2e-46
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.698 0.600 0.266 4.8e-51
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1148 (409.2 bits), Expect = 1.6e-116, P = 1.6e-116
 Identities = 311/934 (33%), Positives = 457/934 (48%)

Query:   170 DIKGPKRLSRLNNLKVFDLSGNLFNNXXXXXXXXXXXXXXXXXYDNRLEGSIDVKEFDSL 229
             D++G K LSRL NL++ DLS + FNN                   N +     VKEF  L
Sbjct:    61 DVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDL 120

Query:   230 SNLEELDMSYNEIDNFEVP-QACSGLRKLSYLHLLRVGIR-DGSKLLQSMGSFPSLNTLD 287
             +NLE LD+  N   N  +P Q  + LR+   L +L +      S++   + S  SL +L 
Sbjct:   121 TNLEHLDLRGNRF-NGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLS 179

Query:   288 LSYNNFXXXXXXXXQGFPHFKSLKEL----YMDDARIALNTSF-------LQIIGESMPS 336
             L  NN           FP  K L++L     +D +R   N S        L+ +     S
Sbjct:   180 LWGNNMGGP-------FPA-KELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLS 231

Query:   337 IQYXXXXXXXXXXXXRTLD-QGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVXX 395
                            +T    G CP  +++EL +++N L G  P CL ++T LR+LD+  
Sbjct:   232 DNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSS 291

Query:   396 XXXXXXXXXXPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDXXXXXXXXXXXXS 455
                        L +L S+E L L  N+F+   SL  L N S+LK+               
Sbjct:   292 NQLTGNVPSA-LANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFE 350

Query:   456 HSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKL 515
              S   P FQL  + L S   + +  P FL +Q DL +V LS  +++  FP+WLLENNTKL
Sbjct:   351 TSWK-PKFQLVVIALRSCNLEKV--PHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKL 407

Query:   516 RQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLE-IGDILSRLTVFNISMNAL 574
               L L N+S    F+LP  +H  L  L+VS N F  H+ L+  G IL  L   N++ N  
Sbjct:   408 EVLLLQNNSFTS-FQLPKSAHNLL-FLNVSVNKFN-HLFLQNFGWILPHLVCVNLAYNGF 464

Query:   575 DGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVXXXXXXXXXXXXEGHMFSRNFNL 634
              G++PSS  NM  ++FLDLS+N+  G++P     GC              G +F    N 
Sbjct:   465 QGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANF 524

Query:   635 TNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNH 694
             T L  + ++ N F G I +      SL  L +SNN L+G IP W+G    L  + +  N 
Sbjct:   525 TRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNM 584

Query:   695 IEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHL-SKNMLHGQLKEGTFFN 753
             +EG IP     +  LQ+LD+S N +SG +P     +    V L   N L G + +    N
Sbjct:   585 LEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLN 644

Query:   754 CLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIXXXXXXXXXXXXXXXX 813
                +++LDL  N L+GN+P+ ++    +S L+L  NN  G++P                 
Sbjct:   645 ---VIVLDLRNNRLSGNLPEFIN-TQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNN 700

Query:   814 XXHGHIPSCFDNTT--LHE-----RYNN----GSSLQP--FETSFVIMGGMDVDPKKQIL 860
               +G IPSC  NT+  L +     RY+     G++  P  FE S +++   ++  +    
Sbjct:   701 KFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFE-SLLMIDEFNMVNETNSQ 759

Query:   861 ESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPI 920
                +F TK     Y G    LL G+DLS N L G IP ++G L +++ LNLSHNNL+G I
Sbjct:   760 TKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVI 819

Query:   921 PSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNE 980
               +FS L+N+ESLDLS+N+L   IP QL ++ +LAVF+V+YNNLSG +P+   QF TF  
Sbjct:   820 LESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQ-GRQFNTFET 878

Query:   981 SSYEGNPFLCGPPLPICISPTTMPEASPSNEGDNNLIDMDIFFITFTTSYVIVIFGIVAV 1040
              SY GNP LCG  + I  +           E D + +DM+ F+ +F  +YV ++ GI+A 
Sbjct:   879 QSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILAS 938

Query:  1041 LYVNARWRRRWFYLVEMWTTSCYYFVIDNLIPTR 1074
             L  ++ W R WFY+V+ +       +  N   T+
Sbjct:   939 LSFDSPWSRAWFYIVDAFVLKVRNMLWQNTAGTK 972


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_1573000001
hypothetical protein (1097 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1077
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-50
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-30
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  223 bits (569), Expect = 4e-60
 Identities = 188/609 (30%), Positives = 275/609 (45%), Gaps = 99/609 (16%)

Query: 388 LRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPLFNHSRLKIFDAENNE 447
           ++ +++S+NQL G I        +S+  L LS+N+F   I    + N   L+  D  NN 
Sbjct: 95  IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDLSNNM 151

Query: 448 INAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPNW 507
           ++ EI                       D  +F         L+ + L    +  + PN 
Sbjct: 152 LSGEI---------------------PNDIGSF-------SSLKVLDLGGNVLVGKIPNS 183

Query: 508 LLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVF 567
           L  N T L  L+L ++ LVG     +   K L+ + +  NN  G IP EIG  L+ L   
Sbjct: 184 L-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHL 241

Query: 568 NISMNALDGSIPSSFGNMNFLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHM 627
           ++  N L G IPSS GN+  LQ+L L  N+L+G IP  +      L SL LS+N+L G +
Sbjct: 242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEI 300

Query: 628 FSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLG---NLTV 684
                 L NL  L L  N+F G+IP +L+    LQ L L +N  SG+IP+ LG   NLTV
Sbjct: 301 PELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTV 360

Query: 685 LRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLP-SCYDFVCIEQVHLSKNMLH 743
           L    +  N++ G IP   C    L  L +  N++ G +P S      + +V L  N   
Sbjct: 361 LD---LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS 417

Query: 744 GQLKEGTFFNCLTLM-ILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRL 802
           G+L     F  L L+  LD+S N+L G I  R   +  L  L LA N   G +P      
Sbjct: 418 GELPSE--FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP-DSFGS 474

Query: 803 NQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILES 862
            +L+ LDLS N   G +P                                          
Sbjct: 475 KRLENLDLSRNQFSGAVPRKL--------------------------------------- 495

Query: 863 FDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPS 922
                        G +  L+  L LS N+L G IP ++ +  K+ +L+LSHN L+G IP+
Sbjct: 496 -------------GSLSELMQ-LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPA 541

Query: 923 TFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESS 982
           +FS +  +  LDLS N+LS +IP  L  + +L   ++++N+L G +P   A F   N S+
Sbjct: 542 SFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGA-FLAINASA 600

Query: 983 YEGNPFLCG 991
             GN  LCG
Sbjct: 601 VAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1077
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.58
PLN03150623 hypothetical protein; Provisional 99.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.85
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.43
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.42
KOG4341483 consensus F-box protein containing LRR [General fu 98.37
KOG4341483 consensus F-box protein containing LRR [General fu 98.37
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
PRK15386426 type III secretion protein GogB; Provisional 97.81
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.75
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.53
PRK15386426 type III secretion protein GogB; Provisional 97.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.4
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.29
KOG4308478 consensus LRR-containing protein [Function unknown 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.3
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.08
KOG4308478 consensus LRR-containing protein [Function unknown 94.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.73
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.16
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.76
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.95
smart0037026 LRR Leucine-rich repeats, outliers. 86.95
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.66
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.18
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.69
smart0037026 LRR Leucine-rich repeats, outliers. 85.69
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.33
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-68  Score=683.89  Aligned_cols=584  Identities=36%  Similarity=0.526  Sum_probs=417.2

Q ss_pred             cHHHHHHHHhchhhccCCCCcccCCCCCCCCCCCccccceEecCCCCceEEEEcCCcccCccccccccccccCcCCcEee
Q 001439           28 LNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCCQWERVSCNNTMGRVVVLDLSQTHRGEYWYLNASLFTPFQQLESLD  107 (1077)
Q Consensus        28 ~~~~~~all~~k~~~~~~~~~l~~w~~~~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~~~~~~~~~~~l~~L~~L~  107 (1077)
                      +++|++||++||+++.+|.+.+.+|.. +  ++||.|.||+|++ .++|+.+||+++.+.+                   
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~-~--~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~-------------------   83 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNS-S--ADVCLWQGITCNN-SSRVVSIDLSGKNISG-------------------   83 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCC-C--CCCCcCcceecCC-CCcEEEEEecCCCccc-------------------
Confidence            578999999999999888888999964 3  7899999999986 5789999998764332                   


Q ss_pred             CCCCCCCccccchhhhhccCCCCCcEEeCCCCCCCchhhHHhh-ccCCCCEEeCCCCcCCCccCCcchhhccCCCCCcEE
Q 001439          108 LRDNDIAGCVENEGLERLSRLSNLKMLNLVGNLFNNSILSSLA-RLSSLTSLDLSANRLKGSIDIKGPKRLSRLNNLKVF  186 (1077)
Q Consensus       108 Ls~n~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~-~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~l~~L~~L  186 (1077)
                              ..+    ..+..+++|++|+|++|.+++.+|..+. ++++|++|+|++|.+.+.+|.      +.+++|++|
T Consensus        84 --------~~~----~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~------~~l~~L~~L  145 (968)
T PLN00113         84 --------KIS----SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR------GSIPNLETL  145 (968)
T ss_pred             --------cCC----hHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc------cccCCCCEE
Confidence                    221    1256667777777777777666666554 677777777777777766552      446677777


Q ss_pred             ECCCCCCCchhhHhhhccCCCcEEEcCCCCCCCCcChhhhhcccccceeecCCCcCCCCchhhhccCCcccceeeecccc
Q 001439          187 DLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNLEELDMSYNEIDNFEVPQACSGLRKLSYLHLLRVG  266 (1077)
Q Consensus       187 ~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~l~~~~  266 (1077)
                      ++++|.+.+..|..++++++|++|++++|.+.+.++ .                                          
T Consensus       146 ~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p-~------------------------------------------  182 (968)
T PLN00113        146 DLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIP-N------------------------------------------  182 (968)
T ss_pred             ECcCCcccccCChHHhcCCCCCEEECccCcccccCC-h------------------------------------------
Confidence            777777666666666666666666555555432221 1                                          


Q ss_pred             cCCcchhhhhcCCCCCcceeccccCcccccccccccCCccCccccEEecchhHhhhhhhhHHHHhccCCCCcEEecccCc
Q 001439          267 IRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQYLSLSNSS  346 (1077)
Q Consensus       267 ~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~l~~~l~~L~~L~L~~~~  346 (1077)
                                                                                                      
T Consensus       183 --------------------------------------------------------------------------------  182 (968)
T PLN00113        183 --------------------------------------------------------------------------------  182 (968)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCcccccccccCCCCccEEEccCCcCCCCchhhhcCCCCCcEEecCCCccccccCCccccCCCCcceeecCCCeeeee
Q 001439          347 VSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIP  426 (1077)
Q Consensus       347 ~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~i~~~~l~~l~~L~~L~L~~n~l~~~  426 (1077)
                                .++.+++|++|++++|.+++.+|..++++++|++|++++|.+.+.+ +..+.+                 
T Consensus       183 ----------~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~-p~~l~~-----------------  234 (968)
T PLN00113        183 ----------SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEI-PYEIGG-----------------  234 (968)
T ss_pred             ----------hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcC-ChhHhc-----------------
Confidence                      2222334444444444444444555555555555555555443322 111111                 


Q ss_pred             cCcccccCCCCccEEecCCCcceeeeeccccCCCCccceeEEeeccCCCCCCccchhccCCCcccEEEeccCCCCCCCch
Q 001439          427 ISLEPLFNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEYVRLSHIKMNEEFPN  506 (1077)
Q Consensus       427 ~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~p~~l~~~~~L~~L~l~~~~~~~~~p~  506 (1077)
                                                                                                      
T Consensus       235 --------------------------------------------------------------------------------  234 (968)
T PLN00113        235 --------------------------------------------------------------------------------  234 (968)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhcCCCccEEEccCCCCcCCCccCcCCCCCccEEEcCCCcccccCCchhhccCCCCcEEEcccCcccccCCccCCCCC
Q 001439          507 WLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLLDVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFGNMN  586 (1077)
Q Consensus       507 ~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~  586 (1077)
                                                   +++|++|++++|.+++.+|..+.. +++|++|++++|.+.+.+|..+.+++
T Consensus       235 -----------------------------l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~  284 (968)
T PLN00113        235 -----------------------------LTSLNHLDLVYNNLTGPIPSSLGN-LKNLQYLFLYQNKLSGPIPPSIFSLQ  284 (968)
T ss_pred             -----------------------------CCCCCEEECcCceeccccChhHhC-CCCCCEEECcCCeeeccCchhHhhcc
Confidence                                         122333333333333344444443 67778888888888777777777778


Q ss_pred             CCCEEEccCCcCCCCcchHhhhcCCcCcEEEcccccCCCcccccccCCCccCeeeccCccccccCCccccCCCCCcEEEc
Q 001439          587 FLQFLDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFL  666 (1077)
Q Consensus       587 ~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L  666 (1077)
                      +|++|++++|.+.+.+|..+ ..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++
T Consensus       285 ~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~L  363 (968)
T PLN00113        285 KLISLDLSDNSLSGEIPELV-IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDL  363 (968)
T ss_pred             CcCEEECcCCeeccCCChhH-cCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEEC
Confidence            88888888887776666554 35666666666666666555555555555555555555555555555555555555555


Q ss_pred             ccCcCCCCCCccccCCCCccEEECCCCcccCCCCccccCCCCCCEEeccCCcCCcCCCCCCCCccccEEEccCCcccccc
Q 001439          667 SNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHGQL  746 (1077)
Q Consensus       667 ~~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~~L~~L~l~~n~~~~~i  746 (1077)
                      ++|++.+.+|.++..+++|+.|++++|.+.+.+|..+..+++|+.|++++|                       .+.+.+
T Consensus       364 s~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n-----------------------~l~~~~  420 (968)
T PLN00113        364 STNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDN-----------------------SFSGEL  420 (968)
T ss_pred             CCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCC-----------------------EeeeEC
Confidence            555555555555555555555555555555555555555555555555555                       444555


Q ss_pred             CcccccccccccEeccccccCCCCCCccccCCCCCCEEEccCccccccCchhccCCCCCCEEECcCCcCCCCCCcccccC
Q 001439          747 KEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNT  826 (1077)
Q Consensus       747 ~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~  826 (1077)
                      |. .|.++++|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+ ..++|+.||+++|++++.+|..+.++
T Consensus       421 p~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l  498 (968)
T PLN00113        421 PS-EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSL  498 (968)
T ss_pred             Ch-hHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhh
Confidence            55 78888899999999999999999988899999999999999998888766 46899999999999999999877665


Q ss_pred             cccccccCCCCCCCcccceeecCCCcCCcccccccceeeccccceeecccCcCCCCceEECCCCcCCCCCcccccccccC
Q 001439          827 TLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKI  906 (1077)
Q Consensus       827 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~L  906 (1077)
                      .                                                     .|+.|+|++|++++.+|..++++++|
T Consensus       499 ~-----------------------------------------------------~L~~L~Ls~N~l~~~~p~~~~~l~~L  525 (968)
T PLN00113        499 S-----------------------------------------------------ELMQLKLSENKLSGEIPDELSSCKKL  525 (968)
T ss_pred             h-----------------------------------------------------ccCEEECcCCcceeeCChHHcCccCC
Confidence            4                                                     68899999999999999999999999


Q ss_pred             ceeeCcCCcCCCCCCccccCCCCCCeEeCCCCcCcccCCCcccCCCCcceEEcccccccccCCccccccCCCCcccccCC
Q 001439          907 QTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGN  986 (1077)
Q Consensus       907 ~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~l~ls~N~l~g~~p~~~~~~~~~~~~~~~gN  986 (1077)
                      ++|+|++|.++|.+|..|+.+++|+.|||++|+++|.+|..+..+++|+++++++|+++|.+|. .++|.++...++.||
T Consensus       526 ~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~-~~~~~~~~~~~~~~n  604 (968)
T PLN00113        526 VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS-TGAFLAINASAVAGN  604 (968)
T ss_pred             CEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC-cchhcccChhhhcCC
Confidence            9999999999999999999999999999999999999999999999999999999999999998 788999999999999


Q ss_pred             CCCCCCC
Q 001439          987 PFLCGPP  993 (1077)
Q Consensus       987 ~~lC~~~  993 (1077)
                      |.+||.+
T Consensus       605 ~~lc~~~  611 (968)
T PLN00113        605 IDLCGGD  611 (968)
T ss_pred             ccccCCc
Confidence            9999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1077
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-47
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-47
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-05
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 186 bits (472), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 170/559 (30%), Positives = 254/559 (45%), Gaps = 72/559 (12%) Query: 483 FLYNQHDLEYVRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPIHSHKQLRLL 542 FL + L+++ +S K++ +F + + T+L+ L++ ++ VGP +P K L+ L Sbjct: 215 FLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVGP--IPPLPLKSLQYL 271 Query: 543 DVSKNNFQGHIPLEIGDILSRLTVFNISMNALDGSIPSSFG------------------- 583 +++N F G IP + LT ++S N G++P FG Sbjct: 272 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 331 Query: 584 ------NMNFLQFLDLSNNQLTGEIPEHLAMGCVXXXXXXXXXXXXEGHMF---SRNFNL 634 M L+ LDLS N+ +GE+PE L G + +N Sbjct: 332 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 391 Query: 635 TNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNH 694 T L L L+ N F G+IP +LS CS L L LS N LSG IP LG+L+ LR + + N Sbjct: 392 T-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450 Query: 695 IEGPIPLEFCQLRILQILDISDNNISGSLPS-CYDFVCIEQVHLSKNMLHGQLKE--GTF 751 +EG IP E ++ L+ L + N+++G +PS + + + LS N L G++ + G Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 752 FNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIXXXXXXXXXXXXXX 811 N L IL LS N +GNIP + L +L L N G +P Sbjct: 511 EN---LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFI 567 Query: 812 XXXXHGHIPS------CFDNTTL-------HERYNNGSSLQPFETSFVIMGGMDVDPKKQ 858 + +I + C L E+ N S+ P + + GG Sbjct: 568 AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGH------- 620 Query: 859 ILESFDFTTKSITYTYQGRVPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAG 918 S T+ G + LD+S N L G+IP +IG++ + LNL HN+++G Sbjct: 621 ---------TSPTFDNNGS----MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG 667 Query: 919 PIPSTFSNLRNIESLDLSYNKLSWKIPYQLVELNTLAVFSVAYNNLSGKIPERAAQFATF 978 IP +LR + LDLS NKL +IP + L L ++ NNLSG IPE QF TF Sbjct: 668 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETF 726 Query: 979 NESSYEGNPFLCGPPLPIC 997 + + NP LCG PLP C Sbjct: 727 PPAKFLNNPGLCGYPLPRC 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1077
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-159
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-54
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-59
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-65
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-42
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-50
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-25
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  489 bits (1262), Expect = e-159
 Identities = 208/784 (26%), Positives = 336/784 (42%), Gaps = 95/784 (12%)

Query: 257  LSYLHLLRVGIR-DGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYM 315
            ++ + L    +    S +  S+ S   L +L LS ++   +V+    GF    SL  L +
Sbjct: 52   VTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS----GFKCSASLTSLDL 107

Query: 316  DDARIALNTSFLQIIGESMPSIQYLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLR 375
                ++   + L  +G S   +++L++S++++    +    G   L  L+ L ++ N + 
Sbjct: 108  SRNSLSGPVTTLTSLG-SCSGLKFLNVSSNTLDFPGKV--SGGLKLNSLEVLDLSANSIS 164

Query: 376  GSLPWCLA---NMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLILSDNHFQIPISLEPL 432
            G+             L+ L +S N++ G +    +    ++E L +S N+F   I    L
Sbjct: 165  GANVVGWVLSDGCGELKHLAISGNKISGDV---DVSRCVNLEFLDVSSNNFSTGIPF--L 219

Query: 433  FNHSRLKIFDAENNEINAEIIESHSLTTPNFQLQSLLLSSGYRDGITFPKFLYNQHDLEY 492
             + S L+  D   N+++ +                              + +    +L+ 
Sbjct: 220  GDCSALQHLDISGNKLSGDF----------------------------SRAISTCTELKL 251

Query: 493  VRLSHIKMNEEFPNWLLENNTKLRQLSLVNDSLVGPFRLPI-HSHKQLRLLDVSKNNFQG 551
            + +S  +     P   L     L+ LSL  +   G     +  +   L  LD+S N+F G
Sbjct: 252  LNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 308

Query: 552  HIPLEIGDILSRLTVFNISMNALDGSIP-SSFGNMNFLQFLDLSNNQLTGEIPEHLAMGC 610
             +P   G   S L    +S N   G +P  +   M  L+ LDLS N+ +GE+PE L    
Sbjct: 309  AVPPFFGS-CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS 367

Query: 611  VSLRSLALSNNNLEGHMFSR--NFNLTNLIWLQLEGNHFVGEIPQSLSKCSSLQGLFLSN 668
             SL +L LS+NN  G +           L  L L+ N F G+IP +LS CS L  L LS 
Sbjct: 368  ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF 427

Query: 669  NSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQILDISDNNISGSLPSCYD 728
            N LSG IP  LG+L+ LR + +  N +EG IP E   ++ L+ L +  N+++G +PS   
Sbjct: 428  NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-- 485

Query: 729  FVCIEQVHLSKNMLHGQLKEGTFFNCLTLMILDLSYNHLNGNIPDRVDGLSQLSYLILAH 788
                                    NC  L  + LS N L G IP  +  L  L+ L L++
Sbjct: 486  ----------------------LSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523

Query: 789  NNLEGEVPIQLCRLNQLQLLDLSNNNLHGHIPSCFDNTTLHERYNNGSSLQPFE------ 842
            N+  G +P +L     L  LDL+ N  +G IP+     +     N  +  +         
Sbjct: 524  NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM 583

Query: 843  TSFVIMGGMDVDPKKQILESFDFTTKSITY-----TYQGRVP------SLLSGLDLSCNR 891
                   G  ++ +    E  +  +           Y G           +  LD+S N 
Sbjct: 584  KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM 643

Query: 892  LIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSYNKLSWKIPYQLVEL 951
            L G+IP +IG++  +  LNL HN+++G IP    +LR +  LDLS NKL  +IP  +  L
Sbjct: 644  LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 703

Query: 952  NTLAVFSVAYNNLSGKIPERAAQFATFNESSYEGNPFLCGPPLPICISPTTMPEASPSNE 1011
              L    ++ NNLSG IPE   QF TF  + +  NP LCG PLP C  P+     +    
Sbjct: 704  TMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRC-DPSNADGYAHHQR 761

Query: 1012 GDNN 1015
              ++
Sbjct: 762  SHHH 765


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1077
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 87.7 bits (216), Expect = 8e-19
 Identities = 59/385 (15%), Positives = 113/385 (29%), Gaps = 41/385 (10%)

Query: 591 LDLSNNQLTGEIPEHLAMGCVSLRSLALSNNNLEGHMFSRNFNLTNLIWLQLEGNHFVGE 650
             L    +T  + +        + +L      ++         L NL  +    N     
Sbjct: 27  TVLGKTNVTDTVSQ---TDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTDI 81

Query: 651 IPQSLSKCSSLQGLFLSNNSLSGKIPRWLGNLTVLRHIIMPKNHIEGPIPLEFCQLRILQ 710
            P  L   + L  + ++NN ++   P           +   +     P+       R+  
Sbjct: 82  TP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 711 ILDISDNNISGSLPSCYDFVCIEQVHLSKNMLHG-------------QLKEGTFFNCLTL 757
             +   +  + S  +    +           L                           L
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 758 MILDLSYNHLNGNIPDRVDGLSQLSYLILAHNNLEGEVPIQLCRLNQLQLLDLSNNNLHG 817
             L  + N ++   P  +   + L  L L  N L+      L  L  L  LDL+NN +  
Sbjct: 200 ESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISN 255

Query: 818 HIPSCFDNTTLHERYNNGSSLQPFETSFVIMGGMDVDPKKQILESFDFTTKSITYTYQGR 877
             P               + L   +     +  +        L + +     +       
Sbjct: 256 LAPLS-----------GLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPIS 304

Query: 878 VPSLLSGLDLSCNRLIGHIPPQIGNLTKIQTLNLSHNNLAGPIPSTFSNLRNIESLDLSY 937
               L+ L L  N +    P  + +LTK+Q L  ++N ++    S+ +NL NI  L   +
Sbjct: 305 NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDV--SSLANLTNINWLSAGH 360

Query: 938 NKLSWKIPYQLVELNTLAVFSVAYN 962
           N++S   P  L  L  +    +   
Sbjct: 361 NQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1077
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.9
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.86
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.84
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.75
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.73
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.71
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.63
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.61
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.51
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=273.61  Aligned_cols=297  Identities=28%  Similarity=0.411  Sum_probs=169.8

Q ss_pred             CCCCHHHHHHHHHCHHHCCCCCCCCCCCCCCCCCCCCC--CCCCEEECCCC--CCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             44748999999820000038877656887899998875--64411746998--946999827766676322343325668
Q 001439           25 EGCLNHERFALLQLKLFFIDPYNYLLDWVDDEGATDCC--QWERVSCNNTM--GRVVVLDLSQTHRGEYWYLNASLFTPF  100 (1077)
Q Consensus        25 ~~~~~~~~~all~~k~~~~~~~~~~~~w~~~~~~~~~c--~w~gv~c~~~~--~~v~~l~l~~~~~~~~~~~~~~~~~~l  100 (1077)
                      ..|+++||+||++||+++.+|. .+++|.. +  +|||  .|+||+|+...  +||+.++|++....+...+. ..    
T Consensus         1 ~~c~~~e~~aLl~~k~~~~~~~-~l~sW~~-~--~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp-~~----   71 (313)
T d1ogqa_           1 ELCNPQDKQALLQIKKDLGNPT-TLSSWLP-T--TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIP-SS----   71 (313)
T ss_dssp             CCSCHHHHHHHHHHHHHTTCCG-GGTTCCT-T--SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECC-GG----
T ss_pred             CCCCHHHHHHHHHHHHHCCCCC-CCCCCCC-C--CCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCCC-HH----
T ss_conf             9989899999999999779998-6778899-9--999889488969748999479889989899888888798-47----


Q ss_pred             CCCCEEECCCCCCCCCCCCHHHHHCCCCCCCCEEECCC-CCCCCHHHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHCCC
Q ss_conf             67767648999888641001333203899986995899-97980136875226998888489996888658751011049
Q 001439          101 QQLESLDLRDNDIAGCVENEGLERLSRLSNLKMLNLVG-NLFNNSILSSLARLSSLTSLDLSANRLKGSIDIKGPKRLSR  179 (1077)
Q Consensus       101 ~~L~~L~L~~n~~~~~~~~~~~~~l~~l~~L~~L~Ls~-n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~  179 (1077)
                                              ++++++|++|+|++ |.+.+.+|..++++++|++|++++|++.+..+    ..+..
T Consensus        72 ------------------------l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~----~~~~~  123 (313)
T d1ogqa_          72 ------------------------LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP----DFLSQ  123 (313)
T ss_dssp             ------------------------GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC----GGGGG
T ss_pred             ------------------------HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCC----CCCCC
T ss_conf             ------------------------84675335202026543330024311454200110203564344332----22220


Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHCCCCC-CEEECCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             99986997899878951047542067885787578878897574433002666-26506778679874021103775665
Q 001439          180 LNNLKVFDLSGNLFNNSILSSLARLSSLRSLLLYDNRLEGSIDVKEFDSLSNL-EELDMSYNEIDNFEVPQACSGLRKLS  258 (1077)
Q Consensus       180 l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L-~~L~Ls~n~l~~~~~~~~~~~l~~L~  258 (1077)
                      +.+|++++++.|.+...+|..+.+++.|+.+++++|.+.+.++ ..+..+.++ +.++++.|+++... +..+..+.   
T Consensus       124 ~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip-~~~~~l~~l~~~l~~~~n~l~~~~-~~~~~~l~---  198 (313)
T d1ogqa_         124 IKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP-DSYGSFSKLFTSMTISRNRLTGKI-PPTFANLN---  198 (313)
T ss_dssp             CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECC-GGGGCCCTTCCEEECCSSEEEEEC-CGGGGGCC---
T ss_pred             HHHHCCCCCCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC---
T ss_conf             1110011112245555685122067400000023553356203-121443112323102246435332-43322222---


Q ss_pred             EEEECCCCCCCCCHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             44301345678402334208999854650446755455333356776676543771401475520316899730189975
Q 001439          259 YLHLLRVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTETVTTTTQGFPHFKSLKELYMDDARIALNTSFLQIIGESMPSIQ  338 (1077)
Q Consensus       259 ~L~l~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~l~~~l~~L~  338 (1077)
                                              ...+++.                           .+  ...+..+..... ++.++
T Consensus       199 ------------------------~~~l~l~---------------------------~~--~~~~~~~~~~~~-~~~l~  224 (313)
T d1ogqa_         199 ------------------------LAFVDLS---------------------------RN--MLEGDASVLFGS-DKNTQ  224 (313)
T ss_dssp             ------------------------CSEEECC---------------------------SS--EEEECCGGGCCT-TSCCS
T ss_pred             ------------------------CCCCCCC---------------------------CC--CCCCCCCCCCCC-CCCCC
T ss_conf             ------------------------2233333---------------------------34--332222222222-22211


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             77234575888854555565588774679835875789740311079987499367974543237863337787655642
Q 001439          339 YLSLSNSSVSNNSRTLDQGLCPLVHLQELHMADNDLRGSLPWCLANMTSLRILDVSSNQLIGSISSSPLIHLTSIEDLIL  418 (1077)
Q Consensus       339 ~L~L~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L  418 (1077)
                      .+++.++.+.+..+    .+..+++|+.|++++|.+++.+|..++++++|++|++++|+++|.+|  .+.++++|+.+++
T Consensus       225 ~l~~~~~~l~~~~~----~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP--~~~~L~~L~~l~l  298 (313)
T d1ogqa_         225 KIHLAKNSLAFDLG----KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP--QGGNLQRFDVSAY  298 (313)
T ss_dssp             EEECCSSEECCBGG----GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECC--CSTTGGGSCGGGT
T ss_pred             CCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEECCCCCCCCCCC--CCCCCCCCCHHHH
T ss_conf             12222222222222----22245544444476570666087688479999989795883516689--8666799897886


Q ss_pred             CCCEE
Q ss_conf             88732
Q 001439          419 SDNHF  423 (1077)
Q Consensus       419 ~~n~l  423 (1077)
                      .+|+.
T Consensus       299 ~~N~~  303 (313)
T d1ogqa_         299 ANNKC  303 (313)
T ss_dssp             CSSSE
T ss_pred             CCCCC
T ss_conf             88950



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure