Citrus Sinensis ID: 001480
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1071 | 2.2.26 [Sep-21-2011] | |||||||
| Q9P2D0 | 1353 | Inhibitor of Bruton tyros | yes | no | 0.403 | 0.319 | 0.306 | 1e-38 | |
| Q6NRS1 | 1339 | Inhibitor of Bruton tyros | N/A | no | 0.368 | 0.294 | 0.300 | 2e-36 | |
| Q6ZPR6 | 1352 | Inhibitor of Bruton tyros | yes | no | 0.342 | 0.271 | 0.328 | 3e-32 | |
| Q6P798 | 551 | RCC1 and BTB domain-conta | no | no | 0.172 | 0.335 | 0.384 | 3e-30 | |
| Q9FN03 | 440 | Ultraviolet-B receptor UV | no | no | 0.274 | 0.668 | 0.313 | 3e-30 | |
| Q5RCZ7 | 551 | RCC1 and BTB domain-conta | no | no | 0.408 | 0.793 | 0.266 | 5e-29 | |
| O95199 | 551 | RCC1 and BTB domain-conta | no | no | 0.408 | 0.793 | 0.266 | 5e-29 | |
| O95714 | 4834 | E3 ubiquitin-protein liga | no | no | 0.321 | 0.071 | 0.294 | 6e-29 | |
| Q9VR91 | 4912 | Probable E3 ubiquitin-pro | yes | no | 0.193 | 0.042 | 0.342 | 2e-28 | |
| Q4U2R1 | 4836 | E3 ubiquitin-protein liga | no | no | 0.309 | 0.068 | 0.290 | 2e-28 |
| >sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 162 bits (410), Expect = 1e-38, Method: Compositional matrix adjust.
Identities = 147/480 (30%), Positives = 228/480 (47%), Gaps = 48/480 (10%)
Query: 30 DLCLAVREGSLADVESALALLKKNGGNINSRNIFGLTPLHSAIWRNQVPIVRRLLAAGAD 89
D+ V +GS +++ L+ N I +++FG LH + ++ L+ G D
Sbjct: 20 DVLSVVTKGSENQIKAFLSSHCYNAATI--KDVFGRNALHLVSSCGKKGVLDWLIQKGVD 77
Query: 90 PDARDGESGWSSLHRALHFGHLAVASVLLQSGASITLEDCKSRTPVDLL--SGPVLQVVG 147
+D ESGW++LHR++ +GH+ LL+ G S+ ++D + + +DL+ P V
Sbjct: 78 LLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYIQDKEGLSALDLVMKDRPTHVVFK 137
Query: 148 SGYNSVATEVFSWGSGANYQLGTGNAHLQKLPCKVD--SLHGFVIKLISAAKFHSVAVTS 205
N+ T+V++WG N+ LG G+ + + P VD S G IK + KFHSV ++
Sbjct: 138 ---NTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIYIKQVVLCKFHSVFLSQ 194
Query: 206 LGEVYTWGYGRGGRLGHPDFDIHSGQAAVITPRRVTSGLGSRRVKTIAAAKHHTVLATEG 265
G+VYT G+G GGRLGH D + + PR V GL +AAAK HTV+ TE
Sbjct: 195 KGQVYTCGHGPGGRLGHGD------EQTCLVPRLV-EGLNGHNCSQVAAAKDHTVVLTED 247
Query: 266 GEVFTWGSNREGQLGYTSVDTQP-TPRRVSSLKLK---IIAVAAANKHTAVVSESGEVFT 321
G V+T+G N QLG + PR++ + LK II VAA HT + + V+T
Sbjct: 248 GCVYTFGLNIFHQLGIIPPPSSCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWTREA-VYT 306
Query: 322 WGCNREGQLG--YGTSNSASNYTPRVVESLKGKD--LVGVAAAKYHTIVLGADGERVIVA 377
G N GQLG + PR V +L KD L VAA+ T+ + G+ ++A
Sbjct: 307 MGLNG-GQLGCLLDPNGEKCVTAPRQVSALHHKDIALSLVAASDGATVCVTTRGDIYLLA 365
Query: 378 -RNLKKSGSTPLKF--------HRKIKL---HVVSIAAGMVHSTALTEDGALFYWASSDP 425
KK S L H + K+ H+ + A+ G +F W S +
Sbjct: 366 DYQCKKMASKQLNLKKVLVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVFCWRSVNS 425
Query: 426 DLR-CQQLYSMCGRNVV--SISAGKYWTAAVTATGDVY--MW--DGKKSKDNPPLVTRLH 478
L+ C+ Y R V I+ + VT G+ + W + +KS + +++ LH
Sbjct: 426 SLKQCRWAYP---RQVFISDIALNRNEILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLH 482
|
Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription. Homo sapiens (taxid: 9606) |
| >sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1071 | ||||||
| 224123724 | 1075 | predicted protein [Populus trichocarpa] | 0.989 | 0.986 | 0.729 | 0.0 | |
| 225439268 | 1076 | PREDICTED: uncharacterized protein LOC10 | 0.990 | 0.986 | 0.729 | 0.0 | |
| 255569510 | 1050 | conserved hypothetical protein [Ricinus | 0.964 | 0.983 | 0.708 | 0.0 | |
| 356571739 | 1061 | PREDICTED: uncharacterized protein LOC10 | 0.974 | 0.983 | 0.709 | 0.0 | |
| 356560879 | 1080 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.983 | 0.714 | 0.0 | |
| 296089288 | 1025 | unnamed protein product [Vitis vinifera] | 0.943 | 0.986 | 0.694 | 0.0 | |
| 357508731 | 1099 | Ankyrin repeat domain-containing protein | 0.987 | 0.962 | 0.683 | 0.0 | |
| 449484006 | 1084 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.991 | 0.979 | 0.675 | 0.0 | |
| 449468281 | 1085 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.979 | 0.675 | 0.0 | |
| 297828852 | 1081 | ankyrin repeat family protein [Arabidops | 0.985 | 0.976 | 0.639 | 0.0 |
| >gi|224123724|ref|XP_002319149.1| predicted protein [Populus trichocarpa] gi|222857525|gb|EEE95072.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1587 bits (4109), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 790/1083 (72%), Positives = 898/1083 (82%), Gaps = 23/1083 (2%)
Query: 3 ELLVSHHGQKQTLQSPARKSSLGGVQKDLCLAVREGSLADVESALALLKKNGGNINSRNI 62
E+LVS GQK LQ+ A+K S GG QKDL VREGSLADV+ ALAL KKNGGNIN+RN+
Sbjct: 2 EVLVSPQGQKYNLQTAAQKFSSGGSQKDLWHVVREGSLADVDLALALHKKNGGNINARNV 61
Query: 63 FGLTPLHSAIWRNQVPIVRRLLAAGADPDARDGESGWSSLHRALHFGHLAVASVLLQSGA 122
FGLTPLH A WRN +PIV+RLL AGADPDARDGESGWSSLHRALHFGHLAVAS+LLQSGA
Sbjct: 62 FGLTPLHIATWRNHIPIVKRLLLAGADPDARDGESGWSSLHRALHFGHLAVASILLQSGA 121
Query: 123 SITLEDCKSRTPVDLLSGPVLQVVGSGYNSVATEVFSWGSGANYQLGTGNAHLQKLPCKV 182
S TLEDCKSRTPVDLLSGPVLQV+ GYNSVATEVFSWGSGANYQLGTGN H+QKLPCKV
Sbjct: 122 STTLEDCKSRTPVDLLSGPVLQVIRDGYNSVATEVFSWGSGANYQLGTGNTHIQKLPCKV 181
Query: 183 DSLHGFVIKLISAAKFHSVAVTSLGEVYTWGYGRGGRLGHPDFDIHSGQAAVITPRRVTS 242
D+LHG +KL+SAAKFHS AV++ GEVYTWG+GRGGRLGHP+FDIHSGQAAVITPR+VTS
Sbjct: 182 DALHGSFVKLVSAAKFHSAAVSASGEVYTWGFGRGGRLGHPEFDIHSGQAAVITPRQVTS 241
Query: 243 GLGSRRVKTIAAAKHHTVLATEGGEVFTWGSNREGQLGYTSVDTQPTPRRVSSLKLKIIA 302
GLGSRRVK IAAAKHHTVLATEGGEVFTWGSNREGQLGYT VDTQPTPRRVSSL+ +I+A
Sbjct: 242 GLGSRRVKAIAAAKHHTVLATEGGEVFTWGSNREGQLGYT-VDTQPTPRRVSSLRSRIVA 300
Query: 303 VAAANKHTAVVSESGEVFTWGCNREGQLGYGTSNSASNYTPRVVESLKGKDLVGVAAAKY 362
VAAANKHTAVVS+SGEVFTWGCNREGQLGYGTSNSASNYTPR VE LKGK L GV+ AKY
Sbjct: 301 VAAANKHTAVVSDSGEVFTWGCNREGQLGYGTSNSASNYTPRAVEYLKGKVLTGVSVAKY 360
Query: 363 HTIVLGADGE------------RVIVARNLKKSGSTPLKFHRKIKLHVVSIAAGMVHSTA 410
HTIVLGA GE RV++ARNLKKSG+TP K HR +LHV +IAAGMVHS A
Sbjct: 361 HTIVLGAGGEVYTWGHRLVTPRRVVIARNLKKSGNTPWKSHRLERLHVAAIAAGMVHSLA 420
Query: 411 LTEDGALFYWASSDPDLRCQQLYSMCGRNVVSISAGKYWTAAVTATGDVYMWDGKKSKDN 470
LT+DG LFYWAS+DPDLRCQQLYS+CG N+VSIS GKYW A VTATGDVYMWDGKK KD
Sbjct: 421 LTDDGTLFYWASADPDLRCQQLYSLCGNNIVSISTGKYWAAVVTATGDVYMWDGKKGKDE 480
Query: 471 PPLVTRLHGIKKATSVSVGETHLLIVGSLYHPIYPPNVAKNPQKLKLNGRNDLEEFYEDF 530
PP VTRLHG+KKATSVSVGETHLLIVGSLYHPIYP + K+PQ + R+++EE ED
Sbjct: 481 PPAVTRLHGVKKATSVSVGETHLLIVGSLYHPIYPSSDDKSPQTQMVQVRDEIEELEEDS 540
Query: 531 MFND-ESNNMPSAIDKDDSGVRLAPSLKSLCENVAAQCLVEPRNALQLLEISDSLGADDL 589
MFND ESN+M S ++KDDSG++ PSLK+LCE AA+ LVEPRN +Q+LEI+DSLGA+DL
Sbjct: 541 MFNDAESNHMLSVVEKDDSGLKSIPSLKALCEKAAAESLVEPRNVIQMLEIADSLGAEDL 600
Query: 590 KKHCEDIAIRNLDYILTVSSHSFASASLDILADLEKSLDLRSSESWSYRRLPTPTATFPV 649
+KHCEDIAI NLDYILTVSSH+F SAS +ILA+LE LD RSSE WSYR LPTPTAT PV
Sbjct: 601 RKHCEDIAIHNLDYILTVSSHAFGSASPEILANLENLLDQRSSEPWSYRSLPTPTATLPV 660
Query: 650 IINSEEEDSENEVLRTRDNHTKKSTLKNEGDNRLDSFFEPKADANQEISKQVRALRKKLQ 709
IIN EED E+EV RTRDN++ KST ++ D +L+SF +PK D ISKQVRALRKKLQ
Sbjct: 661 IINI-EEDGESEVSRTRDNYSDKSTPRSVIDQQLNSFLQPKDDP---ISKQVRALRKKLQ 716
Query: 710 QIEMLEVKLSNGHILDEQQIAKLQTKSVLERSLAELGVPIELPQAIAASAASPDGRGNKK 769
QIEMLE K S GHILD+QQIAKLQT+S+LE SLAELG P+E A+S+ SPD +G+KK
Sbjct: 717 QIEMLETKQSKGHILDDQQIAKLQTRSILESSLAELGAPVETALVKASSSVSPDEKGSKK 776
Query: 770 AGVSKKQKKKSKQKAAQVEAVSDFSVSEVGSNAAKDFFDTEITEVSKKKEEDAMSEGNVA 829
+ VS+KQ++KSKQ+A Q E S F+ ++ S++ K+F D E+++ KEE+ G+V
Sbjct: 777 SEVSRKQRRKSKQQAEQREMPSAFTSTDAESSSVKNFMDVEVSQFPTNKEEETTFGGSVV 836
Query: 830 IEYSKQSGFLVQKKDNADSLKNNCSPQTTSKKKNKNKKGGLSMFLSGALDDTPKEIALPP 889
SK+ GF VQKK +D KN S SKK KN+KGGLSMFLSGALD+ PK+ A PP
Sbjct: 837 NRTSKEIGFFVQKKSGSDLPKNKISSPAVSKK--KNRKGGLSMFLSGALDEVPKDAA-PP 893
Query: 890 PPTPRSEGPAWGGAKVPKGSASLREIQSEQSKIKVNQPTRNKDQFEDPSFGRSEGKVLLS 949
PPTPRSEGPAWGGAKV K SASLR+IQ EQSK K+N PTRNKDQ ED RS+GKVLLS
Sbjct: 894 PPTPRSEGPAWGGAKVSKESASLRQIQDEQSKTKLNIPTRNKDQVEDHFDSRSDGKVLLS 953
Query: 950 SFMTSKPIPVVSARAQQATDGDKSTPPWAASGTPPSLSRPSLRNIQMQQGKQH-CLSHSP 1008
S M SKPIP+VS A QA+D + +TP W ASGTPP LSRPSLR+IQMQQGK+H +SHSP
Sbjct: 954 SLMPSKPIPLVSVPASQASDAEINTPSW-ASGTPPLLSRPSLRDIQMQQGKRHQSISHSP 1012
Query: 1009 KTRTAGFSIAPSQGSPSDSPGMNRWFKPEAETPSSIRSIQMEEKAMKDLKRFYSSVKIVR 1068
K +T GFS++ QGSPSDSPGMNRWFKPE +TPSSIRSIQ+EEKAMKDLKRFYSSVKIV+
Sbjct: 1013 KMKTHGFSVSTGQGSPSDSPGMNRWFKPEVDTPSSIRSIQIEEKAMKDLKRFYSSVKIVK 1072
Query: 1069 NQS 1071
N S
Sbjct: 1073 NPS 1075
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439268|ref|XP_002265056.1| PREDICTED: uncharacterized protein LOC100261641 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255569510|ref|XP_002525722.1| conserved hypothetical protein [Ricinus communis] gi|223535022|gb|EEF36705.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356571739|ref|XP_003554031.1| PREDICTED: uncharacterized protein LOC100800604 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356560879|ref|XP_003548714.1| PREDICTED: uncharacterized protein LOC100814063 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296089288|emb|CBI39060.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357508731|ref|XP_003624654.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|124359292|gb|ABD28429.2| Regulator of chromosome condensation/beta-lactamase-inhibitor protein II [Medicago truncatula] gi|355499669|gb|AES80872.1| Ankyrin repeat domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449484006|ref|XP_004156756.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101206334 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449468281|ref|XP_004151850.1| PREDICTED: uncharacterized protein LOC101206334 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297828852|ref|XP_002882308.1| ankyrin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328148|gb|EFH58567.1| ankyrin repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1071 | ||||||
| UNIPROTKB|F1NXV1 | 1359 | IBTK "Uncharacterized protein" | 0.412 | 0.325 | 0.312 | 2.2e-39 | |
| UNIPROTKB|F1MMV0 | 1353 | IBTK "Uncharacterized protein" | 0.396 | 0.314 | 0.315 | 1.2e-38 | |
| UNIPROTKB|F1RQL8 | 1346 | IBTK "Uncharacterized protein" | 0.396 | 0.315 | 0.317 | 2.3e-38 | |
| UNIPROTKB|E9PDR5 | 1152 | IBTK "Inhibitor of Bruton tyro | 0.404 | 0.375 | 0.311 | 1.9e-37 | |
| MGI|MGI:1918677 | 1352 | Ibtk "inhibitor of Bruton agam | 0.398 | 0.315 | 0.304 | 3e-37 | |
| UNIPROTKB|E7EPI0 | 1338 | IBTK "Inhibitor of Bruton tyro | 0.404 | 0.323 | 0.311 | 4.3e-37 | |
| UNIPROTKB|Q9P2D0 | 1353 | IBTK "Inhibitor of Bruton tyro | 0.404 | 0.320 | 0.311 | 4.6e-37 | |
| RGD|1311697 | 1352 | Ibtk "inhibitor of Bruton agam | 0.419 | 0.332 | 0.279 | 8.2e-35 | |
| TAIR|locus:2163986 | 440 | UVR8 "UVB-RESISTANCE 8" [Arabi | 0.276 | 0.672 | 0.321 | 2.9e-31 | |
| UNIPROTKB|O95199 | 551 | RCBTB2 "RCC1 and BTB domain-co | 0.245 | 0.477 | 0.325 | 3.5e-29 |
| UNIPROTKB|F1NXV1 IBTK "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 443 (161.0 bits), Expect = 2.2e-39, Sum P(4) = 2.2e-39
Identities = 153/489 (31%), Positives = 236/489 (48%)
Query: 30 DLCLAVREGSLADVESALALLKKNGGNINSRNIFGLTPLHSAIWRNQVPIVRRLLAA-GA 88
D+ V GS +++ L+ N I ++ FG LH A + ++ L G
Sbjct: 22 DVISVVTRGSEGQIKAFLSSYCYNAATI--KDAFGRNVLHLASSCGKKGVLDWLAETKGV 79
Query: 89 DPDARDGESGWSSLHRALHFGHLAVASVLLQSGASITLEDCKSRTPVDL-LSGPVLQVVG 147
D A+D ESGW++LHR++ +G++ LL+ G S+ ++D + + +DL + + VV
Sbjct: 80 DLLAKDKESGWTALHRSIFYGYIDCVLSLLKHGVSLYIQDKEGLSALDLVMKDRPIHVVF 139
Query: 148 SGYNSVATEVFSWGSGANYQLGTGNAHLQKLPCKVDSL--HGFVIKLISAAKFHSVAVTS 205
+ TEV++WG+ N+ LG G + P VD + IK + KFHSV ++
Sbjct: 140 K--KTDLTEVYTWGNNINFTLGHGGQQSKHHPELVDLFPRNSVYIKQVVLCKFHSVFLSH 197
Query: 206 LGEVYTWGYGRGGRLGHPDFDIHSGQAAVITPRRVTSGLGSRRVKTIAAAKHHTVLATEG 265
G++YT G+G+GGRLGH D + + PR V GL S + IAAAK HTV+ TE
Sbjct: 198 KGQIYTCGHGQGGRLGHGD------EQTCLVPRLV-EGLSSHQCSQIAAAKDHTVVLTED 250
Query: 266 GEVFTWGSNREGQLGYTSVDTQ-PTPRRVSSLKLK---IIAVAAANKHTAVVSESGEVFT 321
G V+T+G N QLG PR+V + LK +I VAA HT + ++ V+T
Sbjct: 251 GCVYTFGLNTFHQLGILPPPANCSVPRQVQAKNLKGRMVIGVAAGRFHTVLWTKEA-VYT 309
Query: 322 WGCNREGQLGYGTS-NSASNYT-PRVVESLKGKDL-VG-VAAAKYHTIVLGADGERVIVA 377
G N GQLGY N T PR V +L KD+ V V+A+ T+ + G+ ++A
Sbjct: 310 MGLNG-GQLGYLLDPNGEKCVTAPRQVSALHHKDVSVSLVSASDGATVCVTERGDIYLLA 368
Query: 378 R-NLKKSGSTPLKFHRKI--------KL---HVVSIAAGMVHSTALTEDGALFYWASSDP 425
KK S L + + K+ H+ + AL E G +F W SS+
Sbjct: 369 DYQCKKIASKQLNLKKVLVNGGYLEYKVDTQHLKENGGQKICILALDEAGRIFCWKSSNN 428
Query: 426 DLR-CQQLYSMCGRNVV--SISAGKYWTAAVTATGDVYM--W--DGKKSKDNPPLVTRLH 478
++ C+ +Y GR V ++ + VT G+ + W +G+K + LV+ L
Sbjct: 429 SMKQCRWVY---GRQVFMSDVALNRNEMMFVTQDGEAFTGKWLEEGRKVLEKKELVSSLP 485
Query: 479 GIKKATSVS 487
S S
Sbjct: 486 NASTEMSCS 494
|
|
| UNIPROTKB|F1MMV0 IBTK "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQL8 IBTK "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PDR5 IBTK "Inhibitor of Bruton tyrosine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918677 Ibtk "inhibitor of Bruton agammaglobulinemia tyrosine kinase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EPI0 IBTK "Inhibitor of Bruton tyrosine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P2D0 IBTK "Inhibitor of Bruton tyrosine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1311697 Ibtk "inhibitor of Bruton agammaglobulinemia tyrosine kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163986 UVR8 "UVB-RESISTANCE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95199 RCBTB2 "RCC1 and BTB domain-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.00130543 | hypothetical protein (1075 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1071 | |||
| COG5184 | 476 | COG5184, ATS1, Alpha-tubulin suppressor and relate | 1e-27 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-23 | |
| COG5184 | 476 | COG5184, ATS1, Alpha-tubulin suppressor and relate | 5e-22 | |
| COG5184 | 476 | COG5184, ATS1, Alpha-tubulin suppressor and relate | 1e-18 | |
| COG5184 | 476 | COG5184, ATS1, Alpha-tubulin suppressor and relate | 1e-18 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-18 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 9e-18 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-16 | |
| pfam00415 | 50 | pfam00415, RCC1, Regulator of chromosome condensat | 6e-13 | |
| pfam00415 | 50 | pfam00415, RCC1, Regulator of chromosome condensat | 5e-12 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-10 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-10 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 4e-10 | |
| COG5184 | 476 | COG5184, ATS1, Alpha-tubulin suppressor and relate | 5e-10 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 8e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 6e-09 | |
| pfam00415 | 50 | pfam00415, RCC1, Regulator of chromosome condensat | 6e-09 | |
| pfam00415 | 50 | pfam00415, RCC1, Regulator of chromosome condensat | 1e-08 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-07 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 4e-07 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 6e-07 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 6e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 7e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 1e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-06 | |
| pfam13540 | 30 | pfam13540, RCC1_2, Regulator of chromosome condens | 5e-06 | |
| pfam13540 | 30 | pfam13540, RCC1_2, Regulator of chromosome condens | 1e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-05 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-05 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-05 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 9e-05 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 4e-04 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 7e-04 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.001 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 0.001 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.001 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 0.002 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 0.004 |
| >gnl|CDD|227511 COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
Score = 117 bits (295), Expect = 1e-27
Identities = 94/358 (26%), Positives = 139/358 (38%), Gaps = 63/358 (17%)
Query: 157 VFSWGSGANYQLGTGNAHL-----QKLPCKVDSLHGFVIKLISAAKFHSVAVTSLGEVYT 211
V+SWGS +LG GN Q P + I I+ HS+ + G +Y+
Sbjct: 70 VYSWGSNGMNELGLGNDETKVDRPQLNP--FGRIDKASIIKIACGGNHSLGLDHDGNLYS 127
Query: 212 WGYGRGGRLG---HPDFDIHSGQAAVI-------TPRRV---TSGLGSRRVKTIAAAKHH 258
WG G LG H D + TP +V +S RV +A
Sbjct: 128 WGDNDDGALGRDIHKDICDQNNDIIDFDDYELESTPFKVPGGSSAKSHLRVVKLACGWEI 187
Query: 259 TVLATEGGEVFTWGSNREGQLGYTSVDT------QPTPRRVSSLKLKIIAVAAANKHTAV 312
+V+ T G V++WG+ R G+LG S Q TP +V K I+ +AA H
Sbjct: 188 SVILTADGRVYSWGTFRCGELGQGSYKNSQKTSIQFTPLKVP--KKAIVQLAAGADHLIA 245
Query: 313 VSESGEVFTWGCNREGQLGYGTSNSAS----NYTPRVVESLKGKDLVGVAAAKYHTIVLG 368
++ G+V+ WG N++GQLG TS P + ++K VA K H++ L
Sbjct: 246 LTNEGKVYGWGSNQKGQLGRPTSERLKLVVLVGDPFAIRNIK-----YVACGKDHSLALD 300
Query: 369 ADGERVIVARNLKKSGSTPLKFHRKIKLH--------------VVSIAAGMVHSTALTED 414
DGE I A + G +I + SI+AG HS L +D
Sbjct: 301 EDGE--IYAWGVNIFGQLGAGSDGEIGALTTKPNYKQLLSGVTICSISAGESHSLILRKD 358
Query: 415 GALFYWASSD---------PDLRCQQLYSMCGR-NVVSISAGKYWTAAVTATGDVYMW 462
G L+ + D + + + ++ G + A T G VY W
Sbjct: 359 GTLYAFGRGDRGQLGIQEEITIDVSTPTKLSVAIKLEQVACGTHHNIARTDDGSVYSW 416
|
Length = 476 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227511 COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227511 COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227511 COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201217 pfam00415, RCC1, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201217 pfam00415, RCC1, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227511 COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|201217 pfam00415, RCC1, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201217 pfam00415, RCC1, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205718 pfam13540, RCC1_2, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205718 pfam13540, RCC1_2, Regulator of chromosome condensation (RCC1) repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1071 | |||
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| COG5184 | 476 | ATS1 Alpha-tubulin suppressor and related RCC1 dom | 100.0 | |
| KOG1427 | 443 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| COG5184 | 476 | ATS1 Alpha-tubulin suppressor and related RCC1 dom | 100.0 | |
| KOG1427 | 443 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 99.98 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.76 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 99.7 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 99.7 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.68 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.65 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.63 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.62 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.59 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.58 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.57 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.57 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.56 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.54 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.54 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.54 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.53 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.52 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.52 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.52 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.51 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.51 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.51 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.51 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.51 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.49 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.49 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.48 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.47 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.47 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.47 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.47 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.46 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.46 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.46 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.45 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.45 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.45 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.44 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.44 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.43 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.43 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.42 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.41 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.41 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.4 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.4 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.38 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.38 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.37 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.36 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.36 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.35 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.35 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.34 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.34 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.32 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.26 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.25 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.25 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.24 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.24 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.24 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.24 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.19 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.18 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.18 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.17 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.17 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.16 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.14 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.13 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.09 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.08 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.07 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.06 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.05 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.01 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.99 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 98.97 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.97 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.95 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.94 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 98.87 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.84 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.84 | |
| PF00415 | 51 | RCC1: Regulator of chromosome condensation (RCC1) | 98.83 | |
| PF00415 | 51 | RCC1: Regulator of chromosome condensation (RCC1) | 98.82 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.78 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.77 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.76 | |
| PF13540 | 30 | RCC1_2: Regulator of chromosome condensation (RCC1 | 98.74 | |
| PF13540 | 30 | RCC1_2: Regulator of chromosome condensation (RCC1 | 98.72 | |
| KOG0941 | 850 | consensus E3 ubiquitin protein ligase [Posttransla | 98.71 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.7 | |
| KOG0941 | 850 | consensus E3 ubiquitin protein ligase [Posttransla | 98.57 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.55 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.46 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.42 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 98.4 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.36 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.24 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.22 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.22 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.13 | |
| KOG4325 | 212 | consensus Uncharacterized conserved protein [Funct | 98.07 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.03 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.88 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 97.85 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 97.83 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.83 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.8 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 97.8 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.7 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 97.68 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 97.61 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.6 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.6 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 97.41 | |
| KOG4350 | 620 | consensus Uncharacterized conserved protein, conta | 97.38 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 97.18 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.11 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.08 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.05 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 96.95 | |
| KOG4591 | 280 | consensus Uncharacterized conserved protein, conta | 96.82 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 96.59 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.21 | |
| PF07707 | 103 | BACK: BTB And C-terminal Kelch; InterPro: IPR01170 | 95.96 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 95.83 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 95.77 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.62 | |
| smart00875 | 101 | BACK BTB And C-terminal Kelch. The BACK domain is | 95.15 | |
| KOG3669 | 705 | consensus Uncharacterized conserved protein, conta | 94.23 | |
| PF11725 | 1774 | AvrE: Pathogenicity factor; InterPro: IPR021085 Th | 94.06 | |
| PF11725 | 1774 | AvrE: Pathogenicity factor; InterPro: IPR021085 Th | 93.13 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 92.76 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 91.87 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 91.4 | |
| KOG4682 | 488 | consensus Uncharacterized conserved protein, conta | 91.13 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 90.97 | |
| KOG2075 | 521 | consensus Topoisomerase TOP1-interacting protein B | 90.84 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 90.13 | |
| PLN02153 | 341 | epithiospecifier protein | 89.83 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 88.21 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 87.59 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 87.46 | |
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 86.38 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 85.94 | |
| KOG0943 | 3015 | consensus Predicted ubiquitin-protein ligase/hyper | 85.73 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 85.28 | |
| KOG0943 | 3015 | consensus Predicted ubiquitin-protein ligase/hyper | 84.33 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 84.02 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 83.88 | |
| KOG3669 | 705 | consensus Uncharacterized conserved protein, conta | 83.59 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 83.57 | |
| PF11822 | 317 | DUF3342: Domain of unknown function (DUF3342); Int | 82.56 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 81.91 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 80.53 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 80.02 |
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-54 Score=497.76 Aligned_cols=392 Identities=29% Similarity=0.467 Sum_probs=318.6
Q ss_pred CCcccCCCCCcHHHHHHhcCCHHHHHHHHhcCCCCCCCCCCCCccccccccccccccchhhhhccccccccccCCCCCCc
Q 001480 56 NINSRNIFGLTPLHSAIWRNQVPIVRRLLAAGADPDARDGESGWSSLHRALHFGHLAVASVLLQSGASITLEDCKSRTPV 135 (1071)
Q Consensus 56 diN~~d~~G~TpLH~Aa~~g~~eivk~LL~~GAd~n~~d~~~G~TpL~~A~~~g~~~vv~lLl~~Ga~v~l~d~~G~tpL 135 (1071)
-+|.+|.+|+|+||+|+..+...++++||.+|+|++.+|.+.|+||||.|.++|+++|+.+||.+|+++.++|.+|..|+
T Consensus 44 ~anikD~~GR~alH~~~S~~k~~~l~wLlqhGidv~vqD~ESG~taLHRaiyyG~idca~lLL~~g~SL~i~Dkeglspl 123 (1267)
T KOG0783|consen 44 LANIKDRYGRTALHIAVSENKNSFLRWLLQHGIDVFVQDEESGYTALHRAIYYGNIDCASLLLSKGRSLRIKDKEGLSPL 123 (1267)
T ss_pred hhhHHHhhccceeeeeeccchhHHHHHHHhcCceeeeccccccchHhhHhhhhchHHHHHHHHhcCCceEEecccCCCHH
Confidence 37889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCceeeeccccccccceeeeccCCcccccCCCCcccccCCceeccCC--CceEEEEecCCceEEEEecCCcEEEEe
Q 001480 136 DLLSGPVLQVVGSGYNSVATEVFSWGSGANYQLGTGNAHLQKLPCKVDSLH--GFVIKLISAAKFHSVAVTSLGEVYTWG 213 (1071)
Q Consensus 136 dl~sg~v~qa~~~~~~~~~g~VYsWGsN~~GQLG~G~~~~~~~P~~V~~l~--~~~I~~Va~G~~HslaLT~dG~Vy~WG 213 (1071)
++++--.....- -......+||+||.|.+..||.|+......|.+|+.+. |.-+.+|+.|.+|++++++.|+||+||
T Consensus 124 q~~~r~~~~~i~-~~~d~pndvy~wG~N~N~tLGign~~~~~~Pe~Vdlf~~Sg~~~~qV~l~kfHSvfl~~kgqvY~cG 202 (1267)
T KOG0783|consen 124 QFLSRVLSSTIH-PVLDLPNDVYGWGTNVNNTLGIGNGKEPSSPERVDLFKTSGQLFSQVQLSKFHSVFLTEKGQVYVCG 202 (1267)
T ss_pred HHHhhccccccc-cccCCccceeEecccccccccccCCCCCCChHHhHHHHhccHHHHHHHHhhceeeEecCCCcEEEec
Confidence 998752111000 01112369999999999999999999999999999775 556889999999999999999999999
Q ss_pred cCCCCCCCCCCCccCCCCcceeeeeeeecCCCCCCEEEEEecCceEEEEEcCCcEEEEeCCCCCCcCCCCCC-CCCccee
Q 001480 214 YGRGGRLGHPDFDIHSGQAAVITPRRVTSGLGSRRVKTIAAAKHHTVLATEGGEVFTWGSNREGQLGYTSVD-TQPTPRR 292 (1071)
Q Consensus 214 ~N~~GQLG~g~~~~~s~~~~v~~P~~V~~~l~~~~Iv~IAcG~~HslaLT~dG~VyswG~N~~GQLG~g~~~-~~~~P~~ 292 (1071)
.+..|+||+|+. ...+.|++|. ++.+.+|.+|++...|+++||.+|.||+||.|.++|||..+.. ....|.+
T Consensus 203 hG~GGRlG~gde------q~~~iPkrV~-gL~gh~~~qisvs~~HslvLT~~g~Vys~GlN~~hqLG~~~~~~~~~~p~q 275 (1267)
T KOG0783|consen 203 HGAGGRLGFGDE------QYNFIPKRVP-GLIGHKVIQISVSHTHSLVLTKFGSVYSWGLNGSHQLGLSNDELKKDDPIQ 275 (1267)
T ss_pred cCCCCccCcCcc------cccccccccc-cccccceEEEEeecceeEEEeecceEEEeecCcccccCCcCchhhcCchhh
Confidence 999999999954 4668899998 8899999999999999999999999999999999999987433 3455555
Q ss_pred ec-----cCcccEEEEEEcCCceeEEecCCcEEEEeCCCCCCcCCCCCCCCCcccceeeeccCCCCEEEEEecCCeEEEE
Q 001480 293 VS-----SLKLKIIAVAAANKHTAVVSESGEVFTWGCNREGQLGYGTSNSASNYTPRVVESLKGKDLVGVAAAKYHTIVL 367 (1071)
Q Consensus 293 V~-----~l~~~Iv~VacG~~HSlaLT~dG~VY~WG~N~~GQLG~g~~~~~~~~~P~~V~~l~~~~I~~IaaG~~htlaL 367 (1071)
|. ++. .|+.|++|..|+++.|+. .||+||.| .||||..+. ...+.+|+.+..+ ...|..|.|....|+++
T Consensus 276 I~a~r~kg~~-~iIgvaAg~~hsVawt~~-~VY~wGlN-~GQlGi~~n-~~~Vt~Pr~l~~~-~~~v~~v~a~~~ATVc~ 350 (1267)
T KOG0783|consen 276 ITARRIKGFK-QIIGVAAGKSHSVAWTDT-DVYSWGLN-NGQLGISDN-ISVVTTPRRLAGL-LSPVIHVVATTRATVCL 350 (1267)
T ss_pred hhhHhhcchh-hhhhhhcccceeeeeecc-eEEEeccc-CceecCCCC-Cceeecchhhccc-ccceEEEEecCccEEEE
Confidence 54 333 799999999999999976 69999999 899998665 4456678766432 35799999999999999
Q ss_pred eeCCcEEEEecCCCCCCCcc------ceec----cccCCcEEEEEeCCCcceEEecCCcEEEEeCCCCCCceeeeeecCC
Q 001480 368 GADGERVIVARNLKKSGSTP------LKFH----RKIKLHVVSIAAGMVHSTALTEDGALFYWASSDPDLRCQQLYSMCG 437 (1071)
Q Consensus 368 t~dG~Vy~wG~n~~~~~~~p------~~~~----~~~~~~I~~Ia~G~~hslaLt~dG~Vy~WG~n~~~~~p~~v~~l~g 437 (1071)
+.+|.+|++......-.... +.+. .....++.+..+.....+++|+-|.||+|-+++.....-....+.-
T Consensus 351 ~~~~~i~~~ady~~~k~~~n~~~lks~~V~gg~l~~~~~~~~k~~a~~~kll~lte~g~Vy~w~s~ns~~~~c~ftp~r~ 430 (1267)
T KOG0783|consen 351 LQNNSIIAFADYNQVKLPFNVDFLKSLKVTGGPLSLTRFNVRKLLASENKLLVLTELGEVYEWDSKNSTRTSCKFTPLRI 430 (1267)
T ss_pred ecCCcEEEEecccceecCcchhccceeEEecCccchhhhhhhhcchhhhheeeeccCCeEEEEecCCCceeeeeccccee
Confidence 99999999876421111100 0000 0011256677777888999999999999998876543333322322
Q ss_pred ceeEEEEeCCcEEEEEeeCCcEE
Q 001480 438 RNVVSISAGKYWTAAVTATGDVY 460 (1071)
Q Consensus 438 ~~Vv~IaaG~~htlaLT~dG~Vy 460 (1071)
..|.+|+--.+..+++|.||.+|
T Consensus 431 ~~isdIa~~~N~~~~~t~dGc~~ 453 (1267)
T KOG0783|consen 431 FEISDIAWTANSLILCTRDGCWK 453 (1267)
T ss_pred eehhhhhhccceEEEEecCccee
Confidence 45668887788999999999444
|
|
| >COG5184 ATS1 Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1427 consensus Uncharacterized conserved protein, contains RCC1 domain [Function unknown] | Back alignment and domain information |
|---|
| >COG5184 ATS1 Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1427 consensus Uncharacterized conserved protein, contains RCC1 domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00415 RCC1: Regulator of chromosome condensation (RCC1) repeat; InterPro: IPR000408 The regulator of chromosome condensation (RCC1) [] is a eukaryotic protein which binds to chromatin and interacts with ran, a nuclear GTP-binding protein IPR002041 from INTERPRO, to promote the loss of bound GDP and the uptake of fresh GTP, thus acting as a guanine-nucleotide dissociation stimulator (GDS) | Back alignment and domain information |
|---|
| >PF00415 RCC1: Regulator of chromosome condensation (RCC1) repeat; InterPro: IPR000408 The regulator of chromosome condensation (RCC1) [] is a eukaryotic protein which binds to chromatin and interacts with ran, a nuclear GTP-binding protein IPR002041 from INTERPRO, to promote the loss of bound GDP and the uptake of fresh GTP, thus acting as a guanine-nucleotide dissociation stimulator (GDS) | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13540 RCC1_2: Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B | Back alignment and domain information |
|---|
| >PF13540 RCC1_2: Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B | Back alignment and domain information |
|---|
| >KOG0941 consensus E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0941 consensus E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4325 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00875 BACK BTB And C-terminal Kelch | Back alignment and domain information |
|---|
| >KOG3669 consensus Uncharacterized conserved protein, contains dysferlin, TECPR and PH domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others | Back alignment and domain information |
|---|
| >PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3669 consensus Uncharacterized conserved protein, contains dysferlin, TECPR and PH domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1071 | ||||
| 4d9s_A | 406 | Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv | 3e-31 | ||
| 4d9s_A | 406 | Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv | 2e-21 | ||
| 4dnv_A | 370 | Crystal Structure Of The W285f Mutant Of Uvb-Resist | 5e-31 | ||
| 4dnv_A | 370 | Crystal Structure Of The W285f Mutant Of Uvb-Resist | 6e-21 | ||
| 4dnw_A | 374 | Crystal Structure Of Uvb-Resistance Protein Uvr8 Le | 7e-31 | ||
| 4dnw_A | 374 | Crystal Structure Of Uvb-Resistance Protein Uvr8 Le | 5e-21 | ||
| 4dnu_A | 372 | Crystal Structure Of The W285a Mutant Of Uvb-Resist | 1e-30 | ||
| 4dnu_A | 372 | Crystal Structure Of The W285a Mutant Of Uvb-Resist | 1e-21 | ||
| 3kci_A | 389 | The Third Rld Domain Of Herc2 Length = 389 | 3e-27 | ||
| 3kci_A | 389 | The Third Rld Domain Of Herc2 Length = 389 | 3e-26 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-13 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-13 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 5e-13 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 8e-13 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-13 | ||
| 3mvd_K | 423 | Crystal Structure Of The Chromatin Factor Rcc1 In C | 1e-12 | ||
| 3mvd_K | 423 | Crystal Structure Of The Chromatin Factor Rcc1 In C | 7e-07 | ||
| 1a12_A | 413 | Regulator Of Chromosome Condensation (Rcc1) Of Huma | 2e-12 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-12 | ||
| 1i2m_B | 402 | Ran-Rcc1-So4 Complex Length = 402 | 3e-12 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-12 | ||
| 3of7_A | 473 | The Crystal Structure Of Prp20p From Saccharomyces | 1e-11 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-11 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 1e-11 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 2e-11 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-11 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 3e-11 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 5e-11 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 5e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 1e-10 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 2e-10 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 2e-10 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 2e-10 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 2e-10 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 2e-10 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-10 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 6e-04 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-10 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 6e-10 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 6e-10 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 6e-10 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 7e-10 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 1e-09 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 1e-09 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 2e-09 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 2e-09 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 3e-09 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-09 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 7e-09 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 1e-08 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 1e-08 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 1e-08 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 1e-08 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 1e-08 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 6e-08 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 8e-08 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 2e-07 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 4e-07 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-07 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 6e-07 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 9e-07 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 2e-05 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 6e-05 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 5e-05 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 5e-05 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 1e-04 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 1e-04 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 1e-04 | ||
| 1ikn_D | 236 | IkappabalphaNF-Kappab Complex Length = 236 | 1e-04 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 4e-04 | ||
| 3qhy_B | 282 | Structural, Thermodynamic And Kinetic Analysis Of T | 5e-04 | ||
| 1jtd_B | 273 | Crystal Structure Of Beta-Lactamase Inhibitor Prote | 6e-04 |
| >pdb|4D9S|A Chain A, Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv Resistance Locus 8) Length = 406 | Back alignment and structure |
|
| >pdb|4D9S|A Chain A, Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv Resistance Locus 8) Length = 406 | Back alignment and structure |
| >pdb|4DNV|A Chain A, Crystal Structure Of The W285f Mutant Of Uvb-Resistance Protein Uvr8 Length = 370 | Back alignment and structure |
| >pdb|4DNV|A Chain A, Crystal Structure Of The W285f Mutant Of Uvb-Resistance Protein Uvr8 Length = 370 | Back alignment and structure |
| >pdb|4DNW|A Chain A, Crystal Structure Of Uvb-Resistance Protein Uvr8 Length = 374 | Back alignment and structure |
| >pdb|4DNW|A Chain A, Crystal Structure Of Uvb-Resistance Protein Uvr8 Length = 374 | Back alignment and structure |
| >pdb|4DNU|A Chain A, Crystal Structure Of The W285a Mutant Of Uvb-Resistance Protein Uvr8 Length = 372 | Back alignment and structure |
| >pdb|4DNU|A Chain A, Crystal Structure Of The W285a Mutant Of Uvb-Resistance Protein Uvr8 Length = 372 | Back alignment and structure |
| >pdb|3KCI|A Chain A, The Third Rld Domain Of Herc2 Length = 389 | Back alignment and structure |
| >pdb|3KCI|A Chain A, The Third Rld Domain Of Herc2 Length = 389 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3MVD|K Chain K, Crystal Structure Of The Chromatin Factor Rcc1 In Complex With The Nucleosome Core Particle Length = 423 | Back alignment and structure |
| >pdb|3MVD|K Chain K, Crystal Structure Of The Chromatin Factor Rcc1 In Complex With The Nucleosome Core Particle Length = 423 | Back alignment and structure |
| >pdb|1A12|A Chain A, Regulator Of Chromosome Condensation (Rcc1) Of Human Length = 413 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|1I2M|B Chain B, Ran-Rcc1-So4 Complex Length = 402 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|3OF7|A Chain A, The Crystal Structure Of Prp20p From Saccharomyces Cerevisiae And Its Binding Properties To Gsp1p And Histones Length = 473 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|3QHY|B Chain B, Structural, Thermodynamic And Kinetic Analysis Of The Picomolar Binding Affinity Interaction Of The Beta-Lactamase Inhibitor Protein- Ii (Blip-Ii) With Class A Beta-Lactamases Length = 282 | Back alignment and structure |
| >pdb|1JTD|B Chain B, Crystal Structure Of Beta-Lactamase Inhibitor Protein-Ii In Complex With Tem-1 Beta-Lactamase Length = 273 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
Score = 314 bits (808), Expect = 3e-98
Identities = 107/397 (26%), Positives = 171/397 (43%), Gaps = 53/397 (13%)
Query: 142 VLQVVGSGYNSVAT----EVFSWGSGANYQLGTGNAHLQKLPCKVDSLHGFVIKLISAAK 197
SG ++ ++ WG QLG K+P ++L + +
Sbjct: 3 HHHHHSSGRENLYFQGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGE 62
Query: 198 FHSVAVTSLGEVYTWGYGRGGRLGHPDFDIHSGQAAVITPRRVTSGLGSRRVKTIAAA-- 255
AVT+ G++Y GYG GGRLG + +V TP + + +K +A
Sbjct: 63 QTLFAVTADGKLYATGYGAGGRLGIGGTE------SVSTPTLL-ESIQHVFIKKVAVNSG 115
Query: 256 KHHTVLATEGGEVFTWGSNREGQLGYTSVDTQPTPRRVSSLK-LKIIAVAAANKHTAVVS 314
H + + GEV++WG +G+LG+ + PR + SL+ ++++ VAA H+A V+
Sbjct: 116 GKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVT 175
Query: 315 ESGEVFTWGCNREGQLGYGTSNSASNYTPRVVESLKGKDLVGVA--AAKYHTIVLGADGE 372
+G+++TWG R G+LG+ S P++VE+L+G +V +A + T+ L D
Sbjct: 176 AAGDLYTWGKGRYGRLGHSDSEDQL--KPKLVEALQGHRVVDIACGSGDAQTLCLTDDDT 233
Query: 373 RVIV-----------ARNLKKSGSTPLKFHRKIKLHVVSIAAGMVHSTALTEDGALFYW- 420
V R P+K L VV + G S ALT+ GA++ W
Sbjct: 234 ---VWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWG 290
Query: 421 ---------ASSDPDLRCQQLYSMCGRNVVSISAGKYWTAAVTATGDVYMW--------- 462
S D R +Q+ + G+ V++I+ G T G+VY W
Sbjct: 291 KGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLG 350
Query: 463 DG-KKSKDNPPLVTRLHGIKKATSVSVGETHLLIVGS 498
DG + P LV L G KK V+ G H L +
Sbjct: 351 DGTTNAIQRPRLVAALQG-KKVNRVACGSAHTLAWST 386
|
| >3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Length = 406 | Back alignment and structure |
|---|
| >4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Length = 406 | Back alignment and structure |
|---|
| >4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Length = 406 | Back alignment and structure |
|---|
| >4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Length = 406 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >1a12_A RCC1, regulator of chromosome condensation 1; guanine nucleotide exchange factor, GEF, RAN, RAS-like nuclear GTP binding protein; 1.70A {Homo sapiens} SCOP: b.69.5.1 PDB: 1i2m_B Length = 413 | Back alignment and structure |
|---|
| >3of7_A Regulator of chromosome condensation; beta-propeller, guanine nucleotide exchange factor (GEF), GS histones, nucleus, cell cycle; 1.90A {Saccharomyces cerevisiae} Length = 473 | Back alignment and structure |
|---|
| >3of7_A Regulator of chromosome condensation; beta-propeller, guanine nucleotide exchange factor (GEF), GS histones, nucleus, cell cycle; 1.90A {Saccharomyces cerevisiae} Length = 473 | Back alignment and structure |
|---|
| >3of7_A Regulator of chromosome condensation; beta-propeller, guanine nucleotide exchange factor (GEF), GS histones, nucleus, cell cycle; 1.90A {Saccharomyces cerevisiae} Length = 473 | Back alignment and structure |
|---|
| >3of7_A Regulator of chromosome condensation; beta-propeller, guanine nucleotide exchange factor (GEF), GS histones, nucleus, cell cycle; 1.90A {Saccharomyces cerevisiae} Length = 473 | Back alignment and structure |
|---|
| >3of7_A Regulator of chromosome condensation; beta-propeller, guanine nucleotide exchange factor (GEF), GS histones, nucleus, cell cycle; 1.90A {Saccharomyces cerevisiae} Length = 473 | Back alignment and structure |
|---|
| >3mvd_K Regulator of chromosome condensation; protein-DNA complex, nucleosome core particle (NCP), NCP-CHR factor complex; HET: DNA; 2.90A {Drosophila melanogaster} Length = 423 | Back alignment and structure |
|---|
| >3mvd_K Regulator of chromosome condensation; protein-DNA complex, nucleosome core particle (NCP), NCP-CHR factor complex; HET: DNA; 2.90A {Drosophila melanogaster} Length = 423 | Back alignment and structure |
|---|
| >3mvd_K Regulator of chromosome condensation; protein-DNA complex, nucleosome core particle (NCP), NCP-CHR factor complex; HET: DNA; 2.90A {Drosophila melanogaster} Length = 423 | Back alignment and structure |
|---|
| >3mvd_K Regulator of chromosome condensation; protein-DNA complex, nucleosome core particle (NCP), NCP-CHR factor complex; HET: DNA; 2.90A {Drosophila melanogaster} Length = 423 | Back alignment and structure |
|---|
| >3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Length = 282 | Back alignment and structure |
|---|
| >3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Length = 282 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1071 | ||||
| d1a12a_ | 401 | b.69.5.1 (A:) Regulator of chromosome condensation | 4e-34 | |
| d1a12a_ | 401 | b.69.5.1 (A:) Regulator of chromosome condensation | 2e-25 | |
| d1a12a_ | 401 | b.69.5.1 (A:) Regulator of chromosome condensation | 6e-25 | |
| d1a12a_ | 401 | b.69.5.1 (A:) Regulator of chromosome condensation | 1e-06 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 7e-17 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 5e-12 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 6e-12 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 2e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-16 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-16 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-13 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-16 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 9e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 9e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-13 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-11 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-12 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-06 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-05 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-12 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-08 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-12 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-04 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-10 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-09 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-09 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-09 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 9e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-05 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.004 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-08 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 6e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-08 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-06 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 7e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.001 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 6e-08 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 4e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 4e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 4e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 7e-08 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 7e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-05 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 4e-07 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.004 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-05 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 0.002 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 2e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 4e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 8e-04 |
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 401 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: RCC1/BLIP-II family: Regulator of chromosome condensation RCC1 domain: Regulator of chromosome condensation RCC1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 133 bits (335), Expect = 4e-34
Identities = 68/387 (17%), Positives = 120/387 (31%), Gaps = 54/387 (13%)
Query: 156 EVFSWGSGANYQLGTG-NAHLQKLPCKVDSLHGFVIKLISAAKFHSVAVTSLGEVYTWGY 214
V + G G QLG G N +K P V + A H+V ++ G+VY++G
Sbjct: 16 LVLTLGQGDVGQLGLGENVMERKKPALVSIPED--VVQAEAGGMHTVCLSKSGQVYSFGC 73
Query: 215 GRGGRLGHPDFDIHSGQAAVITPRRVTSGLGSRRVKTIAAAKHHTVLATEGGEVFTWGSN 274
G LG S + S AA + + +
Sbjct: 74 NDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFL-----WGSFRD 128
Query: 275 REGQLGYTSVDTQPTPRRVSSLKLKIIAVAAANKHTAVVSESGEVFTWGCNREGQLGYGT 334
G +G + L + ++ VA+ N H +++ G+++T GC +GQLG
Sbjct: 129 NNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVP 188
Query: 335 SNSASNYTPRVVE--------------SLKGKDLVGVAAAKYHTIVLGADGE-------- 372
A+ + +E S Y T + +G
Sbjct: 189 ELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSN 248
Query: 373 --RVIVARNLKKSGSTPLKFHRKIKLHVVSIAAGMVHSTALTEDGALFYWASSDPDLRCQ 430
++ L + V + G H+ + +G + ++
Sbjct: 249 YHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGL 308
Query: 431 QLYSMC---------GRNVVSISAGKYWTAAVTATGDVYMW---------DGKKSKDNPP 472
+ V S++ G AVT G V+ W G+ P
Sbjct: 309 GEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSP 368
Query: 473 ---LVTRLHGIKKATSVSVGETHLLIV 496
+ +L + SVS G H +++
Sbjct: 369 VEMMGKQLEN-RVVLSVSSGGQHTVLL 394
|
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 401 | Back information, alignment and structure |
|---|
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 401 | Back information, alignment and structure |
|---|
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 401 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1071 | |||
| d1a12a_ | 401 | Regulator of chromosome condensation RCC1 {Human ( | 100.0 | |
| d1a12a_ | 401 | Regulator of chromosome condensation RCC1 {Human ( | 100.0 | |
| d1jtdb_ | 273 | beta-lactamase inhibitor protein-II, BLIP-II {Stre | 100.0 | |
| d1jtdb_ | 273 | beta-lactamase inhibitor protein-II, BLIP-II {Stre | 100.0 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.7 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.68 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.6 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.59 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.58 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.55 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.52 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.51 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.5 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.49 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.48 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.45 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.43 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.43 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.42 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.42 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.41 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.4 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.4 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.4 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.39 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.39 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.37 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.37 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.37 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.37 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.33 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.33 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.27 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.26 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.24 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.22 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 97.29 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 97.05 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 94.34 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 90.8 |
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: RCC1/BLIP-II family: Regulator of chromosome condensation RCC1 domain: Regulator of chromosome condensation RCC1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=0 Score=387.83 Aligned_cols=336 Identities=22% Similarity=0.325 Sum_probs=261.1
Q ss_pred CCCEEEECCCCCCCCCCCCCCC-CCCCCCEECCCCCCEEEEEECCCCEEEEEECCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf 2210211267764235778765-556871220578942999802896599992399099984189997799997667787
Q 001480 153 VATEVFSWGSGANYQLGTGNAH-LQKLPCKVDSLHGFVIKLISAAKFHSVAVTSLGEVYTWGYGRGGRLGHPDFDIHSGQ 231 (1071)
Q Consensus 153 ~~g~VysWG~N~~GQLG~g~~~-~~~~P~~I~~l~~~~Iv~VaaG~~hs~aLt~dG~Vy~WG~N~~GQLG~g~~~~~~~~ 231 (1071)
..|+||+||.|.+||||+|... ....|.+|+.+. +|++|+||..|++||+++|+||+||.|.+||||.+... .
T Consensus 13 ~~G~vy~wG~n~~GqLG~g~~~~~~~~P~~v~~~~--~i~~ia~G~~h~~al~~~G~vy~wG~n~~GQLG~g~~~----~ 86 (401)
T d1a12a_ 13 EPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPE--DVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSV----E 86 (401)
T ss_dssp CCBEEEEEEECTTSTTCSCTTCCEEEEEEEECCSS--CEEEEEECSSEEEEEETTSCEEEEECCTTSTTCSCCCS----T
T ss_pred CCCEEEEEECCCCCCCCCCCCCCEECCCEEECCCC--CEEEEEECCCEEEEEECCCEEEEEECCCCCCCCCCCCC----C
T ss_conf 89889999699988889999886503577908999--92999918988999967998999958999887744655----6
Q ss_pred CCEEEEEEEECCCCCCCEEEEEECCCEEEEEECCCCEEEEECCCCCCCCCCC--CCCCCCCEEECCCCCCEEEEEECCCC
Q ss_conf 5033204640588999979998568658999829919999389999768889--98878650322676658999976884
Q 001480 232 AAVITPRRVTSGLGSRRVKTIAAAKHHTVLATEGGEVFTWGSNREGQLGYTS--VDTQPTPRRVSSLKLKIIAVAAANKH 309 (1071)
Q Consensus 232 ~~v~~P~~V~~~l~~~~Iv~IaaG~~HslaLT~dG~VyswG~N~~GQLG~gs--~~~~~~P~~V~~l~~~Iv~VaaG~~H 309 (1071)
.....|..+. ...+|++|+||..|+++++++|.||+||.+..++++... ......+.........|++|+||..|
T Consensus 87 ~~~~~~~~~~---~~~~i~~i~~g~~~~~~~~~~g~v~~wG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~g~~~ 163 (401)
T d1a12a_ 87 GSEMVPGKVE---LQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDH 163 (401)
T ss_dssp TGGGSCEECC---CCSCEEEEEECSSEEEEEETTSCEEEEECEEETTEEEESSBBTBCEEEEEEECCSSCEEEEEECSSE
T ss_pred CCCCCCCCCC---CCCCEEEECCCCCCEEECCCCCCCEECCCCCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCC
T ss_conf 6423554235---4220022011100101000345311202145655544666775431001100168850699820352
Q ss_pred EEEEECCCCEEEEECCCCCCCCCCCCCCCC---------CCCCEEEE-----CCCCCCEEEEEECCCEEEEEEECCCEEE
Q ss_conf 068820891999948999976789989987---------66650341-----2689978999933873999960896999
Q 001480 310 TAVVSESGEVFTWGCNREGQLGYGTSNSAS---------NYTPRVVE-----SLKGKDLVGVAAAKYHTIVLGADGERVI 375 (1071)
Q Consensus 310 SiaLt~dG~VYsWG~N~~GQLG~g~~~~~~---------~~~P~~V~-----~l~~~~I~~IaaG~~hTivLt~dG~Vy~ 375 (1071)
+++++.+|++|+||.|.+||||.+...... ...|..+. .....+|.+|+||.+|+++++.+|.+|.
T Consensus 164 ~~~~~~~g~~~~~G~n~~gqlg~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~i~~v~~g~~~~~~l~~~g~v~~ 243 (401)
T d1a12a_ 164 LVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYG 243 (401)
T ss_dssp EEEEETTSCEEEEECCTTSTTCSCGGGTSSSCGGGGHHHHHSCEECCCBCSSCCSBCCEEEEEEETTEEEEEETTCCEEE
T ss_pred EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEEEEECCCEEEEEECCCEEEE
T ss_conf 25650378500346687662288875344567755544335652000035677778439999936876999955981865
Q ss_pred EECCCCCCCCCC--------CEEC--CCCCCCEEEEEECCCCCEEEECCCCEEEEECCCCC-----------CCEEEEEE
Q ss_conf 933788889854--------2230--13687599999679820688269839998089999-----------72023100
Q 001480 376 VARNLKKSGSTP--------LKFH--RKIKLHVVSIAAGMVHSTALTEDGALFYWASSDPD-----------LRCQQLYS 434 (1071)
Q Consensus 376 wG~n~~~~~~~p--------~~~~--~~~~~~Iv~IaaG~~hslaLT~dG~Vy~WGsn~~~-----------~~p~~v~~ 434 (1071)
||.|...+.... .... ......|+.+++|..|+++++++|.||+||.|..+ ..|..+..
T Consensus 244 ~g~n~~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~~~~~~l~~~g~v~~wG~n~~gqlG~g~~~~~~~~P~~i~~ 323 (401)
T d1a12a_ 244 FGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISR 323 (401)
T ss_dssp EECCTTSTTSCSSCSCEEEEEECGGGCCTTCCEEEEEECSSEEEEEETTSCEEEEECCGGGTTCSCTTCCCEEEEEECCS
T ss_pred ECCCCEECCCCCCCCCCEECCCCCCCCCCCEEEEEEEEECCCEEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCEECCC
T ss_conf 12221020354566310000010123554036999851012013561489788840334675678862333558888579
Q ss_pred CCCCEEEEEEECCCEEEEEEECCCEEEECCCCCCC-------CCCCEEEECCC----CCEEEEEECCCEEEEEEEC
Q ss_conf 37960599971795899995089499966999999-------99843774686----5489999438748999807
Q 001480 435 MCGRNVVSISAGKYWTAAVTATGDVYMWDGKKSKD-------NPPLVTRLHGI----KKATSVSVGETHLLIVGSL 499 (1071)
Q Consensus 435 l~g~~Vv~IaaG~~hs~aLT~dG~Vy~WG~N~~~~-------~~~~p~~v~~~----~~V~~Va~G~~HtivL~s~ 499 (1071)
+ .+|++|+||.+|+++++++|+||+||.|..++ +...|+++... .+|++|+||.+|+++|+.+
T Consensus 324 ~--~~i~~Is~G~~hs~alt~dG~v~~WG~n~~GQLG~G~~~~~~~P~~v~~~~~~~~~v~~v~~G~~hs~~l~~d 397 (401)
T d1a12a_ 324 L--PAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKD 397 (401)
T ss_dssp S--SSEEEEEECSSEEEEEETTSCEEEEECCTTSTTCSSSCSCEEEEEECCSTTTTTEEEEEEEECSSEEEEEEEE
T ss_pred C--CCEEEEEEECCEEEEEECCCEEEEEECCCCCCCCCCCCCCEECCEEEECCCCCCCEEEEEEECCCEEEEEEEC
T ss_conf 9--9829999308879999489969999259988778999988860789643578998899999752439999979
|
| >d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|