Citrus Sinensis ID: 001578


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSYDD
cccccHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHccccccHHHHHcccHHHHcHHHHHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHcHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccEEHHHccHHHHHcccccccccccccHHHHccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHcccccccccccccccEEEccccccc
cHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccccHHEcccccccccccccHHHHcccHHHHccccccHHHHHHHcccccccccccccccHHcccccccccHHHHHHccccHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHccHHHHHcccHHHHHHHHHHHHHccccHHHHHHHccHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccEccHHHHHHHHHHHHHHccccccEEEEHHHHHHHHccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEcccccccccEEccEEEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHEEccccc
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGcafsalgrkEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKqdrsvtceydvsnsmssltvsesglnandkmsetsenhnksdicdsssqsrdvsetcsksshdpdlcngrsdeakggssvpvsksglhingklrevsenhngssdgsksthasrdaseinrqssddfdicngpidkasvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQilkedpmypealigRGTARAFQRELEAAISDFTEAiqsnpsagEAWKRRGQARAALGESVEAIQDLSKalefepnsadilhergivnfkfkdFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDlssglgidpsnieCLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASkinsefcwfdidgdidplfkeywckrlhpknvcekvyrqpplrdslkkgklrrqdfsvTKQKTALLLVADSIGkkiqydcpgflsnRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKysnrssskngkrarrkdriniasqnrggagcstssssdtssygiteerssghpkmswqDVYTLAVKWRqisepcdpvvWVNKLSeefnsgfgshtpmilgqAKVVRYFPNYARTLDVAKTVMKDkkyvhnkaddiidlsedvvgedfwlATWCnstafegkqlegtRITLVKMgesgydfairtpctpsrwdeFDAEMTMAWEVDWEAilnsdphffldsvkswlypslktstswkeypdvtstfATTGSVVAALSSYDD
mlkrklldsryrlnkthkticeidelvrvDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETsenhnksdicdsssqsrDVSEtcsksshdpdlcngrsdeakggssvpvsksgLHINGKLrevsenhngssdgsksthasrdaseinrqssddfdicNGPIDKAsvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklsfkWDMLKetsneakrnkkfcvtrisksksisvdfrlsrgiaqvnegkyASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRlhpknvcekvyrqpplrdslkkgklrrqdfsvtkqktaLLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAewkysnrssskngkrarrkdriniasqnrggagcstssssdtssygiteerssghpkmswQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKtvmkdkkyvhnkaddiidlsEDVVGEDFWLATWCNStafegkqlegtRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSYDD
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAkggssvpvsksgLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKlssdsaslndsntnsesyskssisdnkssdstesrsklsFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYhlrglllhglgqhKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCstssssdtssYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSYDD
*********RYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQ**SVTCE************************************************************************************************************************************************************************************************************KFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDF*************************************LEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQ***************DFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKY******************************************************SWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVA*******
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAE*******************RINIASQNRGGAGCST*******************PKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILN******LDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSS***
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNAN*************************************LCNGRS**********VSKSGLHINGKLREVS***********************RQSSDDFDICNGPIDKASVNER**************************************************KLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS******************GESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWK***************KDRINIASQ******************************MSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSYDD
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNR******KRARRKDRINIASQN****************************KMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSY**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSEDVVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAILNSDPHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVVAALSSYDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1050 2.2.26 [Sep-21-2011]
Q8NBP0860 Tetratricopeptide repeat yes no 0.567 0.693 0.260 1e-58
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.195 0.209 0.255 1e-12
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.246 0.278 0.242 4e-12
O82039 932 Probable UDP-N-acetylgluc N/A no 0.207 0.233 0.248 3e-11
Q68FQ7659 RNA polymerase II-associa no no 0.224 0.358 0.269 4e-10
Q96301 914 Probable UDP-N-acetylgluc no no 0.207 0.238 0.248 4e-10
Q58741314 TPR repeat-containing pro yes no 0.235 0.786 0.244 1e-09
Q5ZKQ3665 RNA polymerase II-associa no no 0.224 0.354 0.252 1e-09
Q04737248 TPR repeat-containing pro N/A no 0.139 0.588 0.270 1e-09
Q54VG4334 Small glutamine-rich tetr no no 0.110 0.347 0.316 2e-09
>sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 Back     alignment and function desciption
 Score =  229 bits (584), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 178/682 (26%), Positives = 313/682 (45%), Gaps = 86/682 (12%)

Query: 334 SDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVN 393
           SD +   S+   S LS   + +   +      K+F       + + S +  L+     + 
Sbjct: 100 SDCEPKGSSPCDSLLSLNTEKILSQAKSIAEQKRFPFA----TDNDSTNEELAIAYVLIG 155

Query: 394 EGKYASAISIFDQILKEDPMYPEALIGRGTARAFQ-----RELEAAISDFTEAIQSNPSA 448
            G Y  AI  F  +L+E+P    A+ GRG A   +     +  E A+ + +  I   P  
Sbjct: 156 SGLYDEAIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVITLEPDR 215

Query: 449 GEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSA 508
            E +++R +  + LG   EA+ DL+KA++ +P SA +   RG + F  +D+  A ED   
Sbjct: 216 PEVFEQRAEILSPLGRINEAVNDLTKAIQLQP-SARLYRHRGTLYFISEDYATAHEDFQQ 274

Query: 509 CVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSE 568
            ++L+K    A  Y GL     G  K+A E+  +A++   +F++A+  L Q Y++L N E
Sbjct: 275 SLELNKNQPIAMLYKGLTFFHRGLLKEAIESFKEALKQKVDFIDAYKSLGQAYRELGNFE 334

Query: 569 KALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASC 628
            A E  Q+ L +++   +   LRG++L+  G  ++A+K+    L ++P N  C Y++   
Sbjct: 335 AATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKGLS 394

Query: 629 YHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAF-YQKEIALYTASKINSEFCWFDIDG 687
           + A+G++ E IK     +  +    +K   + L   Y +E + Y  + +++    ++ID 
Sbjct: 395 HVAMGQFYEGIKAQTKVMLNDPLPGQKASPEYLKVKYLREYSRYLHAHLDTPLTEYNIDV 454

Query: 688 DIDPLFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTA-LLLVADSI 746
           D+   FK++W K L    + E    QP L+  +K   +  Q+F   K +   L+ VAD +
Sbjct: 455 DLPGSFKDHWAKNL--PFLIEDYEEQPGLQPHIK--DVLHQNFESYKPEVQELICVADRL 510

Query: 747 GKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRK 806
           G  +QY+ PGFL N+R HR  GLAA+E+ Q V + W         +N     NG     K
Sbjct: 511 GSLMQYETPGFLPNKRIHRAMGLAALEVMQAVQRTW---------TNSKVRMNG-----K 556

Query: 807 DRINIASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDP 866
            R+                                   M W+D++ +AVKWR+I++P  P
Sbjct: 557 TRL-----------------------------------MQWRDMFDIAVKWRRIADPDQP 581

Query: 867 VVWVNKL-SEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAK---------------- 909
           V+W++++ +   + GF +H  +I GQ   +RY   + + L   K                
Sbjct: 582 VLWLDQMPARSLSRGFNNHINLIRGQVINMRYLEYFEKILHFIKDRILVYHGANNPKGLL 641

Query: 910 TVMKDKKYVHNKADDIIDLSEDV---VGEDFWLATWCNSTAFEGKQLEGTRITLVKMGES 966
            V +  + VH K +D++ + +       + F + T   S   +GK+ +G  IT+      
Sbjct: 642 EVREALEKVH-KVEDLLPIMKQFNTKTKDGFTVNTKVPSLKDQGKEYDGFTITITGDKVG 700

Query: 967 GYDFAIRTPCTPSRWDEFDAEM 988
              F++ T  T  R   + AE+
Sbjct: 701 NILFSVETQTTEERTQLYHAEI 722





Homo sapiens (taxid: 9606)
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=4 SV=1 Back     alignment and function description
>sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 Back     alignment and function description
>sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0751 PE=4 SV=1 Back     alignment and function description
>sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1050
2555679751101 tetratricopeptide repeat protein, tpr, p 0.909 0.867 0.720 0.0
2254389201068 PREDICTED: tetratricopeptide repeat prot 0.919 0.903 0.670 0.0
3574827051033 Tetratricopeptide repeat protein [Medica 0.839 0.852 0.653 0.0
3574827011062 Tetratricopeptide repeat protein [Medica 0.839 0.829 0.653 0.0
4495207221046 PREDICTED: tetratricopeptide repeat prot 0.855 0.858 0.650 0.0
4494484721046 PREDICTED: tetratricopeptide repeat prot 0.855 0.858 0.650 0.0
3564969451047 PREDICTED: tetratricopeptide repeat prot 0.846 0.849 0.651 0.0
3565655171042 PREDICTED: tetratricopeptide repeat prot 0.850 0.857 0.653 0.0
2977981241043 hypothetical protein ARALYDRAFT_912592 [ 0.891 0.897 0.589 0.0
1865171701052 suppressor of RPS4-RLD 1 / tetratricopep 0.897 0.895 0.583 0.0
>gi|255567975|ref|XP_002524965.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223535800|gb|EEF37462.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/979 (72%), Positives = 806/979 (82%), Gaps = 24/979 (2%)

Query: 33  MASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDC 92
           MASAI+ R+ELAKLC+ R+WSKAIR+LDSLL+QS  IQDICNRAFCYSQLELHKHVI+DC
Sbjct: 1   MASAISERVELAKLCASRDWSKAIRVLDSLLSQSCTIQDICNRAFCYSQLELHKHVIKDC 60

Query: 93  DKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTA 152
           DKALQLDP LLQAYILKG AFS+LGRK++AL VW++GYEHAL QSADLKQ LELEELL  
Sbjct: 61  DKALQLDPMLLQAYILKGRAFSSLGRKDDALLVWQQGYEHALRQSADLKQLLELEELLKF 120

Query: 153 AKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNK-SDICDSSSQSRDVSETC 211
           AKQ+R++     V+ S + +  +E   + N K +E S+N ++ SDI +S  +S D SE C
Sbjct: 121 AKQERNIGLRDHVTES-TPMNTTEFATHTNGKSNEASKNRDQLSDISNSCRESGDGSEIC 179

Query: 212 SKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDAS 271
           SK   + D  N   D+A G S + + +   H+NGK  +V  NH+   D SK  + SRD  
Sbjct: 180 SKFGGNFDAMNVIRDKAGGESPITIPECRPHMNGKSDDVCTNHDKLGDKSKLHNESRDTY 239

Query: 272 EINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKS 331
           +I   S D+  I N    KA  + +  +  NGTH+  DK+S DS S N  +  S   SKS
Sbjct: 240 KICCNSGDNCAIQNYLSRKAEGDVKTDK--NGTHNFIDKIS-DSESCNVLSDTSVPSSKS 296

Query: 332 SISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQ 391
           S     S D+++ R KLS K D+  E  +E K++KKF VTRISK+KSI+VDFRLSRGIAQ
Sbjct: 297 STISISSGDTSDIRVKLSNKTDIPNEAGDETKKSKKFSVTRISKTKSITVDFRLSRGIAQ 356

Query: 392 VNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEA 451
           VNEGKYASAISIFDQIL EDP YPEALIGRGTA AFQRELEAAI+DF++AIQSNP AGEA
Sbjct: 357 VNEGKYASAISIFDQILTEDPTYPEALIGRGTAHAFQRELEAAIADFSKAIQSNPLAGEA 416

Query: 452 WKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVK 511
           WKRRGQARAALGES+EAI DL+KALEFEPNSADILHERGIVNFKFKDF+AAV+DLSACVK
Sbjct: 417 WKRRGQARAALGESIEAIHDLTKALEFEPNSADILHERGIVNFKFKDFDAAVQDLSACVK 476

Query: 512 LDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKAL 571
           LDK+NKSAYTYLGLALSS GEYKKAEEAHLK+IQLDR+FLE W HLTQFYQDLAN  KA 
Sbjct: 477 LDKDNKSAYTYLGLALSSTGEYKKAEEAHLKSIQLDRSFLEGWAHLTQFYQDLANLTKAF 536

Query: 572 ECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHA 631
           EC++QVL ID RF+KAYHL GLLLHG+G+H+KAIK+LS GL I+ SNIECLYLRASCYHA
Sbjct: 537 ECIKQVLQIDARFAKAYHLHGLLLHGMGEHRKAIKELSLGLSIENSNIECLYLRASCYHA 596

Query: 632 IGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFCWFDIDGDIDP 691
           IGEY EA+KDYDA LD+ELDSMEKFVLQCLAFYQKE+ALYTASKINSEFCWFDIDGDIDP
Sbjct: 597 IGEYGEAVKDYDATLDMELDSMEKFVLQCLAFYQKELALYTASKINSEFCWFDIDGDIDP 656

Query: 692 LFKEYWCKRLHPKNVCEKVYRQPPLRDSLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQ 751
           LFKEYWCKRLHPKNVCEKVYRQPPLRDSLK+GKLR+QDF +TKQKTALL+ ADSIGKKIQ
Sbjct: 657 LFKEYWCKRLHPKNVCEKVYRQPPLRDSLKRGKLRKQDFVITKQKTALLMAADSIGKKIQ 716

Query: 752 YDCPGFLSNRRQHRMAGLAAIEIAQKVSKIWRSLQAEWKYSNRSSSKNGKRARRKDRINI 811
           YDCPGFL NRRQHRMAGLAAIEIAQKVSK WRSLQAEWK+SN+S SK GK+ RR  RIN+
Sbjct: 717 YDCPGFLPNRRQHRMAGLAAIEIAQKVSKAWRSLQAEWKHSNKSMSKYGKKTRR--RINM 774

Query: 812 ASQNRGGAGCSTSSSSDTSSYGITEERSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVN 871
            SQNRGGAGCS++SS  ++SYGI+EERSSG   +SWQDVY+LAVKWRQISEPCDPVVWVN
Sbjct: 775 PSQNRGGAGCSSNSSETSTSYGISEERSSGRHMISWQDVYSLAVKWRQISEPCDPVVWVN 834

Query: 872 KLSEEFNSGFGSHTPMILGQAKVVRYFPNYARTLDVAKTVMKDKKYVHNKADDIIDLSED 931
           KLSEEFN+GFGS TP+ILGQAKVVRY+ NY RTLD AKT+MKDK YVH+KAD++ID+S+D
Sbjct: 835 KLSEEFNTGFGSQTPLILGQAKVVRYYMNYERTLDAAKTIMKDKLYVHSKADEVIDISKD 894

Query: 932 -----------------VVGEDFWLATWCNSTAFEGKQLEGTRITLVKMGESGYDFAIRT 974
                            V+GEDFWLATWCNST  EGK+LEGTRITL+KMGE G+DFAIRT
Sbjct: 895 EKLRDIMDAKTCSELYKVIGEDFWLATWCNSTVIEGKRLEGTRITLMKMGEHGFDFAIRT 954

Query: 975 PCTPSRWDEFDAEMTMAWE 993
           PCTP RWDEFDAEM MAWE
Sbjct: 955 PCTPPRWDEFDAEMAMAWE 973




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438920|ref|XP_002279290.1| PREDICTED: tetratricopeptide repeat protein 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357482705|ref|XP_003611639.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512974|gb|AES94597.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357482701|ref|XP_003611637.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512972|gb|AES94595.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449520722|ref|XP_004167382.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448472|ref|XP_004141990.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356496945|ref|XP_003517325.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|356565517|ref|XP_003550986.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|297798124|ref|XP_002866946.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] gi|297312782|gb|EFH43205.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186517170|ref|NP_195462.3| suppressor of RPS4-RLD 1 / tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|332661397|gb|AEE86797.1| suppressor of RPS4-RLD 1 / tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1050
TAIR|locus:21263471052 SRFR1 "SUPPRESSOR OF RPS4-RLD 0.647 0.646 0.657 2.30000000194e-315
DICTYBASE|DDB_G02721861050 DDB_G0272186 "TPR_1 repeat-con 0.147 0.147 0.417 8.1e-63
ZFIN|ZDB-GENE-080722-25826 ttc13 "tetratricopeptide repea 0.374 0.475 0.296 1.1e-53
UNIPROTKB|Q74DZ8266 GSU1166 "TPR domain protein" [ 0.212 0.838 0.271 2.1e-14
TIGR_CMR|GSU_1166266 GSU_1166 "TPR domain protein" 0.212 0.838 0.271 2.1e-14
UNIPROTKB|F1NNH9599 TOMM70A "Uncharacterized prote 0.257 0.450 0.224 8.1e-12
UNIPROTKB|P72802266 mom72 "Mitochondrial outer mem 0.173 0.684 0.279 1.6e-11
RGD|1303049610 Tomm70a "translocase of outer 0.264 0.455 0.223 6.4e-11
MGI|MGI:106295611 Tomm70a "translocase of outer 0.264 0.454 0.223 6.4e-11
ZFIN|ZDB-GENE-041121-17542 stip1 "stress-induced-phosphop 0.171 0.332 0.247 2.2e-10
TAIR|locus:2126347 SRFR1 "SUPPRESSOR OF RPS4-RLD 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2400 (849.9 bits), Expect = 2.3e-315, Sum P(3) = 2.3e-315
 Identities = 463/704 (65%), Positives = 554/704 (78%)

Query:   359 SNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEAL 418
             S+E+++NKK+ + RIS + SISVDFRLSRGIAQVNEG Y  AISIFD++LKE+P YPEAL
Sbjct:   275 SDESRKNKKYTIARISGTHSISVDFRLSRGIAQVNEGNYTKAISIFDKVLKEEPTYPEAL 334

Query:   419 IGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEF 478
             IGRGTA AFQRELE+AI+DFT+AIQSNP+A EAWKRRGQARAALGE VEA++DL+KAL F
Sbjct:   335 IGRGTAYAFQRELESAIADFTKAIQSNPAASEAWKRRGQARAALGEYVEAVEDLTKALVF 394

Query:   479 EPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEE 538
             EPNS D+LHERGIVNFK KDF AAV+DLS C+K +K+NKSAYTYLGLA +S+GEYKKAEE
Sbjct:   395 EPNSPDVLHERGIVNFKSKDFTAAVKDLSICLKQEKDNKSAYTYLGLAFASLGEYKKAEE 454

Query:   539 AHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYXXXXXXXXXX 598
             AHLK+IQLD N+LEAW HL QFYQ+LA+  KALEC++QVL +D R  KAY          
Sbjct:   455 AHLKSIQLDSNYLEAWLHLAQFYQELADHCKALECIEQVLQVDNRVWKAYHLRGLVFHGL 514

Query:   599 XXXKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVL 658
                +KAI++LS GL I+ + IECLYLR SCYHA+GEYR+A+KDYDA +D+ELD++EKFVL
Sbjct:   515 GEHRKAIQELSIGLSIE-NTIECLYLRGSCYHAVGEYRDAVKDYDATVDVELDAVEKFVL 573

Query:   659 QCLAFYQKEIALYTASKINSEFCWFDIDGDIDPLFKEYWCKRLHPKNVCEKVYRQPPLRD 718
             QCLAFYQKE+ALYTASK++SEF  FDIDGDIDP+FKEYWCKRLHPKNVCEKVYRQPPLR+
Sbjct:   574 QCLAFYQKELALYTASKVSSEFLCFDIDGDIDPMFKEYWCKRLHPKNVCEKVYRQPPLRE 633

Query:   719 SLKKGKLRRQDFSVTKQKTALLLVADSIGKKIQYDCPGFLSNRRQHRMAGLAAIEIAQKV 778
             SLKKGKL++QD ++TKQK  +L  AD IGK+IQYDCPGFL N+RQHRMAGLA IEIAQKV
Sbjct:   634 SLKKGKLKKQDLAITKQKANILRFADLIGKRIQYDCPGFLPNKRQHRMAGLAVIEIAQKV 693

Query:   779 SKIWRSLQAEWKYSNRSSSKNGKRARRKDRINIASQNRGGAGCXXXXXXXXXX-YGITEE 837
             SK WR    EW+ S + ++KNGK+ RR++R NI SQNRGGAGC           Y   E+
Sbjct:   694 SKAWR---IEWRNSTKGTTKNGKKNRRRERTNILSQNRGGAGCSSSSFSETSTGYASLED 750

Query:   838 RSSGHPKMSWQDVYTLAVKWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMILGQAKVVRY 897
             RSSG   +SWQDVY+ AV+WRQISEPCDPVVWVNKLSEEFNSGFGSHTPM+LGQAKVVRY
Sbjct:   751 RSSGRSILSWQDVYSPAVRWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMVLGQAKVVRY 810

Query:   898 FPNYARTLDVAKTVMKDKKYVHNKADDIIDLSED-----------------VVGEDFWLA 940
             FPNY RTL +AK+++KDK  V +K D +IDLS+D                 +VGEDFW+A
Sbjct:   811 FPNYERTLTLAKSIIKDKLSVRSKKDKVIDLSKDEKIEKIMRAETCDELHNIVGEDFWVA 870

Query:   941 TWCNSTAFEGKQLEGTRITLV-KMGESGYDFAIRTPCTPSRWDEFDAEMTMAWEVDWEAI 999
             TWC+ST  EGK+LEGTRIT + K G  GYDF+IRTPCTP+RW +FD EMT AWE    A 
Sbjct:   871 TWCDSTGSEGKRLEGTRITCIQKPGRLGYDFSIRTPCTPARWSDFDEEMTSAWEALCTAY 930

Query:  1000 LNSD-PHFFLDSVKSWLYPSLKTSTSWKEYPDVTSTFATTGSVV 1042
                +     LD++++     L+ +  W  +  +    A TG VV
Sbjct:   931 CGENYGSTELDALETVRDAILRMTYYWYNFMPLARGTAVTGFVV 974


GO:0042742 "defense response to bacterium" evidence=IGI
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0032947 "protein complex scaffold" evidence=TAS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
DICTYBASE|DDB_G0272186 DDB_G0272186 "TPR_1 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080722-25 ttc13 "tetratricopeptide repeat domain 13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q74DZ8 GSU1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1166 GSU_1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNH9 TOMM70A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P72802 mom72 "Mitochondrial outer membrane 72K protein" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
RGD|1303049 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:106295 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-22
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-17
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-17
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-17
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-15
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-14
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-13
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-13
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-12
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-11
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 8e-09
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-08
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 5e-07
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 7e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-07
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 8e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 6e-06
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 8e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-05
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 3e-05
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 5e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 8e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 9e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 9e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-04
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-04
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 2e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 5e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 5e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 7e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 7e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 8e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 8e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
TIGR03939800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 0.001
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.002
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 0.002
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
 Score = 99.5 bits (246), Expect = 1e-22
 Identities = 84/290 (28%), Positives = 133/290 (45%), Gaps = 10/290 (3%)

Query: 394 EGKYASAISIFDQILKEDPMYPEALIGRGTAR-AFQRELEAAISDFTEAIQSNPSAGEA- 451
                 A++I  + L +      AL+  G A      EL  A+    EA++  P++  A 
Sbjct: 1   LKDLLLALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAG 60

Query: 452 -WKRRGQARAALGESVEAIQDLSKALEFE--PNSADILHERGIVNFKFKDFNAAVEDLSA 508
                  A   LG   EA++ L KALE E  PN A+ L   G++      +  A+E L  
Sbjct: 61  LLLLLALALLKLGRLEEALELLEKALELELLPNLAEALLNLGLLLEALGKYEEALELLEK 120

Query: 509 CVKLDKENKSAYTYLGL-ALSSIGEYKKAEEAHLKAIQLD---RNFLEAWGHLTQFYQDL 564
            + LD +   A   L L AL  +G+Y++A E + KA++LD       EA   L    + L
Sbjct: 121 ALALDPDPDLAEALLALGALYELGDYEEALELYEKALELDPELNELAEALLALGALLEAL 180

Query: 565 ANSEKALECLQQVLYID-KRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLY 623
              E+ALE L++ L ++    ++A    GLL   LG++++A++     L +DP N E LY
Sbjct: 181 GRYEEALELLEKALKLNPDDDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNAEALY 240

Query: 624 LRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTA 673
             A     +G Y EA++  + AL+L+ D     +   L   +    L  A
Sbjct: 241 NLALLLLELGRYEEALEALEKALELDPDLYNLGLALLLLLAEALELLEKA 290


Length = 291

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1050
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.98
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.95
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.95
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
KOG0547606 consensus Translocase of outer mitochondrial membr 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2003840 consensus TPR repeat-containing protein [General f 99.92
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.91
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
PRK14574822 hmsH outer membrane protein; Provisional 99.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG2003840 consensus TPR repeat-containing protein [General f 99.88
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.88
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.88
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.88
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.87
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.87
KOG2076895 consensus RNA polymerase III transcription factor 99.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
KOG2076895 consensus RNA polymerase III transcription factor 99.83
PRK14574822 hmsH outer membrane protein; Provisional 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
PRK12370553 invasion protein regulator; Provisional 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.8
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.8
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.78
KOG1125579 consensus TPR repeat-containing protein [General f 99.78
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.77
KOG1129478 consensus TPR repeat-containing protein [General f 99.77
PRK11189296 lipoprotein NlpI; Provisional 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
KOG1125579 consensus TPR repeat-containing protein [General f 99.76
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
PLN032181060 maturation of RBCL 1; Provisional 99.75
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.75
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.74
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
PLN02789320 farnesyltranstransferase 99.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.72
PLN02789320 farnesyltranstransferase 99.72
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.7
PLN032181060 maturation of RBCL 1; Provisional 99.7
PLN03077857 Protein ECB2; Provisional 99.69
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.69
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.68
KOG0553304 consensus TPR repeat-containing protein [General f 99.68
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.68
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
PLN03077857 Protein ECB2; Provisional 99.65
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.64
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.64
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.59
KOG1915677 consensus Cell cycle control protein (crooked neck 99.57
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.53
KOG2376652 consensus Signal recognition particle, subunit Srp 99.53
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.52
KOG4234271 consensus TPR repeat-containing protein [General f 99.51
KOG2376652 consensus Signal recognition particle, subunit Srp 99.5
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.5
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.5
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.49
PRK15359144 type III secretion system chaperone protein SscB; 99.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.45
PRK15359144 type III secretion system chaperone protein SscB; 99.44
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.4
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.4
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.39
KOG4648536 consensus Uncharacterized conserved protein, conta 99.38
PRK10370198 formate-dependent nitrite reductase complex subuni 99.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.37
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.37
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.35
KOG1915677 consensus Cell cycle control protein (crooked neck 99.35
PRK10370198 formate-dependent nitrite reductase complex subuni 99.35
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.33
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.32
PRK04841903 transcriptional regulator MalT; Provisional 99.31
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.31
KOG1128777 consensus Uncharacterized conserved protein, conta 99.3
KOG1128777 consensus Uncharacterized conserved protein, conta 99.28
PRK04841903 transcriptional regulator MalT; Provisional 99.27
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.26
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.24
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.24
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.21
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.2
KOG0553304 consensus TPR repeat-containing protein [General f 99.17
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.17
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.1
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.07
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.07
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.06
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.06
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.01
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.99
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.99
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.97
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.96
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.93
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 98.93
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.9
KOG1941518 consensus Acetylcholine receptor-associated protei 98.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.86
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.83
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.81
KOG4648536 consensus Uncharacterized conserved protein, conta 98.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.8
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.8
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.8
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.8
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.79
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.79
PRK11906458 transcriptional regulator; Provisional 98.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.77
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.76
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.75
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.74
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.73
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.73
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.73
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.72
PRK11906458 transcriptional regulator; Provisional 98.71
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.69
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.69
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.68
KOG1941518 consensus Acetylcholine receptor-associated protei 98.67
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.65
COG3898531 Uncharacterized membrane-bound protein [Function u 98.65
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.64
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.64
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.62
COG3898531 Uncharacterized membrane-bound protein [Function u 98.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.61
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.6
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.58
PRK15331165 chaperone protein SicA; Provisional 98.57
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.56
PRK15331165 chaperone protein SicA; Provisional 98.53
PRK10803263 tol-pal system protein YbgF; Provisional 98.5
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.49
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.45
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.45
PRK10803263 tol-pal system protein YbgF; Provisional 98.44
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.42
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.41
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.4
COG4700251 Uncharacterized protein conserved in bacteria cont 98.39
KOG4555175 consensus TPR repeat-containing protein [Function 98.39
PF12688120 TPR_5: Tetratrico peptide repeat 98.36
PF12688120 TPR_5: Tetratrico peptide repeat 98.35
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.32
KOG4234271 consensus TPR repeat-containing protein [General f 98.31
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.31
COG4700251 Uncharacterized protein conserved in bacteria cont 98.31
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.29
KOG2471696 consensus TPR repeat-containing protein [General f 98.29
KOG1586288 consensus Protein required for fusion of vesicles 98.28
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.26
PF1337173 TPR_9: Tetratricopeptide repeat 98.23
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.2
PF13512142 TPR_18: Tetratricopeptide repeat 98.19
PF1337173 TPR_9: Tetratricopeptide repeat 98.19
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.17
KOG1586288 consensus Protein required for fusion of vesicles 98.13
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.11
KOG2471696 consensus TPR repeat-containing protein [General f 98.11
PF13512142 TPR_18: Tetratricopeptide repeat 98.05
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.03
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.02
KOG4555175 consensus TPR repeat-containing protein [Function 98.0
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.93
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.92
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.91
KOG1585308 consensus Protein required for fusion of vesicles 97.86
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.86
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.84
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.83
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.8
KOG1310758 consensus WD40 repeat protein [General function pr 97.78
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.74
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.73
KOG1258577 consensus mRNA processing protein [RNA processing 97.73
KOG1585308 consensus Protein required for fusion of vesicles 97.69
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.67
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.66
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.64
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.6
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.55
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.55
PF1343134 TPR_17: Tetratricopeptide repeat 97.51
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.5
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.48
KOG1550552 consensus Extracellular protein SEL-1 and related 97.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.45
KOG4507886 consensus Uncharacterized conserved protein, conta 97.43
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.43
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.43
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.42
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.42
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.4
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.4
KOG4507886 consensus Uncharacterized conserved protein, conta 97.31
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.29
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.23
PF1342844 TPR_14: Tetratricopeptide repeat 97.21
KOG1550552 consensus Extracellular protein SEL-1 and related 97.21
PF1342844 TPR_14: Tetratricopeptide repeat 97.21
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.14
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.13
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.13
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.13
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.08
KOG1258577 consensus mRNA processing protein [RNA processing 97.08
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.07
PF1343134 TPR_17: Tetratricopeptide repeat 97.02
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.01
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.95
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.93
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.91
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.91
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.9
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.88
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.78
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.73
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.7
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.67
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.65
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.63
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.6
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 96.6
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.53
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.41
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.18
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.17
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.13
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.13
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.12
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.11
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.07
KOG20411189 consensus WD40 repeat protein [General function pr 96.06
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.05
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.03
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.92
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.7
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.63
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.61
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.57
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.53
PRK10941269 hypothetical protein; Provisional 95.48
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.14
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.1
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.05
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.89
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.69
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.67
PRK10941269 hypothetical protein; Provisional 94.61
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.56
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.54
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.39
PRK11619644 lytic murein transglycosylase; Provisional 94.37
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.22
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.19
KOG20411189 consensus WD40 repeat protein [General function pr 94.12
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.09
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.02
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.86
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.71
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 93.66
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 93.61
COG1747711 Uncharacterized N-terminal domain of the transcrip 93.59
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.53
KOG15381081 consensus Uncharacterized conserved protein WDR10, 93.52
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.51
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.48
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.27
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.04
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.0
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.87
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.82
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 92.72
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 92.68
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.57
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.29
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.21
KOG1310758 consensus WD40 repeat protein [General function pr 92.15
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.12
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 91.98
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.79
KOG3364149 consensus Membrane protein involved in organellar 91.54
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.22
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.57
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.56
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.45
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.31
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.21
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 90.14
KOG2581493 consensus 26S proteasome regulatory complex, subun 89.99
KOG2422665 consensus Uncharacterized conserved protein [Funct 89.75
COG4976287 Predicted methyltransferase (contains TPR repeat) 89.73
KOG2422665 consensus Uncharacterized conserved protein [Funct 89.58
COG1747711 Uncharacterized N-terminal domain of the transcrip 89.48
KOG4814872 consensus Uncharacterized conserved protein [Funct 89.37
KOG3364149 consensus Membrane protein involved in organellar 89.3
KOG15381081 consensus Uncharacterized conserved protein WDR10, 89.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.22
KOG0529421 consensus Protein geranylgeranyltransferase type I 88.89
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.78
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 88.74
KOG1463411 consensus 26S proteasome regulatory complex, subun 88.68
KOG4814872 consensus Uncharacterized conserved protein [Funct 88.34
COG5159421 RPN6 26S proteasome regulatory complex component [ 88.02
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.96
COG5191435 Uncharacterized conserved protein, contains HAT (H 87.8
COG2912269 Uncharacterized conserved protein [Function unknow 87.76
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 87.11
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 86.77
KOG0529421 consensus Protein geranylgeranyltransferase type I 86.26
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.9
PF1286294 Apc5: Anaphase-promoting complex subunit 5 85.83
KOG2581493 consensus 26S proteasome regulatory complex, subun 85.62
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 85.24
COG5191435 Uncharacterized conserved protein, contains HAT (H 85.05
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.0
COG2912269 Uncharacterized conserved protein [Function unknow 83.86
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.85
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 83.45
COG4941415 Predicted RNA polymerase sigma factor containing a 83.21
COG3629280 DnrI DNA-binding transcriptional activator of the 83.11
KOG4014248 consensus Uncharacterized conserved protein (conta 81.89
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 80.91
KOG4014248 consensus Uncharacterized conserved protein (conta 80.6
PF1286294 Apc5: Anaphase-promoting complex subunit 5 80.35
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 80.18
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.1e-42  Score=376.25  Aligned_cols=444  Identities=18%  Similarity=0.199  Sum_probs=367.4

Q ss_pred             HHHHHhcCCHHHHHHHHHHHHhcc-CCcHHHHHHHHHHHHhhCHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHcCCHHH
Q 001578           43 LAKLCSLRNWSKAIRILDSLLAQS-YEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEE  121 (1050)
Q Consensus        43 ~~~~~~~~~~~~Ai~~y~~ai~~~-~~~~~~~nra~~~~~~~~~~~Ai~~~~~Al~l~P~~~~a~~~~g~~~~~lg~~~~  121 (1050)
                      ..+.|+.|+|.+|.++-...-..+ .+...+..++..+++..++++....-..|+..+|...++|-.+|.++-..|++++
T Consensus        55 ah~~yq~gd~~~a~~h~nmv~~~d~t~~~~llll~ai~~q~~r~d~s~a~~~~a~r~~~q~ae~ysn~aN~~kerg~~~~  134 (966)
T KOG4626|consen   55 AHRLYQGGDYKQAEKHCNMVGQEDPTNTERLLLLSAIFFQGSRLDKSSAGSLLAIRKNPQGAEAYSNLANILKERGQLQD  134 (966)
T ss_pred             HHHHHhccCHHHHHHHHhHhhccCCCcccceeeehhhhhcccchhhhhhhhhhhhhccchHHHHHHHHHHHHHHhchHHH
Confidence            356899999999999888776666 3333355577778888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHhhccCChHhHHHHHHHHHHHHHHHhhhhhhhhhcccccCCCcccccCCCCCCCCCchhhhcCCCCcccccc
Q 001578          122 ALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSS  201 (1050)
Q Consensus       122 A~~~~~~al~~~~~~~~~~~~l~~l~~~~~~~~~~l~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~  201 (1050)
                      |+..|+.+              +++.|...++..++.+......                                    
T Consensus       135 al~~y~~a--------------iel~p~fida~inla~al~~~~------------------------------------  164 (966)
T KOG4626|consen  135 ALALYRAA--------------IELKPKFIDAYINLAAALVTQG------------------------------------  164 (966)
T ss_pred             HHHHHHHH--------------HhcCchhhHHHhhHHHHHHhcC------------------------------------
Confidence            88888888              4444444444444422111110                                    


Q ss_pred             ccccccccccccCCCCCCCCCCCccccCCCCCCCccccccccCCccccccccCCCCCCCCCcccccccccccccCCCCCc
Q 001578          202 SQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDF  281 (1050)
Q Consensus       202 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~k~~~~~  281 (1050)
                                                     .+..                                             
T Consensus       165 -------------------------------~~~~---------------------------------------------  168 (966)
T KOG4626|consen  165 -------------------------------DLEL---------------------------------------------  168 (966)
T ss_pred             -------------------------------CCcc---------------------------------------------
Confidence                                           0000                                             


Q ss_pred             cCCCCCCCccccccccCcCCCCccccccCcccCcccCCCCccccccccccccccCCCCCcHHhhhhhhhhhHHHHHhhhH
Q 001578          282 DICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNE  361 (1050)
Q Consensus       282 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~~~~~~~~~~~~~~~~~~~k~~~~~~~l~~~~~~~~~~~~~~~~  361 (1050)
                                                                                                      
T Consensus       169 --------------------------------------------------------------------------------  168 (966)
T KOG4626|consen  169 --------------------------------------------------------------------------------  168 (966)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHhHHHHHHHhhccCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHH
Q 001578          362 AKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEA  441 (1050)
Q Consensus       362 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~Ai~~~~~al~~~p~~~~a~~~la~~~~~~g~~~~A~~~~~~a  441 (1050)
                          .--++...+..+|....+...+|..+-..|+..+|..+|.++++..|..+-+|..+|.++..+|+...|+..|++|
T Consensus       169 ----a~~~~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eA  244 (966)
T KOG4626|consen  169 ----AVQCFFEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEA  244 (966)
T ss_pred             ----cHHHHHHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHh
Confidence                0013334455666667777788888888899999999999999999988889999999999999999999999999


Q ss_pred             HHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHH
Q 001578          442 IQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYT  521 (1050)
Q Consensus       442 l~~~p~~~~~~~~la~~~~~~g~~~eA~~~l~kal~~~p~~~~~~~~lg~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~  521 (1050)
                      +.++|+..++|+++|.+|...+.+++|+.+|.+++.+.|+++.++-++|.+|+.+|..+-|+..|++++++.|..+.++.
T Consensus       245 vkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~  324 (966)
T KOG4626|consen  245 VKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYN  324 (966)
T ss_pred             hcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCcCcHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHCCCH
Q 001578          522 YLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQH  601 (1050)
Q Consensus       522 ~la~~~~~~g~~~eA~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~  601 (1050)
                      ++|.++-..|+..+|..+|.+++.+.|+++++.++||.+|.++|.+++|...|.++++..|+.+.++.++|.+|.++|++
T Consensus       325 NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl  404 (966)
T KOG4626|consen  325 NLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNL  404 (966)
T ss_pred             HHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHhcCHHHHHH
Q 001578          602 KKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAIKDYDAALDLELDSMEKFVLQCLAFYQKEIALYTASKINSEFC  681 (1050)
Q Consensus       602 ~eAi~~l~~al~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~~al~l~p~~~~~~~~~~~~~~~~g~~~~~~~~~~~A~~  681 (1050)
                      ++|+.+|+.++.+.|..++++.++|..|..+|+...|+++|.+|+.++|...+       ++.+++..+-..|+..+|+.
T Consensus       405 ~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~Ae-------AhsNLasi~kDsGni~~AI~  477 (966)
T KOG4626|consen  405 DDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAE-------AHSNLASIYKDSGNIPEAIQ  477 (966)
T ss_pred             HHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHH-------HHhhHHHHhhccCCcHHHHH
Confidence            99999999999999999999999999999999999999999999999988765       45556666777788999999


Q ss_pred             HHHHhhccCCCCHHHHHhhcCC
Q 001578          682 WFDIDGDIDPLFKEYWCKRLHP  703 (1050)
Q Consensus       682 ~l~~a~~l~p~~~e~w~~r~~~  703 (1050)
                      .|+.++.++|+|++..|++++.
T Consensus       478 sY~~aLklkPDfpdA~cNllh~  499 (966)
T KOG4626|consen  478 SYRTALKLKPDFPDAYCNLLHC  499 (966)
T ss_pred             HHHHHHccCCCCchhhhHHHHH
Confidence            9999999999999998887754



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-13
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-09
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-10
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-06
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-08
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 3e-07
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-04
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 1e-08
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 9e-06
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 2e-05
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 3e-05
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 3e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 1e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-04
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 6e-04
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 8e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 74.7 bits (182), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 46/134 (34%), Positives = 71/134 (52%) Query: 450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSAC 509 EAW G A G+ EAI+ KALE +P SA+ + G +K D++ A+E Sbjct: 2 EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61 Query: 510 VKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEK 569 ++LD + A+ LG A G+Y +A E + KA++LD EAW +L Y + ++ Sbjct: 62 LELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDE 121 Query: 570 ALECLQQVLYIDKR 583 A+E Q+ L +D R Sbjct: 122 AIEYYQKALELDPR 135
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-60
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-60
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-60
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-59
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-56
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-51
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-48
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-33
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-60
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-58
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-58
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-52
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-56
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-49
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-43
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-43
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-42
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-38
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-37
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-36
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-56
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-53
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-45
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-40
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-34
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-54
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-43
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-40
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-32
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-55
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-46
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-46
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-36
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-50
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-50
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-45
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-49
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-40
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-40
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-49
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-45
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-42
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-28
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-49
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-42
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-30
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-45
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-46
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-46
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-45
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-44
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-44
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-44
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-41
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-39
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-38
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-37
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-33
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-33
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-45
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-27
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-41
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-33
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-39
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-30
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-28
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-23
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-20
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-43
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-31
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-34
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-24
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-19
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-33
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-33
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-33
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-33
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-26
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-22
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-18
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-33
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-30
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-27
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-25
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-23
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-10
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-06
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-25
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-24
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-24
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-25
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-24
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 9e-23
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-13
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-22
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-21
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-19
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-18
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-18
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-13
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-20
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-13
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-19
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-10
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-19
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-17
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-17
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-17
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-14
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 9e-17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-10
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 5e-09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 5e-16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 6e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-16
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 9e-09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-16
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-13
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 4e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 6e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 9e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-15
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 9e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-13
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-12
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 7e-08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-12
2l6j_A111 TPR repeat-containing protein associated with HSP; 6e-12
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-07
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 2e-11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-10
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-10
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-10
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-10
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 9e-10
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 6e-08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 8e-08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-06
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 6e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-10
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-10
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 3e-08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 5e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 7e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 8e-06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 1e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 9e-05
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 4e-04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 4e-04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 7e-04
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
 Score =  213 bits (545), Expect = 3e-60
 Identities = 38/301 (12%), Positives = 81/301 (26%), Gaps = 6/301 (1%)

Query: 386 SRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSN 445
           S    +       + + +  Q     P    A+   G  +     ++  +    +A    
Sbjct: 145 SHDGGKQALETVQALLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLT 204

Query: 446 PSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVED 505
           P    A    G  + AL      +  L +A    P     +   G      +     +  
Sbjct: 205 PQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPV 264

Query: 506 LSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLA 565
           L     L  +   A         ++   ++      +A  L    + A        Q L 
Sbjct: 265 LCQAHGLTPQQVVAIASNSGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALE 324

Query: 566 NSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLR 625
             ++ L  L Q   +  +   A          L   ++ +  L    G+ P  +  +   
Sbjct: 325 TVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASN 384

Query: 626 ASCYHAIGEYREAIKDYDAALDLELDSMEKF-----VLQCLAFYQKEIALYT-ASKINSE 679
                A+   +  +     A  L  + +          Q L   Q+ + +   A  +  +
Sbjct: 385 GGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQ 444

Query: 680 F 680
            
Sbjct: 445 Q 445


>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1050
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-33
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-32
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-30
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-27
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-26
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-26
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-04
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-20
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-19
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-15
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 8e-13
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-05
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.003
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-19
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-10
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-19
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-15
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-12
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-18
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-13
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-17
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-15
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-13
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 6e-15
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-11
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 5e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 8e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 9e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-13
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-07
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-08
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-06
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 8e-05
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.004
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 2e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.003
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 5e-07
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 3e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 6e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.003
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 7e-06
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  130 bits (326), Expect = 6e-33
 Identities = 43/233 (18%), Positives = 93/233 (39%)

Query: 401 ISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARA 460
            + + + ++  P +  A    G     Q E+  AI  F +A+  +P+  +A+   G    
Sbjct: 155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK 214

Query: 461 ALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAY 520
                  A+    +AL   PN A +      V ++    + A++     ++L      AY
Sbjct: 215 EARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY 274

Query: 521 TYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYI 580
             L  AL   G   +AE+ +  A++L     ++  +L    ++  N E+A+   ++ L +
Sbjct: 275 CNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV 334

Query: 581 DKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIG 633
              F+ A+     +L   G+ ++A+      + I P+  +      +    + 
Sbjct: 335 FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1050
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.8
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.79
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.77
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.59
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.57
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.44
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.4
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.4
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.39
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.39
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.33
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.25
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.1
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.01
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.9
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.89
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.84
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.79
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.56
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.21
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.15
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.17
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.05
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.95
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.25
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 85.35
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.4e-34  Score=282.97  Aligned_cols=382  Identities=16%  Similarity=0.147  Sum_probs=317.2

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHH
Q ss_conf             9999943899999999999981137-917787899999971278999999999998099875699999999998599999
Q 001578           43 LAKLCSLRNWSKAIRILDSLLAQSY-EIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEE  121 (1050)
Q Consensus        43 ~~~~~~~g~y~~Ai~~y~~ai~~~~-n~~~~~nrA~~~~~lg~~~~Ai~~~~~AL~ldP~~~~a~~~lG~~y~~lg~~~e  121 (1050)
                      +..+|+.|+|++|+..|+++++.+| ++..+.++|.+|+.+|++++|+..++++++++|++..+++.+|.+|..+|++++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99999869999999999999986899899999999999986999999999999998599989999999999642000222


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             99999999963037938689899999999999842111111000135777654567888898871110027997522223
Q 001578          122 ALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSS  201 (1050)
Q Consensus       122 A~~~~~~al~~~~~~~~~~~~ll~l~~~~~~a~~~l~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~  201 (1050)
                      |+..++.+.+..+...............       .     ..                                     
T Consensus        86 A~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~-----~~-------------------------------------  116 (388)
T d1w3ba_          86 AIEHYRHALRLKPDFIDGYINLAAALVA-------A-----GD-------------------------------------  116 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHH-------H-----SC-------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-------C-----CC-------------------------------------
T ss_conf             2222221211222222222222222222-------2-----22-------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44632100102689998887787644679987776666544588620000148899999886554566432234788875
Q 001578          202 SQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDF  281 (1050)
Q Consensus       202 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~k~~~~~  281 (1050)
                                                    .     .                                           
T Consensus       117 ------------------------------~-----~-------------------------------------------  118 (388)
T d1w3ba_         117 ------------------------------M-----E-------------------------------------------  118 (388)
T ss_dssp             ------------------------------S-----S-------------------------------------------
T ss_pred             ------------------------------C-----C-------------------------------------------
T ss_conf             ------------------------------2-----2-------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68899987433323357678884444567546734577776441000112235689998077644345336877874259
Q 001578          282 DICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNE  361 (1050)
Q Consensus       282 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~~~~~~~~~~~~~~~~~~~k~~~~~~~l~~~~~~~~~~~~~~~~  361 (1050)
                                                                                                   .  
T Consensus       119 -----------------------------------------------------------------------------~--  119 (388)
T d1w3ba_         119 -----------------------------------------------------------------------------G--  119 (388)
T ss_dssp             -----------------------------------------------------------------------------H--
T ss_pred             -----------------------------------------------------------------------------C--
T ss_conf             -----------------------------------------------------------------------------2--


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             99817888998511198769999999999999099799999999999959999999999999999907999999999999
Q 001578          362 AKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEA  441 (1050)
Q Consensus       362 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~Ai~~~~~al~~~p~~~~a~~~la~~~~~~g~~~~A~~~~~~a  441 (1050)
                          ............+.........+......+....+...+.+.+...|..+.++..+|..+...|++++|...+.++
T Consensus       120 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a  195 (388)
T d1w3ba_         120 ----AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKA  195 (388)
T ss_dssp             ----HHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred             ----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             ----2222111222222222222222222211000135678888740258610689986363010247199999999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             99599919999999999999199999999999999619999999999999999849999999999999982799999999
Q 001578          442 IQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYT  521 (1050)
Q Consensus       442 l~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~  521 (1050)
                      ++.+|++..++..+|.++...|++++|+..++++....+.....+..+|.++...|++++|+..++++++.+|++..++.
T Consensus       196 l~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~  275 (388)
T d1w3ba_         196 VTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYC  275 (388)
T ss_dssp             HHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHH
T ss_pred             HHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             98494649999997155220052999999999857775547999999999999878999999999999984999899999


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCH
Q ss_conf             99999998399999999999999727583999999999999828959999999999941799999999999999988997
Q 001578          522 YLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQH  601 (1050)
Q Consensus       522 ~la~~~~~~g~~~eA~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  601 (1050)
                      .+|.++...|++++|+..++.++...|.....+..++.++...|++++|+..++++++..|+++.++..+|.++..+|++
T Consensus       276 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~  355 (388)
T d1w3ba_         276 NLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL  355 (388)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCH
T ss_conf             99999997487999999998654048730010157999999878999999999999986889899999999999985999


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             999999999881299999999999999999069
Q 001578          602 KKAIKDLSSGLGIDPSNIECLYLRASCYHAIGE  634 (1050)
Q Consensus       602 ~eAl~~l~~al~~~p~~~~~~~~la~~~~~~g~  634 (1050)
                      ++|+..|+++++++|+++.++.++|.+|.++|+
T Consensus       356 ~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         356 QEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             999999999997099989999999999998589



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure