Citrus Sinensis ID: 001801


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010-
MNIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQDGNGEDDEDEVEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
ccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccHHHHHHcccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEEEcccccccccHHHHHccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEccccEEEEEEcccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccEEEEEccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEcccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHEEEEEEEEc
ccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccHHHHHcccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHHccccccEEEEcccccccccccccHccccccEEEEcccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcHccccEEEcccccccccccHHHHHccccccEEEcccccEEEEccccccccccEEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccccccccccEEEEEccccccccccccccccEEEEcccccccccccHHHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccEEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHcccccEEEEEcccccccccccHHHHcHHHHHHccccccccccccccccccccccccccccccccccEEEEEccccHHHHccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHcccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHEEEEEEcc
MNIVVSFVLLELLAVATISLSfcggatclgHCIESEREALLKFKKdlkdpsnrlvswngagdgadcckwsgvvcdnftGHVLELrlgnplnhpisyhtspaQYSIIYRTYGAEyeayerskfggkinpsllhfqhlnyldlsgnsfgggiprflgsmgklkylnlsgagfkgmiphqlgnlsklqyldlvenselyvdnlswlpglsllqhldlggvnlgkAFDWSLAINSLSSLRVLRLsgcqldhfhpppivnissisvldlssnqfdqnsLVLSWVFGLSNlvyldlgsndfqgsipvglqnltslrhldlsyndfnssipNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLssqqlegqiprsfgrlcnlreislsdvkmSQDISEILDIFSSCIsdrleswdmtgckifghltsqighfksldslflshnsisglipsslgglssLERVVLSNNTLKGYLSEIHLANLSKLvsfdvsgnaltlkvgpdwippfqlekldlqschlgptfpfwLLSQNVLgyldisrsgiqdtvparfweaspqlyflnfsnsringeipnlskatglrtvdlssnnlsgtlplisfqlesidlsnnafsgsispvlcngmrgelqvlnlennsfsgeipdcWMNFLYLRVLNlgnnnftgnlppslgslgsltLLHLQKnslsgripeslsnCNRLVSlnmdgnqfsgdiptwigEKFSSMVILNLRsnifdgqfptelCFLTSLQILDLgynnlsgaIPKCISNLsamvtvdyplgdthpgitdcslyrsclprprsfsdpIEKAFLVMKGKELEYSTILYLVALIDLsknnfsgeipvEVTDLVALRSLNLsynhfsgripdsigamkSIEVIdfsnnqlseeiprsvsnltFLNLLNLSYNylsgeiptstqlqsfdascfigndlcgsplsrnctetvpmpqdgngeddedEVEWFYVSMALGCVVGFWfvigplivnrrWRYMYSVFLDRLGDKCSTAIRKFK
MNIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQDGNGEDDEDEVEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLdrlgdkcstairkfk
MNIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINslsslrvlrlsGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNsisglipsslgglsslERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVlnlgnnnftgnlppslgslgsltllhlQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRsvsnltflnllnlsynylsGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQdgngeddedeveWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
**IVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPL**********************VEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTA*****
***VVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSP*************************WFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
MNIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQDGNGEDDEDEVEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
*NIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCT**************EDEVEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIVVSFVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQDGNGEDDEDEVEWFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDKCSTAIRKFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1011 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.730 0.590 0.309 1e-73
C0LGQ5 1249 LRR receptor-like serine/ no no 0.790 0.639 0.294 6e-72
Q9C9H7847 Receptor-like protein 12 no no 0.672 0.802 0.304 2e-71
Q9FL28 1173 LRR receptor-like serine/ no no 0.651 0.561 0.319 1e-66
C0LGS2 1136 Probable LRR receptor-lik no no 0.661 0.588 0.300 6e-62
Q9LYN8 1192 Leucine-rich repeat recep no no 0.740 0.628 0.293 1e-61
O49318 1124 Probable leucine-rich rep no no 0.623 0.560 0.304 4e-58
Q9LVP0 1102 Probable leucine-rich rep no no 0.598 0.549 0.296 3e-57
Q9ZPS9 1143 Serine/threonine-protein no no 0.572 0.506 0.297 7e-57
O22476 1196 Protein BRASSINOSTEROID I no no 0.624 0.527 0.309 5e-56
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  279 bits (713), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 263/851 (30%), Positives = 410/851 (48%), Gaps = 112/851 (13%)

Query: 124 GKINPSLLHFQHLNYLDLSGNSF-------------------------GGGIPRFLGSMG 158
           G I+PS+  F +L ++DLS N                            G IP  LGS+ 
Sbjct: 85  GSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLV 144

Query: 159 KLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQHLDLGGVN 218
            LK L L      G IP   GNL  LQ L L             L GL            
Sbjct: 145 NLKSLKLGDNELNGTIPETFGNLVNLQMLALAS---------CRLTGL------------ 183

Query: 219 LGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQNSLVLSW 278
           +   F        L  L+ L L   +L+   P  I N +S+++   + N+   N  + + 
Sbjct: 184 IPSRF------GRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRL--NGSLPAE 235

Query: 279 VFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISL 338
           +  L NL  L+LG N F G IP  L +L S+++L+L  N     IP  L   +NL  + L
Sbjct: 236 LNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDL 295

Query: 339 RSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSF-GRLCNLREISLSDVKMSQDI- 396
            SN+L G I      ++  +E L L+  +L G +P++      +L+++ LS+ ++S +I 
Sbjct: 296 SSNNLTGVIHEEFWRMN-QLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIP 354

Query: 397 SEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGL 456
           +EI    S+C S +L   D++   + G +   +     L +L+L++NS+ G + SS+  L
Sbjct: 355 AEI----SNCQSLKL--LDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNL 408

Query: 457 SSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSC 516
           ++L+   L +N L+G + +  +  L KL    +  N  + ++  +     +L+++D    
Sbjct: 409 TNLQEFTLYHNNLEGKVPK-EIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGN 467

Query: 517 HLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIP-NLS 575
            L    P  +     L  L +  + +   +PA       Q+  ++ ++++++G IP +  
Sbjct: 468 RLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCH-QMTVIDLADNQLSGSIPSSFG 526

Query: 576 KATGLRTVDLSSNNLSGTLP--LISFQ-LESIDLSNNAFSGSISPVLCNGMRGELQVLNL 632
             T L    + +N+L G LP  LI+ + L  I+ S+N F+GSISP LC G    L   ++
Sbjct: 527 FLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSISP-LC-GSSSYLS-FDV 583

Query: 633 ENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPES 692
             N F G+IP        L  L LG N FTG +P + G +  L+LL + +NSLSG IP  
Sbjct: 584 TENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVE 643

Query: 693 LSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILD 752
           L  C +L  ++++ N  SG IPTW+G K   +  L L SN F G  PTE+  LT++  L 
Sbjct: 644 LGLCKKLTHIDLNNNYLSGVIPTWLG-KLPLLGELKLSSNKFVGSLPTEIFSLTNILTLF 702

Query: 753 LGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLV 812
           L  N+L+G+IP+ I NL A+  ++                          S P+      
Sbjct: 703 LDGNSLNGSIPQEIGNLQALNALNL--------------------EENQLSGPLP----- 737

Query: 813 MKGKELEYSTILYLVALID--LSKNNFSGEIPVEVTDLVALRS-LNLSYNHFSGRIPDSI 869
                   STI  L  L +  LS+N  +GEIPVE+  L  L+S L+LSYN+F+GRIP +I
Sbjct: 738 --------STIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTI 789

Query: 870 GAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIG 929
             +  +E +D S+NQL  E+P  + ++  L  LNLSYN L G++    Q   + A  F+G
Sbjct: 790 STLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKL--KKQFSRWQADAFVG 847

Query: 930 N-DLCGSPLSR 939
           N  LCGSPLS 
Sbjct: 848 NAGLCGSPLSH 858




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1011
2240728851024 predicted protein [Populus trichocarpa] 0.931 0.919 0.492 0.0
3154367201020 verticillium wilt resistance-like protei 0.957 0.949 0.474 0.0
3565615521019 PREDICTED: LRR receptor-like serine/thre 0.930 0.923 0.464 0.0
3565616671018 PREDICTED: leucine-rich repeat receptor 0.934 0.928 0.465 0.0
3565616651072 PREDICTED: LRR receptor-like serine/thre 0.940 0.887 0.448 0.0
3565616551052 PREDICTED: probable leucine-rich repeat 0.927 0.891 0.465 0.0
2099706071045 M18S-3Ap [Malus floribunda] 0.963 0.932 0.448 0.0
3565662571086 PREDICTED: LRR receptor-like serine/thre 0.934 0.870 0.451 0.0
3565616611020 PREDICTED: LRR receptor-like serine/thre 0.932 0.924 0.461 0.0
2555818501082 leucine-rich repeat receptor protein kin 0.955 0.892 0.446 0.0
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1011 (49%), Positives = 651/1011 (64%), Gaps = 69/1011 (6%)

Query: 32   CIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLN 91
            C + ER+ALLKFK DLKDPSNRL SW  AG G DCC W GV+CDN TGHV+ELRL     
Sbjct: 37   CSQIERDALLKFKHDLKDPSNRLASW--AGFGGDCCTWRGVICDNVTGHVIELRL----- 89

Query: 92   HPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGG-GI 150
              IS+    A Y +       +YE Y +    G+INPSL+  +HL YLDL  N FGG  I
Sbjct: 90   RSISF----ADY-LASSGASTQYEDYLKLILSGRINPSLVSLKHLRYLDLRNNDFGGVQI 144

Query: 151  PRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVEN-SELYVDNLSWLPGLSLL 209
            P+F+G +G LK+L+LS AGF G IPH LGNLS L YL+L +  S+  V+NL+WL  LS L
Sbjct: 145  PKFIGLIGSLKHLDLSDAGFAGTIPHGLGNLSDLNYLNLHDYYSQFNVENLNWLSQLSSL 204

Query: 210  QHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQF 269
            + LDL  V+LG  F+W   IN+L SL  L LS CQL    P   VN SS+S+LDLSSN  
Sbjct: 205  EFLDLSLVHLGNVFNWLEVINTLPSLVELHLSYCQLPPVPPILYVNFSSLSILDLSSNYV 264

Query: 270  DQNSLVL----SWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPN 325
            D++++ +     WV  L  L+ L+L +N+FQG IP GLQNLT L+ LDLS N F+SSIP 
Sbjct: 265  DESAISMLNFPRWVSHLKTLLSLNLANNNFQGPIPNGLQNLTLLKALDLSINHFSSSIPE 324

Query: 326  WLASFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLS---SQQLEGQIPRSFGRLCNL 382
            WL  F +L  ++L SN+LQG ++  + N+++ I  LDLS     + EG IP SF +LCNL
Sbjct: 325  WLYGFEHLKLLNLGSNNLQGVLSSAIGNMTSLIS-LDLSLNHELKFEGGIPGSFKKLCNL 383

Query: 383  REISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSH 442
            R +SLS+VK++QDI+E+L++   C+S+ +ES D+ GC +FG LT+ +G F++L  L L  
Sbjct: 384  RTLSLSNVKLNQDIAEVLEVLLGCVSEEVESLDLAGCLLFGQLTNHLGKFRNLAYLGLRS 443

Query: 443  NSISGLIPSSLGGLSSLERVVLSNNTLKGYL------------------------SEIHL 478
            NSISG IP +LG L SL  +VLS+N L G L                        SE+H 
Sbjct: 444  NSISGPIPMALGELVSLRSLVLSDNKLNGTLPKSFGELTKLEEMDISHNLFQGEVSEVHF 503

Query: 479  ANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDLQSCHLGPTFPFWLLSQNVLGYLDIS 538
            ANL  L +F  +GN L L+V PDWIPP QL  +DL+S ++GP FP W+     L YLDIS
Sbjct: 504  ANLKNLRNFSAAGNQLNLRVSPDWIPP-QLVFIDLRSWNVGPQFPKWVRPLEHLSYLDIS 562

Query: 539  RSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPN---LSKATGLRTVDLSSNNLSGTLP 595
             S I  T+P  FW  S ++ +LN S+++I G IP+   L        VDLSSN   G LP
Sbjct: 563  NSSISSTIPIWFWTMSFRMEYLNLSHNQIQGVIPSKLKLDFTASYPLVDLSSNQFKGPLP 622

Query: 596  LISFQLESIDLSNNAFSGSISPVLCNGMR--GELQVLNLENNSFSGEIPDCWMNFLYLRV 653
             I   + ++DLSNN+FSGS+   LC+ +     +QVLNL  N  SG IPDCW ++ YL  
Sbjct: 623  SIFSNVGALDLSNNSFSGSMLNFLCHKIDELKNMQVLNLGENLLSGVIPDCWSSWQYLVA 682

Query: 654  LNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDI 713
            + L NN  +GN+P S+G+L  L  LH++ +SLSG++P SL NC +L++L++  N+  G +
Sbjct: 683  IKLSNNKLSGNIPDSIGALSLLESLHIRNSSLSGKLPISLKNCTKLITLDVAENELVGSM 742

Query: 714  PTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMV 773
            P WIG++FSSMV+LN+R+N F G+ P ELC L SLQILDL +N LS +IP C + LSAM 
Sbjct: 743  PAWIGKRFSSMVVLNMRANKFHGRIPRELCNLASLQILDLAHNRLSWSIPTCFNKLSAMA 802

Query: 774  TVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALIDLS 833
            T +  LG  +                 S S   +   LVMKGK +EYSTIL  V  IDLS
Sbjct: 803  TRNDSLGKIYLD---------------SGSSTFDNVLLVMKGKVVEYSTILKFVRSIDLS 847

Query: 834  KNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSV 893
             N   GEIP EVT L  L+SLNLS N  +GRIP+ IG+++ +E +DFS NQLS EIP+S+
Sbjct: 848  SNALCGEIPEEVTRLSELQSLNLSQNSLTGRIPEGIGSLRYLESMDFSVNQLSGEIPQSM 907

Query: 894  SNLTFLNLLNLSYNYLSGEIPTSTQLQSFDASCFIGNDLCGSPLSRNCTETVPMPQDGNG 953
            S+LTFL+ LNLS N L G IP+ TQLQSF  S F GN+LCG PLS+NC+       +   
Sbjct: 908  SDLTFLSHLNLSDNRLRGRIPSGTQLQSFGPSSFSGNELCGPPLSKNCSVDNKFHVEHER 967

Query: 954  EDDEDEVE--WFYVSMALGCVVGFWFVIGPLIVNRRWRYMYSVFLDRLGDK 1002
            E+D + ++  WFYVSM LG +VGFW V+GPL+ NRRWRY+Y  FLDRL D+
Sbjct: 968  EEDGNGLKGRWFYVSMVLGFIVGFWGVVGPLMFNRRWRYVYYHFLDRLRDQ 1018




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|356561552|ref|XP_003549045.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Glycine max] Back     alignment and taxonomy information
>gi|356561667|ref|XP_003549101.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Glycine max] Back     alignment and taxonomy information
>gi|356561665|ref|XP_003549100.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Glycine max] Back     alignment and taxonomy information
>gi|356561655|ref|XP_003549095.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|356566257|ref|XP_003551350.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
>gi|356561661|ref|XP_003549098.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
>gi|255581850|ref|XP_002531725.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223528628|gb|EEF30645.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1011
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.825 0.922 0.326 7.7e-103
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.694 0.865 0.292 8.9e-70
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.791 0.813 0.278 1.7e-60
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.833 0.827 0.271 1e-58
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.665 0.778 0.295 2.5e-57
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.721 0.818 0.282 1.3e-56
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.790 0.803 0.279 3.1e-56
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.839 0.849 0.267 5.8e-55
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.720 0.582 0.283 4.9e-53
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.610 0.549 0.263 6.7e-53
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1019 (363.8 bits), Expect = 7.7e-103, P = 7.7e-103
 Identities = 299/916 (32%), Positives = 453/916 (49%)

Query:     7 FVLLELLAVATISLSFCGGATCLGHCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADC 66
             F+   +L +   +L++  G+     CI +ER+ALL F+  L D S+RL SW+G     DC
Sbjct:    10 FISFLILILLLKNLNY--GSAASPKCISTERQALLTFRAALTDLSSRLFSWSGP----DC 63

Query:    67 CKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKI 126
             C W GV+CD  T HV+++ L NP                   +     + Y+R    GKI
Sbjct:    64 CNWPGVLCDARTSHVVKIDLRNP-------------------SQDVRSDEYKRGSLRGKI 104

Query:   127 NPSLLHFQHLNYLDLSGNSFGG-GIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQ 185
             +PSL   + L+YLDLS N F    IP F+G +  L+YLNLS + F G IP  LGNLSKL+
Sbjct:   105 HPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLE 164

Query:   186 YLDLVENS-------ELYVDNLSWLPGLSL-LQHLDLGGVNLGKAFD-WSLAINXXXXXX 236
              LDL   S        L   NL WL  LS  L++L++G VNL  A + W    +      
Sbjct:   165 SLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALK 224

Query:   237 XXXXXGCQLDHFHPPPI---VNISSISVLDLSSNQFDQNSLVLSWVFGLSNLVYLDLGSN 293
                    +L +  PP +    ++  + VLDLS N    NS + +W+FGL+NL  L L  +
Sbjct:   225 ELHLFNSELKNL-PPTLSSSADLKLLEVLDLSENSL--NSPIPNWLFGLTNLRKLFLRWD 281

Query:   294 DFQGSIPVGLQNLTSLRHLDLSYN-DFNSSIPNWLASFSNLVHISLRSNSLQGSITGFL- 351
               QGSIP G +NL  L  LDLS N      IP+ L     L  + L +N L G I GFL 
Sbjct:   282 FLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLD 341

Query:   352 ---ANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCIS 408
                 N   S+  LDLSS +L G +P S G L NL+ + LS    +  +   +   +S   
Sbjct:   342 AFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMAS--- 398

Query:   409 DRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNXXXXXXXXXXXXXXXXERVVLSNNT 468
               L+  D++   + G +   +G    L  L L  N                 + +    T
Sbjct:   399 --LKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSI--RLT 454

Query:   469 LKGYLSEIHLANLSKLVSFDVSGNAL-TLKVG--PDWIP-PFQLEKLDLQSCHLGPTFP- 523
              + Y S +     + +  F +    +   ++G  P W+    +L  + L++  +  T P 
Sbjct:   455 TEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPD 514

Query:   524 FWL--LSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLS-KATGL 580
              W   +S  V  YL ++ + I+  +P +   A P+L  ++ S++   G  P  S  AT L
Sbjct:   515 SWFSGISSKVT-YLILANNRIKGRLPQKL--AFPKLNTIDLSSNNFEGTFPLWSTNATEL 571

Query:   581 RTVDLSSNNLSGTLP----LISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNS 636
             R   L  NN SG+LP    ++  ++E I L +N+F+G+I   LC  + G LQ+L+L  N 
Sbjct:   572 R---LYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCE-VSG-LQILSLRKNH 626

Query:   637 FSGEIPDCWMNFLYLRVXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNSLSGRIPESLSNC 696
             FSG  P CW     L                              +NSL G+IPESL NC
Sbjct:   627 FSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNC 686

Query:   697 NRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYN 756
             + L ++++ GN+ +G +P+W+G K SS+ +L L+SN F GQ P +LC + +L+ILDL  N
Sbjct:   687 SGLTNIDLGGNKLTGKLPSWVG-KLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGN 745

Query:   757 NLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGK 816
              +SG IPKCISNL+A+       G  +    +     +      + ++ I  +   + G+
Sbjct:   746 KISGPIPKCISNLTAIAR-----GTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGE 800

Query:   817 -ELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSI 875
                E   +LYL  +++LS+N+ +G IP ++++L  L +L+LS N FSG IP S  A+ S+
Sbjct:   801 IPREILGLLYL-RILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSL 859

Query:   876 EVIDFSNNQLSEEIPR 891
             + ++ S N+L   IP+
Sbjct:   860 QRLNLSFNKLEGSIPK 875


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-49
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  234 bits (599), Expect = 4e-64
 Identities = 202/665 (30%), Positives = 305/665 (45%), Gaps = 133/665 (20%)

Query: 230 NSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFD----QNSLVLSWVFGLSNL 285
           N+ S +  + LSG  +       I  +  I  ++LS+NQ       +    S     S+L
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTS-----SSL 120

Query: 286 VYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQG 345
            YL+L +N+F GSIP G  ++ +L  LDLS N  +  IPN + SFS+L  + L  N L G
Sbjct: 121 RYLNLSNNNFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVG 178

Query: 346 SITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSS 405
            I   L NL+ S+E L L+S QL GQIPR  G++ +L+ I L    +S            
Sbjct: 179 KIPNSLTNLT-SLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLS------------ 225

Query: 406 CISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLS 465
                            G +  +IG   SL+ L L +N+++G IPSSLG L +L+ + L 
Sbjct: 226 -----------------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLY 268

Query: 466 NNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQ-LEKLDLQSCHLGPTFPF 524
            N L G +    + +L KL+S D+S N+L+ ++ P+ +   Q LE L L S +     P 
Sbjct: 269 QNKLSGPIPP-SIFSLQKLISLDLSDNSLSGEI-PELVIQLQNLEILHLFSNNFTGKIPV 326

Query: 525 WLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIP-NLSKATGLRTV 583
            L S                          P+L  L   +++ +GEIP NL K   L  +
Sbjct: 327 ALTSL-------------------------PRLQVLQLWSNKFSGEIPKNLGKHNNLTVL 361

Query: 584 DLSSNNLSGTLP---LISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGE 640
           DLS+NNL+G +P     S  L  + L +N+  G I   L  G    L+ + L++NSFSGE
Sbjct: 362 DLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSL--GACRSLRRVRLQDNSFSGE 419

Query: 641 IPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSGRIPESLSNCNRLV 700
           +P  +     +  L++ NNN  G +      + SL +L L +N   G +P+S     RL 
Sbjct: 420 LPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKRLE 478

Query: 701 SLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSG 760
           +L++  NQFSG +P  +G   S ++ L L  N   G+ P EL     L  LDL +N LSG
Sbjct: 479 NLDLSRNQFSGAVPRKLG-SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSG 537

Query: 761 AIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEY 820
            IP                                     SFS+                
Sbjct: 538 QIPA------------------------------------SFSE---------------- 545

Query: 821 STILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDF 880
              + +++ +DLS+N  SGEIP  + ++ +L  +N+S+NH  G +P S GA  +I     
Sbjct: 546 ---MPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP-STGAFLAINASAV 601

Query: 881 SNNQL 885
           + N  
Sbjct: 602 AGNID 606


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1011
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.55
PLN03150623 hypothetical protein; Provisional 99.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.72
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.56
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.03
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.9
KOG4341483 consensus F-box protein containing LRR [General fu 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG4341483 consensus F-box protein containing LRR [General fu 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.65
PRK15386426 type III secretion protein GogB; Provisional 97.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.45
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.38
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.24
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.14
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.68
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.67
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
KOG4308478 consensus LRR-containing protein [Function unknown 95.37
KOG4308478 consensus LRR-containing protein [Function unknown 93.88
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 87.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.76
smart0037026 LRR Leucine-rich repeats, outliers. 85.76
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.63
smart0037026 LRR Leucine-rich repeats, outliers. 84.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.32
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.6
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.9e-71  Score=708.16  Aligned_cols=583  Identities=35%  Similarity=0.560  Sum_probs=386.1

Q ss_pred             CHHHHHHHHhhhccCCCCCCCccCCCCCCCCCCCccceeeEecCCCCceEEEEcCCCCCCCCCCCCCCcchhhhhhcccc
Q 001801           33 IESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPLNHPISYHTSPAQYSIIYRTYGA  112 (1011)
Q Consensus        33 ~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (1011)
                      +++|++||++||+++.+|.+.+.+|.   .+++||.|+||+|++ .++|+.|+|+++                       
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~-----------------------   79 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGK-----------------------   79 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCC-----------------------
Confidence            56899999999999988888889997   577899999999985 679999999984                       


Q ss_pred             hhhhhccccCCccccccccCCCCCCEEECCCCCCCCCCCcccc-CCCCCCEeeCCCCCCCCCCccccCCCCCCCEEeCCC
Q 001801          113 EYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGIPRFLG-SMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVE  191 (1011)
Q Consensus       113 ~~~~~~~~~~~g~l~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~-~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~L~~  191 (1011)
                              .+.|.+++.+..+++|++|+|++|.+++.+|..+. .+++|++|+|++|++++.+|.  +.+++|++|+|++
T Consensus        80 --------~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~  149 (968)
T PLN00113         80 --------NISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSN  149 (968)
T ss_pred             --------CccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcC
Confidence                    67788888999999999999999999888887655 899999999999998887774  3344455555444


Q ss_pred             CCCcCCCCCCCCCCCCCCcEEeCCCCCCCCccchHHHhcCCCCCCEEEcCCCCCCCCCCCCCCCCCCccEEECCCCCCCC
Q 001801          192 NSELYVDNLSWLPGLSLLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSNQFDQ  271 (1011)
Q Consensus       192 n~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~  271 (1011)
                      |                                                   .+++..|..++++++|++|++++|.+.+
T Consensus       150 n---------------------------------------------------~~~~~~p~~~~~l~~L~~L~L~~n~l~~  178 (968)
T PLN00113        150 N---------------------------------------------------MLSGEIPNDIGSFSSLKVLDLGGNVLVG  178 (968)
T ss_pred             C---------------------------------------------------cccccCChHHhcCCCCCEEECccCcccc
Confidence            3                                                   3333333334444444444444444433


Q ss_pred             ChhhhHhhhCCCCCcEEEccCCCCcccCcccccCCCCCCEEeCCCCCCCCCcchhccCCCCCcEEEccCCCCCCchhhHH
Q 001801          272 NSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLASFSNLVHISLRSNSLQGSITGFL  351 (1011)
Q Consensus       272 ~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l  351 (1011)
                      .  .|..++++++|++|++++|.+++.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+++.+|.. 
T Consensus       179 ~--~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~-  255 (968)
T PLN00113        179 K--IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS-  255 (968)
T ss_pred             c--CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh-
Confidence            2  4444444444444444444444444444444444444444444444444444444444444444444444444444 


Q ss_pred             HhhhccccEEecccCcCcCCCchhccCCCCCCEEEccCccCCcchhHHHhhhcccccCCcceeeccCCcccccCcccccC
Q 001801          352 ANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLSDVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQIGH  431 (1011)
Q Consensus       352 ~~l~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~l~~~~p~~l~~  431 (1011)
                                              ++++++|++|++++|.                             +.+.+|..+.+
T Consensus       256 ------------------------l~~l~~L~~L~L~~n~-----------------------------l~~~~p~~l~~  282 (968)
T PLN00113        256 ------------------------LGNLKNLQYLFLYQNK-----------------------------LSGPIPPSIFS  282 (968)
T ss_pred             ------------------------HhCCCCCCEEECcCCe-----------------------------eeccCchhHhh
Confidence                                    4444444444444433                             33333444444


Q ss_pred             CCCCCEEEccCCcCCCcCcccccCCCcCcEEEeecCccccccChhhhcCCCCccEEEccCCeeeeecCCCCCCcccccee
Q 001801          432 FKSLDSLFLSHNSISGLIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKL  511 (1011)
Q Consensus       432 l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L  511 (1011)
                      +++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|. .+..+++|+.|++++|.+.                
T Consensus       283 l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~l~~L~~L~L~~n~l~----------------  345 (968)
T PLN00113        283 LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQLWSNKFS----------------  345 (968)
T ss_pred             ccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh-hHhcCCCCCEEECcCCCCc----------------
Confidence            44445555555555444555555555555555555554443332 2222222222222211111                


Q ss_pred             ecccCcCCCCccccccCCCCCCEEecCCCCCCCCcchhHhhhcCcccccccccccccccCCCccccCCCcEEEccCcccC
Q 001801          512 DLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEIPNLSKATGLRTVDLSSNNLS  591 (1011)
Q Consensus       512 ~L~~n~l~~~~~~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~~~L~~L~Ls~n~l~  591 (1011)
                                                      +.+|.                                           
T Consensus       346 --------------------------------~~~p~-------------------------------------------  350 (968)
T PLN00113        346 --------------------------------GEIPK-------------------------------------------  350 (968)
T ss_pred             --------------------------------CcCCh-------------------------------------------
Confidence                                            11111                                           


Q ss_pred             ccCCCcccCCceeecccccCCCCCChhhccCCCCcccEEeeccccccccCChhhhccccCcEEecCCCcccccCCccccC
Q 001801          592 GTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGELQVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGS  671 (1011)
Q Consensus       592 ~~~p~~~~~L~~L~ls~n~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~  671 (1011)
                                                .+..  +++|+.|++++|++++.+|..+..+++|+.|++++|++.+.+|..++.
T Consensus       351 --------------------------~l~~--~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~  402 (968)
T PLN00113        351 --------------------------NLGK--HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGA  402 (968)
T ss_pred             --------------------------HHhC--CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhC
Confidence                                      0000  234444455555555555555555555666666666666666666666


Q ss_pred             CCcccEEeCcCCcccccCCccccCCCCCcEEEcCCCccccccChhHhhccCCCcEEEeccccccccCCccccCCCCCcEE
Q 001801          672 LGSLTLLHLQKNSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTSLQIL  751 (1011)
Q Consensus       672 l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L  751 (1011)
                      +++|+.|++++|++++.+|..+..+++|+.|++++|++++.+|..+. .+++|+.|++++|.+.+.+|..+ ..++|+.|
T Consensus       403 ~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L  480 (968)
T PLN00113        403 CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENL  480 (968)
T ss_pred             CCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccceEE
Confidence            66666666666666666666666666666666666666666665554 56666666666666666666554 34788888


Q ss_pred             EccCccccccccccccccccCccccCCCCCCCCCccCCcccccCCCCCCCCCCcccceEEEecCcchhhhhhcceeEEEE
Q 001801          752 DLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIEKAFLVMKGKELEYSTILYLVALID  831 (1011)
Q Consensus       752 ~Ls~N~l~~~~p~~l~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Ld  831 (1011)
                      ++++|++++.+|..+.++++|                                                       +.||
T Consensus       481 ~ls~n~l~~~~~~~~~~l~~L-------------------------------------------------------~~L~  505 (968)
T PLN00113        481 DLSRNQFSGAVPRKLGSLSEL-------------------------------------------------------MQLK  505 (968)
T ss_pred             ECcCCccCCccChhhhhhhcc-------------------------------------------------------CEEE
Confidence            888888888888877766665                                                       5689


Q ss_pred             ccCCcceecCchhccccccCceeeccCccccccccccccCCCCCCEEeCcCCcccccCCccccCCCCCCeEEcccCcccc
Q 001801          832 LSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSG  911 (1011)
Q Consensus       832 Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~L~Ls~N~l~~~ip~~l~~l~~L~~L~ls~N~l~g  911 (1011)
                      |++|+++|.+|..++++++|++|+|++|.++|.+|..++++++|+.|||++|+++|.+|..+..+++|+.||+++|+++|
T Consensus       506 Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~  585 (968)
T PLN00113        506 LSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHG  585 (968)
T ss_pred             CcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcccCccCccccCCC-CCCCCC
Q 001801          912 EIPTSTQLQSFDASCFIGN-DLCGSP  936 (1011)
Q Consensus       912 ~iP~~~~~~~~~~~~~~~n-~lcg~~  936 (1011)
                      .+|..+++.++...+|.|| .+||.+
T Consensus       586 ~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        586 SLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             eCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999 899865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-40
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-40
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-11
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 1e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-06
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 7e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-05
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 165 bits (417), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 197/715 (27%), Positives = 293/715 (40%), Gaps = 116/715 (16%) Query: 290 LGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNW--LASFSNLVHISLRSNSLQ--G 345 L ++ GS+ G + SL LDLS N + + L S S L +++ SN+L G Sbjct: 81 LSNSHINGSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPG 139 Query: 346 SITGFLANLSASIEVLDLSSQQLEGQ--IPRSFGRLC-NLREISLSDVKMSQDIS----- 397 ++G L S+EVLDLS+ + G + C L+ +++S K+S D+ Sbjct: 140 KVSGGLK--LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV 197 Query: 398 --EILDIFSSCISDRLESWDMTGCKIFGHLTSQIGHFKSLDSLFLSHNXXXXXXXXXXXX 455 E LD+ S+ S TG G ++ Sbjct: 198 NLEFLDVSSNNFS--------TGIPFLGDCSA---------------------------- 221 Query: 456 XXXXERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQLEKLDL-- 513 + + +S N L G S ++ ++L ++S N VGP IPP L+ L Sbjct: 222 ---LQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQF---VGP--IPPLPLKSLQYLS 272 Query: 514 --QSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRINGEI 571 ++ G F + + L LD+S + VP F S SN+ +GE+ Sbjct: 273 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN-FSGEL 331 Query: 572 P--NLSKATGLRTVDLSSNNLSGTLPL----ISFQLESIDLSNNAFSGSISPVLCNGMRG 625 P L K GL+ +DLS N SG LP +S L ++DLS+N FSG I P LC + Sbjct: 332 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 391 Query: 626 ELQVLNLENNSFSGEIPDCWMN----------FLYLRVXXXXXXXXXXXXXXXXXXXXXX 675 LQ L L+NN F+G+IP N F YL Sbjct: 392 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 451 Query: 676 XXXXXQK--------------NSLSGRIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKF 721 Q+ N L+G IP LSNC L +++ N+ +G+IP WIG + Sbjct: 452 EGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RL 510 Query: 722 SSMVILNLRSNIFDGQFPTELCFLTSLQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGD 781 ++ IL L +N F G P EL SL LDL N +G IP + S + ++ G Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK 570 Query: 782 THPGITDCSLYRSC----------------LPRPRSFSDPIEKAFLVMKGKELEYSTILY 825 + I + + + C L R S +P V G Sbjct: 571 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR-LSTRNPCNITSRVYGGHTSPTFDNNG 629 Query: 826 LVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPDSIGAMKSIEVIDFSNNQL 885 + +D+S N SG IP E+ + L LNL +N SG IPD +G ++ + ++D S+N+L Sbjct: 630 SMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKL 689 Query: 886 SEEIPRXXXXXXXXXXXXXXXXXXXGEIPTSTQLQSFDASCFIGN-DLCGSPLSR 939 IP+ G IP Q ++F + F+ N LCG PL R Sbjct: 690 DGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 744
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-180
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-79
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-72
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-51
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-72
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-28
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-43
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-53
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-40
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-29
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  542 bits (1399), Expect = e-180
 Identities = 220/941 (23%), Positives = 339/941 (36%), Gaps = 225/941 (23%)

Query: 31  HCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCKWSGVVCDNFTGHVLELRLGNPL 90
             +  E   L+ FK  L D  N L  W+      + C + GV C +    V  +      
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWSS---NKNPCTFDGVTCRD--DKVTSI------ 55

Query: 91  NHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFGGGI 150
                                                        L+   L+       +
Sbjct: 56  --------------------------------------------DLSSKPLNV--GFSAV 69

Query: 151 PRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLSLLQ 210
              L S+  L+ L LS +   G +       + L  LDL  N                  
Sbjct: 70  SSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRN------------------ 110

Query: 211 HLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIV-NISSISVLDLSSNQF 269
                  +L        ++ S S L+ L +S   LD          ++S+ VLDLS+N  
Sbjct: 111 -------SLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSI 163

Query: 270 -DQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWLA 328
              N +      G   L +L +  N   G + V      +L  LD+S N+F++ IP +L 
Sbjct: 164 SGANVVGWVLSDGCGELKHLAISGNKISGDVDVS--RCVNLEFLDVSSNNFSTGIP-FLG 220

Query: 329 SFSNLVHISLRSNSLQGSITGFLANLSASIEVLDLSSQQLEGQIPRSFGRLCNLREISLS 388
             S L H+ +  N L G  +  ++  +  +++L++SS Q  G IP     L +L+ +SL+
Sbjct: 221 DCSALQHLDISGNKLSGDFSRAISTCT-ELKLLNISSNQFVGPIPPL--PLKSLQYLSLA 277

Query: 389 DVKMSQDISEILDIFSSCISDRLESWDMTGCKIFGHLTSQI-GHFKSLDSLFLSHNSISG 447
           +                              K  G +   + G   +L  L LS N   G
Sbjct: 278 E-----------------------------NKFTGEIPDFLSGACDTLTGLDLSGNHFYG 308

Query: 448 LIPSSLGGLSSLERVVLSNNTLKGYLSEIHLANLSKLVSFDVSGNALTLKVGPDWIPPFQ 507
            +P   G  S LE + LS+N   G L    L  +  L   D+S N  +            
Sbjct: 309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS------------ 356

Query: 508 LEKLDLQSCHLGPTFPFWLLSQNVLGYLDISRSGIQDTVPARFWEASPQLYFLNFSNSRI 567
                                                 +P      S  L  L+ S++  
Sbjct: 357 ------------------------------------GELPESLTNLSASLLTLDLSSNNF 380

Query: 568 NGEIPNLSKATGLRTVDLSSNNLSGTLPLISFQLESIDLSNNAFSGSISPVLCNGMRGEL 627
           +G I            +L  N  +         L+ + L NN F+G I P L N    EL
Sbjct: 381 SGPILP----------NLCQNPKN--------TLQELYLQNNGFTGKIPPTLSN--CSEL 420

Query: 628 QVLNLENNSFSGEIPDCWMNFLYLRVLNLGNNNFTGNLPPSLGSLGSLTLLHLQKNSLSG 687
             L+L  N  SG IP    +   LR L L  N   G +P  L  + +L  L L  N L+G
Sbjct: 421 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTG 480

Query: 688 RIPESLSNCNRLVSLNMDGNQFSGDIPTWIGEKFSSMVILNLRSNIFDGQFPTELCFLTS 747
            IP  LSNC  L  +++  N+ +G+IP WIG +  ++ IL L +N F G  P EL    S
Sbjct: 481 EIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRS 539

Query: 748 LQILDLGYNNLSGAIPKCISNLSAMVTVDYPLGDTHPGITDCSLYRSCLPRPRSFSDPIE 807
           L  LDL  N  +G IP  +   S  +  ++  G  +  I +  + + C            
Sbjct: 540 LIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH---------GA 590

Query: 808 KAFLVMKGKELEYSTILYLVALIDLSKNNFSGEIPVEVTDLVALRSLNLSYNHFSGRIPD 867
              L  +G   E    L      +++   + G       +  ++  L++SYN  SG IP 
Sbjct: 591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK 650

Query: 868 SIGAMKSIEVIDFSNNQLSEEIPRSVSNLTFLNLLNLSYNYLSGEIPTS----------- 916
            IG+M  + +++  +N +S  IP  V +L  LN+L+LS N L G IP +           
Sbjct: 651 EIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEID 710

Query: 917 -------------TQLQSFDASCFIGND-LCGSPLSRNCTE 943
                         Q ++F  + F+ N  LCG PL R    
Sbjct: 711 LSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPS 751


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1011
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-23
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 99.1 bits (245), Expect = 4e-23
 Identities = 73/316 (23%), Positives = 117/316 (37%), Gaps = 19/316 (6%)

Query: 32  CIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCC--KWSGVVCDN--FTGHVLELRLG 87
           C   +++ALL+ KKDL +P+  L SW       DCC   W GV+CD    T  V  L L 
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT-LSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLS 58

Query: 88  NPLNHPISYHTSPAQYSIIYRTYGAEYEAYERSKFGGKINPSLLHFQHLNYLDLSGNSFG 147
               +    +  P+  S+    Y         +   G I P++     L+YL ++  +  
Sbjct: 59  G--LNLPKPYPIPS--SLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 148 GGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSKLQYLDLVENSELYVDNLSWLPGLS 207
           G IP FL  +  L  L+ S     G +P  + +L  L  +    N        S+     
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK 174

Query: 208 LLQHLDLGGVNLGKAFDWSLAINSLSSLRVLRLSGCQLDHFHPPPIVNISSISVLDLSSN 267
           L   + +    L      + A  +L+ +          +       V   S         
Sbjct: 175 LFTSMTISRNRLTGKIPPTFANLNLAFVD------LSRNMLEGDASVLFGSDKNTQKIHL 228

Query: 268 QFDQNSLVLSWVFGLSNLVYLDLGSNDFQGSIPVGLQNLTSLRHLDLSYNDFNSSIPNWL 327
             +  +  L  V    NL  LDL +N   G++P GL  L  L  L++S+N+    IP   
Sbjct: 229 AKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-G 287

Query: 328 ASFSNLVHISLRSNSL 343
            +       +  +N  
Sbjct: 288 GNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1011
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.87
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.76
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.65
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.62
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.16
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=293.92  Aligned_cols=128  Identities=36%  Similarity=0.649  Sum_probs=106.5

Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC--CEEEEECCCC--CCEEEEECCCCCCCCCCCCCCCCCHHHH
Q ss_conf             99999999999511018799998568878999999866--0015735999--9659997599999998778898620132
Q 001801           31 HCIESEREALLKFKKDLKDPSNRLVSWNGAGDGADCCK--WSGVVCDNFT--GHVLELRLGNPLNHPISYHTSPAQYSII  106 (1011)
Q Consensus        31 ~~~~~~~~~ll~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~~--~~v~~L~l~~~~~~~~~~~~~~~~~~~~  106 (1011)
                      .|.++|++||++||+++.+|. .+++|.   .++|||.  |.||+|+...  +||+.|+|++.                 
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~-----------------   60 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL-----------------   60 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECC-----------------
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-CCCCCC---CCCCCCCCCCCCEEEECCCCCEEEEEEECCCC-----------------
T ss_conf             989899999999999779998-677889---99999889488969748999479889989899-----------------


Q ss_pred             HHCCCCHHHHHCCCCCCC--CCCCCCCCCCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             311351011100235776--1155452788898897889-9899987722469999978637898788888432489999
Q 001801          107 YRTYGAEYEAYERSKFGG--KINPSLLHFQHLNYLDLSG-NSFGGGIPRFLGSMGKLKYLNLSGAGFKGMIPHQLGNLSK  183 (1011)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~--~l~~~l~~l~~L~~L~Ls~-~~~~~~~p~~l~~l~~L~~L~Ls~n~~~~~~p~~l~~l~~  183 (1011)
                                    .+.|  .+|+.++++++|++|+|++ |.+.+.+|..++++++|++|++++|.+.+..+..+..+.+
T Consensus        61 --------------~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~  126 (313)
T d1ogqa_          61 --------------NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKT  126 (313)
T ss_dssp             --------------CCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTT
T ss_pred             --------------CCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHH
T ss_conf             --------------888888798478467533520202654333002431145420011020356434433222220111


Q ss_pred             CCEEECCCCC
Q ss_conf             9899589998
Q 001801          184 LQYLDLVENS  193 (1011)
Q Consensus       184 L~~L~Ls~n~  193 (1011)
                      |++++++.|.
T Consensus       127 L~~l~l~~N~  136 (313)
T d1ogqa_         127 LVTLDFSYNA  136 (313)
T ss_dssp             CCEEECCSSE
T ss_pred             HCCCCCCCCC
T ss_conf             0011112245



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure