Citrus Sinensis ID: 001941
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 993 | ||||||
| 190148357 | 1053 | histidine kinase 3 [Betula pendula] | 0.953 | 0.899 | 0.792 | 0.0 | |
| 190148361 | 1019 | histidine kinase 3B [Populus trichocarpa | 0.951 | 0.927 | 0.783 | 0.0 | |
| 224075549 | 1029 | histidine kinase cytokinin receptor [Pop | 0.951 | 0.918 | 0.775 | 0.0 | |
| 225425392 | 1039 | PREDICTED: histidine kinase 3 [Vitis vin | 0.953 | 0.911 | 0.783 | 0.0 | |
| 224053503 | 1020 | histidine kinase cytokinin receptor [Pop | 0.952 | 0.927 | 0.765 | 0.0 | |
| 255547688 | 1005 | histidine kinase 1, 2, 3 plant, putative | 0.918 | 0.907 | 0.781 | 0.0 | |
| 356512385 | 1030 | PREDICTED: histidine kinase 3-like [Glyc | 0.951 | 0.917 | 0.746 | 0.0 | |
| 356525172 | 1030 | PREDICTED: histidine kinase 3-like [Glyc | 0.951 | 0.917 | 0.743 | 0.0 | |
| 116109353 | 1027 | histidine kinase 1 [Medicago sativa] | 0.951 | 0.920 | 0.730 | 0.0 | |
| 357462961 | 1047 | Histidine kinase [Medicago truncatula] g | 0.951 | 0.902 | 0.720 | 0.0 |
| >gi|190148357|gb|ACE63261.1| histidine kinase 3 [Betula pendula] | Back alignment and taxonomy information |
|---|
Score = 1538 bits (3983), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 757/955 (79%), Positives = 823/955 (86%), Gaps = 8/955 (0%)
Query: 1 MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYESKDTKTDLRGEVFKMWLNCWERI 60
MSLL+V GFGLKVGHLLWMLC WIVSVISMN F+N D+KT L + KMWL CWE+I
Sbjct: 1 MSLLNVVGFGLKVGHLLWMLCYWIVSVISMNWFINSGIMDSKTGLLSDSSKMWLRCWEKI 60
Query: 61 SGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQATEKRREALG 120
SGNS I H Y Q GSKRV + WWRK+LITW+ WT+VSLWIFWY+SSQATEKR+E+L
Sbjct: 61 SGNSCKIQHHYSQYFGSKRVPKEWWRKLLITWVFGWTIVSLWIFWYLSSQATEKRKESLA 120
Query: 121 SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTS 180
SMCDERARMLQDQFNVSMNH+QAMSI+IS FHHGKNPSAIDQ TF RYTERTAFERPLTS
Sbjct: 121 SMCDERARMLQDQFNVSMNHIQAMSIMISIFHHGKNPSAIDQRTFARYTERTAFERPLTS 180
Query: 181 GVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKD-------EPSPIEEEYAPVIFA 233
GVAYAVRVL SERE+FEKQQGWTIKRMDT E NPVH+D EPSPI+EEYAPVIFA
Sbjct: 181 GVAYAVRVLHSEREQFEKQQGWTIKRMDTLEQNPVHEDDYAPEALEPSPIQEEYAPVIFA 240
Query: 234 QDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAVYKRELPS 293
QDT+SHV+SLDMLSGKEDRENVL AR SGKGVLTAPF+LLKTNRLGVILTFAVYK +LPS
Sbjct: 241 QDTISHVVSLDMLSGKEDRENVLLARESGKGVLTAPFKLLKTNRLGVILTFAVYKTDLPS 300
Query: 294 NATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPISMYGSNVS 353
NATPNERI+ATDGYLGG+FDIESLVEKLL QLASKQTI VNVYD TN SHPISMYGSNVS
Sbjct: 301 NATPNERIQATDGYLGGVFDIESLVEKLLQQLASKQTILVNVYDTTNHSHPISMYGSNVS 360
Query: 354 DDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGHIFQATVNRI 413
DDGL S LNFGDPFRKHEM CRFKQK PWP LAI+TSIGILVIA LVG+IF ATVNRI
Sbjct: 361 DDGLQHGSALNFGDPFRKHEMHCRFKQKPPWPWLAITTSIGILVIALLVGYIFHATVNRI 420
Query: 414 AKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQD 473
AKVE+D M ELKK+AEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDT+LDVTQQD
Sbjct: 421 AKVEDDCQKMTELKKQAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTDLDVTQQD 480
Query: 474 YVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVE 533
YVRTAQ SGKALVSLINEVLDQAK+ESG+LELEAV F+LRAILDDVLSLFSGKS GVE
Sbjct: 481 YVRTAQDSGKALVSLINEVLDQAKIESGRLELEAVQFDLRAILDDVLSLFSGKSPGNGVE 540
Query: 534 LAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETEL 593
LAVYISD+VPE LIGD GRFRQIITNLMGNSIKFTEKGHIFVTV+LVEEV+ SIEVETE
Sbjct: 541 LAVYISDQVPEMLIGDAGRFRQIITNLMGNSIKFTEKGHIFVTVHLVEEVIGSIEVETE- 599
Query: 594 SSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQ 653
SSS NTLSG+PVADR SW GF+TF+Q+GST P SSS+DLINLIVSVEDTG GIP EAQ
Sbjct: 600 SSSNNTLSGFPVADRKSSWDGFRTFSQEGSTCPLSSSSSDLINLIVSVEDTGVGIPREAQ 659
Query: 654 SRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNG 713
SR+FTPFMQVGPSISRTHGGTGIGLSISK LVG MKGEIGFVSIPN GSTFTFTAVF N
Sbjct: 660 SRVFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFVSIPNTGSTFTFTAVFTNA 719
Query: 714 SSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQ 773
SS NE+ S Q+NNQ S SSEFQGM ALVVDPRP+RAKVSRYHIQRLGI+VE+V D Q
Sbjct: 720 SSHPNEYKSLQINNQSKSTSSEFQGMTALVVDPRPVRAKVSRYHIQRLGIRVELVPDLNQ 779
Query: 774 CLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRAN 833
+ I+SG+ I+M+LVEQEVW++D+ ++ LF+N +K KLFLLAN I SS+
Sbjct: 780 GFANISSGNTAIDMVLVEQEVWDRDSGIAVLFINKFKKSYSRIPPKLFLLANPIGSSKTR 839
Query: 834 TSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVD 893
+T P VIMKPLR+SML+ASLQRAMGVGNKGN RN ELP SLR+LLLGRKILIVD
Sbjct: 840 AATSDDYTPPVIMKPLRASMLSASLQRAMGVGNKGNPRNGELPGSSLRNLLLGRKILIVD 899
Query: 894 DNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYE 948
DNNVNL+VAA LK+YGA VVC E GKKA LL PPH FDACFMDIQMPE+DG+E
Sbjct: 900 DNNVNLRVAAGALKKYGADVVCAESGKKAISLLKPPHHFDACFMDIQMPEIDGFE 954
|
Source: Betula pendula Species: Betula pendula Genus: Betula Family: Betulaceae Order: Fagales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|190148361|gb|ACE63263.1| histidine kinase 3B [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224075549|ref|XP_002304678.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222842110|gb|EEE79657.1| histidine kinase cytokinin receptor [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225425392|ref|XP_002276961.1| PREDICTED: histidine kinase 3 [Vitis vinifera] gi|297738469|emb|CBI27670.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224053503|ref|XP_002297846.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|190148359|gb|ACE63262.1| histidine kinase 3A [Populus trichocarpa] gi|222845104|gb|EEE82651.1| histidine kinase cytokinin receptor [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255547688|ref|XP_002514901.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] gi|223545952|gb|EEF47455.1| histidine kinase 1, 2, 3 plant, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356512385|ref|XP_003524900.1| PREDICTED: histidine kinase 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356525172|ref|XP_003531201.1| PREDICTED: histidine kinase 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|116109353|gb|ABJ74169.1| histidine kinase 1 [Medicago sativa] | Back alignment and taxonomy information |
|---|
| >gi|357462961|ref|XP_003601762.1| Histidine kinase [Medicago truncatula] gi|355490810|gb|AES72013.1| Histidine kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 993 | ||||||
| TAIR|locus:2015964 | 1036 | HK3 "histidine kinase 3" [Arab | 0.941 | 0.902 | 0.702 | 0.0 | |
| TAIR|locus:2177261 | 1176 | HK2 "histidine kinase 2" [Arab | 0.849 | 0.717 | 0.571 | 4.7e-251 | |
| TAIR|locus:2059718 | 1080 | WOL "WOODEN LEG" [Arabidopsis | 0.709 | 0.652 | 0.567 | 2.3e-204 | |
| TIGR_CMR|CPS_4165 | 1683 | CPS_4165 "sensory box histidin | 0.202 | 0.119 | 0.387 | 6.9e-54 | |
| DICTYBASE|DDB_G0269204 | 1699 | dhkE "histidine kinase E" [Dic | 0.342 | 0.200 | 0.338 | 2.4e-51 | |
| UNIPROTKB|Q9KPC0 | 927 | VC_2453 "Sensor histidine kina | 0.343 | 0.367 | 0.299 | 1.8e-50 | |
| TIGR_CMR|VC_2453 | 927 | VC_2453 "sensor histidine kina | 0.343 | 0.367 | 0.299 | 1.8e-50 | |
| TIGR_CMR|GSU_2314 | 1025 | GSU_2314 "sensory box histidin | 0.184 | 0.178 | 0.392 | 2e-48 | |
| TIGR_CMR|CPS_4117 | 948 | CPS_4117 "sensor histidine kin | 0.179 | 0.187 | 0.390 | 2.3e-47 | |
| TIGR_CMR|SPO_0132 | 739 | SPO_0132 "sensor histidine kin | 0.252 | 0.339 | 0.357 | 7e-47 |
| TAIR|locus:2015964 HK3 "histidine kinase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3334 (1178.7 bits), Expect = 0., P = 0.
Identities = 677/964 (70%), Positives = 765/964 (79%)
Query: 1 MSLLHVFGFGLKVGHLLWMLCCWIVSVISMNCFMNYES---------KDTKTDLRGEVFK 51
MSL HV GFG+K+GHL WMLCCW VS N + + TK + K
Sbjct: 1 MSLFHVLGFGVKIGHLFWMLCCWFVSWFVDNGIEDKSGLLVGSVGDLEKTKMTTLKKKNK 60
Query: 52 MWLNCWERISGNSYYIHHLYYQSIGSKRVRETWWRKVLITWLLFWTLVSLWIFWYMSSQA 111
MW W +IS + I YQ +GS + + WWRK+++ W++FW LVS+W FWY SSQA
Sbjct: 61 MWF--WNKISSSGLKIPSFSYQFLGSVKFNKAWWRKLVVVWVVFWVLVSIWTFWYFSSQA 118
Query: 112 TEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTER 171
EKR+E L SMCDERARMLQDQFNVSMNHVQAMSILISTFHHGK PSAIDQ TF+ YT+R
Sbjct: 119 MEKRKETLASMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKIPSAIDQRTFSEYTDR 178
Query: 172 TAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKD-------EPSPIE 224
T+FERPLTSGVAYA+RVL SEREEFE+QQGWTI++M + E NPVHKD EPSP++
Sbjct: 179 TSFERPLTSGVAYAMRVLHSEREEFERQQGWTIRKMYSLEQNPVHKDDYDLEALEPSPVQ 238
Query: 225 EEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTF 284
EEYAPVIFAQDTVSHV+SLDMLSGKEDRENVLRAR+SGKGVLTAPF L+KTNRLGVILTF
Sbjct: 239 EEYAPVIFAQDTVSHVVSLDMLSGKEDRENVLRARSSGKGVLTAPFPLIKTNRLGVILTF 298
Query: 285 AVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHP 344
AVYKR+LPSNATP ERIEAT+GYLGG+FDIESLVE LL QLASKQTI VNVYDITN S P
Sbjct: 299 AVYKRDLPSNATPKERIEATNGYLGGVFDIESLVENLLQQLASKQTILVNVYDITNHSQP 358
Query: 345 ISMYGSNVSDDGLWLVSTLNFGDPFRKHEMRCRFKQKAPWPLLAISTSIGILVIASLVGH 404
ISMYG+NVS DGL VS L FGDP RKHEMRCRFKQK PWP+L++ TS GILVIA LV H
Sbjct: 359 ISMYGTNVSADGLERVSPLIFGDPLRKHEMRCRFKQKPPWPVLSMVTSFGILVIALLVAH 418
Query: 405 IFQATVNRIAKVEEDYHGMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMD 464
I ATV+RI KVEED M +LKKKAEAADVAKSQFLATVSHEIRTPMNGVLGML MLMD
Sbjct: 419 IIHATVSRIHKVEEDCDKMKQLKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLHMLMD 478
Query: 465 TELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFS 524
TELDVTQQDYVRTAQASGKALVSLINEVLDQAK+ESGKLELE V F+LR ILDDVLSLFS
Sbjct: 479 TELDVTQQDYVRTAQASGKALVSLINEVLDQAKIESGKLELEEVRFDLRGILDDVLSLFS 538
Query: 525 GKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVV 584
KSQ KGVELAVYISDRVP+ LIGDPGRFRQI+TNLMGNSIKFTEKGHIFVTV+LV+E+
Sbjct: 539 SKSQQKGVELAVYISDRVPDMLIGDPGRFRQILTNLMGNSIKFTEKGHIFVTVHLVDELF 598
Query: 585 DSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDT 644
+SI+ ET SS ++TLSG PVADR SW+ FK F+ +G S F+ S D INLIVSVEDT
Sbjct: 599 ESIDGETA-SSPESTLSGLPVADRQRSWENFKAFSSNGHRS-FEPSPPD-INLIVSVEDT 655
Query: 645 GQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTF 704
G GIP+EAQSRIFTPFMQVGPSISRTHGGTGIGLSISK LVG MKGEIGF S P +GSTF
Sbjct: 656 GVGIPVEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFSSTPKVGSTF 715
Query: 705 TFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQ 764
TFTAVF NG + N NNQP + SEF+GMKA+VVD RP RAKVS YH QRLGI+
Sbjct: 716 TFTAVFSNGMQPAERKND---NNQP--IFSEFRGMKAVVVDHRPARAKVSWYHFQRLGIR 770
Query: 765 VEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLA 824
VEVV Q L + G+ +NMIL+EQE+W ++ F+ L+K KL LLA
Sbjct: 771 VEVVPRVEQALHYLKIGTTTVNMILIEQEIWNREADD---FIKKLQKDPLFLSPKLILLA 827
Query: 825 NSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLL 884
NS+ SS + G+ P VI+KPLR+SMLAA+LQR +G+G + ++ P++ LR+LL
Sbjct: 828 NSVESSISEALCTGIDPPIVIVKPLRASMLAATLQRGLGIGIREPPQHKGPPALILRNLL 887
Query: 885 LGRKILIVDDNNVNLKVAAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEM 944
LGRKILIVDDNNVNL+VAA LK+YGA VVC E G KA LL PPH+FDACFMDIQMPEM
Sbjct: 888 LGRKILIVDDNNVNLRVAAGALKKYGADVVCAESGIKAISLLKPPHEFDACFMDIQMPEM 947
Query: 945 DGYE 948
DG+E
Sbjct: 948 DGFE 951
|
|
| TAIR|locus:2177261 HK2 "histidine kinase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059718 WOL "WOODEN LEG" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4165 CPS_4165 "sensory box histidine kinase/response regulator" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269204 dhkE "histidine kinase E" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPC0 VC_2453 "Sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2453 VC_2453 "sensor histidine kinase/response regulator" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4117 CPS_4117 "sensor histidine kinase/response regulator" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0132 SPO_0132 "sensor histidine kinase/response regulator" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| HK3B | histidine kinase cytokinin receptor (1029 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 993 | |||
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 1e-92 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 5e-62 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 8e-53 | |
| COG0642 | 336 | COG0642, BaeS, Signal transduction histidine kinas | 4e-47 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 8e-47 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 3e-41 | |
| pfam03924 | 190 | pfam03924, CHASE, CHASE domain | 4e-40 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 1e-30 | |
| smart01079 | 176 | smart01079, CHASE, This domain is found in the ext | 3e-28 | |
| TIGR02966 | 333 | TIGR02966, phoR_proteo, phosphate regulon sensor k | 2e-27 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 1e-26 | |
| smart00387 | 111 | smart00387, HATPase_c, Histidine kinase-like ATPas | 8e-23 | |
| pfam02518 | 111 | pfam02518, HATPase_c, Histidine kinase-, DNA gyras | 2e-20 | |
| COG2205 | 890 | COG2205, KdpD, Osmosensitive K+ channel histidine | 6e-20 | |
| COG5002 | 459 | COG5002, VicK, Signal transduction histidine kinas | 4e-19 | |
| cd00075 | 103 | cd00075, HATPase_c, Histidine kinase-like ATPases; | 5e-19 | |
| smart00388 | 66 | smart00388, HisKA, His Kinase A (phosphoacceptor) | 7e-19 | |
| pfam00512 | 66 | pfam00512, HisKA, His Kinase A (phospho-acceptor) | 9e-19 | |
| COG4251 | 750 | COG4251, COG4251, Bacteriophytochrome (light-regul | 1e-17 | |
| TIGR01386 | 457 | TIGR01386, cztS_silS_copS, heavy metal sensor kina | 1e-17 | |
| PRK11360 | 607 | PRK11360, PRK11360, sensory histidine kinase AtoS; | 9e-16 | |
| PRK09835 | 482 | PRK09835, PRK09835, sensor kinase CusS; Provisiona | 1e-15 | |
| cd00082 | 65 | cd00082, HisKA, Histidine Kinase A (dimerization/p | 2e-15 | |
| PRK11006 | 430 | PRK11006, phoR, phosphate regulon sensor protein; | 1e-13 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 3e-13 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 3e-13 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 8e-13 | |
| PRK10549 | 466 | PRK10549, PRK10549, signal transduction histidine- | 2e-12 | |
| PRK10604 | 433 | PRK10604, PRK10604, sensor protein RstB; Provision | 4e-12 | |
| PRK11100 | 475 | PRK11100, PRK11100, sensory histidine kinase CreC; | 2e-11 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 5e-11 | |
| PRK13837 | 828 | PRK13837, PRK13837, two-component VirA-like sensor | 3e-10 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 1e-09 | |
| COG3852 | 363 | COG3852, NtrB, Signal transduction histidine kinas | 2e-09 | |
| PRK10364 | 457 | PRK10364, PRK10364, sensor protein ZraS; Provision | 5e-09 | |
| PRK09303 | 380 | PRK09303, PRK09303, adaptive-response sensory kina | 8e-09 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 2e-08 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 6e-08 | |
| PRK10618 | 894 | PRK10618, PRK10618, phosphotransfer intermediate p | 9e-08 | |
| PRK09303 | 380 | PRK09303, PRK09303, adaptive-response sensory kina | 2e-07 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 3e-07 | |
| PRK11073 | 348 | PRK11073, glnL, nitrogen regulation protein NR(II) | 7e-07 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 3e-06 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 6e-06 | |
| PRK09470 | 461 | PRK09470, cpxA, two-component sensor protein; Prov | 2e-05 | |
| COG3290 | 537 | COG3290, CitA, Signal transduction histidine kinas | 3e-05 | |
| TIGR02938 | 494 | TIGR02938, nifL_nitrog, nitrogen fixation negative | 3e-05 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 4e-05 | |
| TIGR02916 | 679 | TIGR02916, PEP_his_kin, putative PEP-CTERM system | 4e-05 | |
| PRK10490 | 895 | PRK10490, PRK10490, sensor protein KdpD; Provision | 5e-05 | |
| PRK09467 | 435 | PRK09467, envZ, osmolarity sensor protein; Provisi | 6e-05 | |
| TIGR03785 | 703 | TIGR03785, marine_sort_HK, proteobacterial dedicat | 7e-05 | |
| COG4192 | 673 | COG4192, COG4192, Signal transduction histidine ki | 9e-05 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 2e-04 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 2e-04 | |
| PRK11086 | 542 | PRK11086, PRK11086, sensory histidine kinase DcuS; | 3e-04 | |
| COG4191 | 603 | COG4191, COG4191, Signal transduction histidine ki | 3e-04 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 5e-04 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 6e-04 |
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
Score = 314 bits (807), Expect = 1e-92
Identities = 169/523 (32%), Positives = 242/523 (46%), Gaps = 82/523 (15%)
Query: 427 KKKA-EAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKAL 485
KK+A EAA + KS+FLA +SHE+RTP+NGV+G + T L TQ+DY++T + S L
Sbjct: 283 KKRAQEAARI-KSEFLANMSHELRTPLNGVIGFTRQTLKTPLTPTQRDYLQTIERSANNL 341
Query: 486 VSLINEVLDQAKVESGKLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPET 545
+++IN++LD +K+E+GKL LE + F+LR LD+V++L + + +KG+EL + I VP+
Sbjct: 342 LAIINDILDFSKLEAGKLVLENIPFSLRETLDEVVTLLAHSAHEKGLELTLNIDPDVPDN 401
Query: 546 LIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPV 605
+IGDP R +QIITNL+GN+IKFTE G+I + V L
Sbjct: 402 VIGDPLRLQQIITNLVGNAIKFTESGNIDILVEL-------------------------- 435
Query: 606 ADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGP 665
++ S + L V + DTG GI QS++F F Q
Sbjct: 436 ----------------------RALSNTKVQLEVQIRDTGIGISERQQSQLFQAFRQADA 473
Query: 666 SISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQM 725
SISR HGGTG+GL I++ LV M G+I F S PN GSTF F N + +
Sbjct: 474 SISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHLPLD-----LNPN--PII 526
Query: 726 NNQPNSVSSEFQGMKALVVDPRPIRAKVSRYHIQRLGIQ--VEVVSDQLQCLSQIASGSK 783
+ P G + L V+P A+ + + +EV LSQ+
Sbjct: 527 DGLPTDC---LAGKRLLYVEPNSAAAQA----TLDILSETPLEVTYSPT--LSQLPEAHY 577
Query: 784 IINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLFLLANSISSSRANTSTDGVSIPS 843
I ++ + T+ L K L L A +
Sbjct: 578 DILLLGLPV----TFREPLTMLHERLAKA-KSMTDFLILALPCHEQVLA-EQLKQDGADA 631
Query: 844 VIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKVAA 903
+ KPL + L +L + + LP L L ++ VDDN NLK+
Sbjct: 632 CLSKPLSHTRLLPALLE-----PCHHKQPPLLPPTDESRLPL--TVMAVDDNPANLKLIG 684
Query: 904 AGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDG 946
A L+ VV + G +A E FD MDIQMP MDG
Sbjct: 685 ALLEEQVEHVVLCDSGHQAVEQAK-QRPFDLILMDIQMPGMDG 726
|
Length = 919 |
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217796 pfam03924, CHASE, CHASE domain | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215015 smart01079, CHASE, This domain is found in the extracellular portion of receptor-like proteins - such as serine/threonine kinases and adenylyl cyclases | Back alignment and domain information |
|---|
| >gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|226655 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236839 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 993 | |||
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 100.0 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 100.0 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 100.0 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 100.0 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 100.0 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 100.0 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 100.0 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 100.0 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 100.0 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 100.0 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 100.0 | |
| PRK09303 | 380 | adaptive-response sensory kinase; Validated | 100.0 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 100.0 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 100.0 | |
| PRK13557 | 540 | histidine kinase; Provisional | 100.0 | |
| PRK10604 | 433 | sensor protein RstB; Provisional | 100.0 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 99.97 | |
| PRK10815 | 485 | sensor protein PhoQ; Provisional | 99.97 | |
| PRK10549 | 466 | signal transduction histidine-protein kinase BaeS; | 99.97 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 99.97 | |
| PRK10364 | 457 | sensor protein ZraS; Provisional | 99.97 | |
| PRK10755 | 356 | sensor protein BasS/PmrB; Provisional | 99.97 | |
| PRK09835 | 482 | sensor kinase CusS; Provisional | 99.97 | |
| TIGR01386 | 457 | cztS_silS_copS heavy metal sensor kinase. Members | 99.97 | |
| TIGR03785 | 703 | marine_sort_HK proteobacterial dedicated sortase s | 99.97 | |
| COG4191 | 603 | Signal transduction histidine kinase regulating C4 | 99.97 | |
| PRK09470 | 461 | cpxA two-component sensor protein; Provisional | 99.96 | |
| COG3852 | 363 | NtrB Signal transduction histidine kinase, nitroge | 99.96 | |
| COG4251 | 750 | Bacteriophytochrome (light-regulated signal transd | 99.96 | |
| PRK09467 | 435 | envZ osmolarity sensor protein; Provisional | 99.96 | |
| PRK10337 | 449 | sensor protein QseC; Provisional | 99.96 | |
| TIGR02966 | 333 | phoR_proteo phosphate regulon sensor kinase PhoR. | 99.96 | |
| PRK11100 | 475 | sensory histidine kinase CreC; Provisional | 99.95 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 99.95 | |
| COG0642 | 336 | BaeS Signal transduction histidine kinase [Signal | 99.94 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 99.94 | |
| PF03924 | 193 | CHASE: CHASE domain; InterPro: IPR006189 The CHASE | 99.93 | |
| TIGR02916 | 679 | PEP_his_kin putative PEP-CTERM system histidine ki | 99.92 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 99.92 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 99.89 | |
| PRK11644 | 495 | sensory histidine kinase UhpB; Provisional | 99.88 | |
| COG5000 | 712 | NtrY Signal transduction histidine kinase involved | 99.88 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 99.87 | |
| COG3614 | 348 | Predicted periplasmic ligand-binding sensor domain | 99.87 | |
| COG4192 | 673 | Signal transduction histidine kinase regulating ph | 99.85 | |
| PF02518 | 111 | HATPase_c: Histidine kinase-, DNA gyrase B-, and H | 99.8 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 99.79 | |
| PRK10935 | 565 | nitrate/nitrite sensor protein NarQ; Provisional | 99.74 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 99.73 | |
| PRK10600 | 569 | nitrate/nitrite sensor protein NarX; Provisional | 99.69 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.62 | |
| PRK10547 | 670 | chemotaxis protein CheA; Provisional | 99.6 | |
| PRK04184 | 535 | DNA topoisomerase VI subunit B; Validated | 99.51 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.42 | |
| smart00387 | 111 | HATPase_c Histidine kinase-like ATPases. Histidine | 99.4 | |
| PRK14868 | 795 | DNA topoisomerase VI subunit B; Provisional | 99.23 | |
| TIGR01052 | 488 | top6b DNA topoisomerase VI, B subunit. This model | 99.22 | |
| PF00512 | 68 | HisKA: His Kinase A (phospho-acceptor) domain; Int | 99.21 | |
| PRK14867 | 659 | DNA topoisomerase VI subunit B; Provisional | 99.18 | |
| cd00075 | 103 | HATPase_c Histidine kinase-like ATPases; This fami | 99.18 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.17 | |
| TIGR01925 | 137 | spIIAB anti-sigma F factor. This model describes t | 99.13 | |
| COG3452 | 297 | Predicted periplasmic ligand-binding sensor domain | 99.1 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.09 | |
| COG0643 | 716 | CheA Chemotaxis protein histidine kinase and relat | 99.07 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.05 | |
| PRK03660 | 146 | anti-sigma F factor; Provisional | 99.04 | |
| COG3851 | 497 | UhpB Signal transduction histidine kinase, glucose | 98.99 | |
| COG4585 | 365 | Signal transduction histidine kinase [Signal trans | 98.98 | |
| COG3920 | 221 | Signal transduction histidine kinase [Signal trans | 98.92 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 98.89 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 98.83 | |
| COG2972 | 456 | Predicted signal transduction protein with a C-ter | 98.82 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 98.81 | |
| COG3850 | 574 | NarQ Signal transduction histidine kinase, nitrate | 98.78 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 98.78 | |
| PRK04069 | 161 | serine-protein kinase RsbW; Provisional | 98.73 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 98.64 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 98.63 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 98.61 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 98.61 | |
| COG3275 | 557 | LytS Putative regulator of cell autolysis [Signal | 98.56 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 98.52 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 98.52 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 98.48 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 98.46 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 98.46 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 98.46 | |
| COG4564 | 459 | Signal transduction histidine kinase [Signal trans | 98.45 | |
| KOG0787 | 414 | consensus Dehydrogenase kinase [Signal transductio | 98.45 | |
| TIGR01924 | 159 | rsbW_low_gc serine-protein kinase RsbW. This model | 98.45 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 98.44 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 98.44 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 98.41 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 98.4 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 98.39 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 98.37 | |
| smart00388 | 66 | HisKA His Kinase A (phosphoacceptor) domain. Dimer | 98.36 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 98.35 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 98.35 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 98.34 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 98.34 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 98.34 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 98.32 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 98.32 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 98.31 | |
| PF14501 | 100 | HATPase_c_5: GHKL domain | 98.27 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 98.26 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 98.25 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 98.24 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 98.21 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 98.2 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 98.2 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 98.19 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 98.18 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 98.16 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 98.16 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 98.14 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 98.14 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 98.13 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 98.11 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 98.1 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 98.09 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 98.06 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 98.05 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.05 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 98.05 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 98.03 | |
| PRK09483 | 217 | response regulator; Provisional | 98.02 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 98.01 | |
| PRK13435 | 145 | response regulator; Provisional | 97.98 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 97.98 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 97.96 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 97.95 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 97.94 | |
| TIGR00585 | 312 | mutl DNA mismatch repair protein MutL. All protein | 97.94 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 97.9 | |
| cd00082 | 65 | HisKA Histidine Kinase A (dimerization/phosphoacce | 97.9 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 97.89 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 97.88 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 97.85 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 97.81 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 97.68 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 97.67 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 97.62 | |
| PRK13557 | 540 | histidine kinase; Provisional | 97.58 | |
| PF13581 | 125 | HATPase_c_2: Histidine kinase-like ATPase domain | 97.57 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 97.57 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 97.56 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 97.55 | |
| COG1389 | 538 | DNA topoisomerase VI, subunit B [DNA replication, | 97.54 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 97.48 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 97.48 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 97.42 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 97.41 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 97.41 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 97.4 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 97.31 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 97.27 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 97.26 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 97.23 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 97.1 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 96.98 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 96.97 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 96.94 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 96.87 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 96.86 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 96.86 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 96.85 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 96.85 | |
| COG2172 | 146 | RsbW Anti-sigma regulatory factor (Ser/Thr protein | 96.84 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 96.84 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 96.79 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 96.77 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 96.73 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 96.7 | |
| PRK00095 | 617 | mutL DNA mismatch repair protein; Reviewed | 96.66 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 96.65 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 96.64 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 96.61 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 96.6 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 96.58 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 96.55 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 96.54 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 96.52 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 96.52 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 96.46 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 96.44 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 96.39 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 96.37 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 96.36 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 96.33 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 96.31 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 96.31 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 96.21 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 96.21 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 96.19 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 96.16 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 96.15 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 96.12 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 96.0 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 96.0 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 95.99 | |
| PRK13435 | 145 | response regulator; Provisional | 95.82 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 95.8 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 95.67 | |
| PRK09483 | 217 | response regulator; Provisional | 95.67 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 95.64 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 95.61 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 95.54 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 95.4 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 95.39 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 95.36 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 95.31 | |
| PF13589 | 137 | HATPase_c_3: Histidine kinase-, DNA gyrase B-, and | 95.3 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 94.95 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 94.89 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 94.62 | |
| PRK05559 | 631 | DNA topoisomerase IV subunit B; Reviewed | 94.03 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 93.66 | |
| PRK14083 | 601 | HSP90 family protein; Provisional | 93.28 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 92.96 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 92.89 | |
| TIGR01055 | 625 | parE_Gneg DNA topoisomerase IV, B subunit, proteob | 92.74 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 92.55 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 92.48 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 92.37 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 92.37 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 92.35 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 92.3 | |
| PRK05644 | 638 | gyrB DNA gyrase subunit B; Validated | 92.11 | |
| TIGR01059 | 654 | gyrB DNA gyrase, B subunit. This model describes t | 92.01 | |
| PRK05218 | 613 | heat shock protein 90; Provisional | 90.78 | |
| PTZ00272 | 701 | heat shock protein 83 kDa (Hsp83); Provisional | 90.37 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 89.62 | |
| PTZ00130 | 814 | heat shock protein 90; Provisional | 89.03 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 87.03 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 86.91 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 86.54 | |
| smart00433 | 594 | TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras | 86.03 | |
| COG5381 | 184 | Uncharacterized protein conserved in bacteria [Fun | 85.47 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 84.64 | |
| COG0323 | 638 | MutL DNA mismatch repair enzyme (predicted ATPase) | 83.93 |
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.7e-54 Score=548.36 Aligned_cols=468 Identities=34% Similarity=0.480 Sum_probs=378.7
Q ss_pred HHHHHHHHHHHHHHHHHHhhccccHhhHhHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Q 001941 422 GMMELKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLMDTELDVTQQDYVRTAQASGKALVSLINEVLDQAKVESG 501 (993)
Q Consensus 422 ~~~el~~~ae~a~~aKs~Fla~vSHELRTPL~~I~g~lelL~~~~l~~~q~~~l~~i~~s~~~L~~lIndlLd~skiesg 501 (993)
++...+++++++++.|++|++++||||||||++|+|+++++.....++.+++|++.+..++++|..+|++++++++++++
T Consensus 278 ~l~~~~~~~~~~~~~~~~~l~~isHelrtPL~~i~~~~~~l~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~ 357 (919)
T PRK11107 278 ELDLAKKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRQTLKTPLTPTQRDYLQTIERSANNLLAIINDILDFSKLEAG 357 (919)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhhHhhcccHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 44455677788888999999999999999999999999999888888889999999999999999999999999999999
Q ss_pred CcceeeEeecHHHHHHHHHHHHhhhhhccCcEEEEEecCCCCceEEeCHHHHHHHHHHHHHHHHhcccCCeEEEEEEEee
Q 001941 502 KLELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHIFVTVYLVE 581 (993)
Q Consensus 502 ~l~l~~~~~dL~~ll~~vl~~~~~~a~~k~I~l~~~i~~~~p~~v~gD~~rL~QIL~NLL~NAiKfT~~G~I~v~v~~~e 581 (993)
+..++..++++.+++++++..+...+..+++.+.+++++..|..+.+|+.+|+||+.||++||+|||+.|.|.|.+....
T Consensus 358 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~d~~~l~~vl~NLl~NAik~~~~g~v~i~v~~~~ 437 (919)
T PRK11107 358 KLVLENIPFSLRETLDEVVTLLAHSAHEKGLELTLNIDPDVPDNVIGDPLRLQQIITNLVGNAIKFTESGNIDILVELRA 437 (919)
T ss_pred CcEEEEeecCHHHHHHHHHHHHHHHHHHcCCEEEEEeCCCCCceEEeCHHHHHHHHHHHHHHHhhcCCCCcEEEEEEEEe
Confidence 99999999999999999999999999999999999998888878899999999999999999999999998887765322
Q ss_pred cccccchhhhhcccccCcCCCCCccccccccCCcccccCCCCCCCCCCCCCCceeEEEEEEEcCCCCChhhHhhccCCcc
Q 001941 582 EVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFM 661 (993)
Q Consensus 582 ~~~~~i~i~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFepF~ 661 (993)
. ..+...+.|+|.|+|+|||++.++++|+||+
T Consensus 438 ~------------------------------------------------~~~~~~~~i~V~D~G~Gi~~~~~~~if~~f~ 469 (919)
T PRK11107 438 L------------------------------------------------SNTKVQLEVQIRDTGIGISERQQSQLFQAFR 469 (919)
T ss_pred c------------------------------------------------CCCeeEEEEEEEEeCCCcCHHHHHHHhhhhc
Confidence 1 1122357899999999999999999999999
Q ss_pred ccCCCCcCcCCCccchHHHHHHHHHHcCCEEEEEEeCCCeEEEEEEEEeCCCCCCCCccccccccCCCCCCCcccCCceE
Q 001941 662 QVGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGNGSSTSNEHNSQQMNNQPNSVSSEFQGMKA 741 (993)
Q Consensus 662 q~~~s~s~~~~GtGLGLsI~k~LVe~mgG~I~v~S~~g~GStF~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~rv 741 (993)
+.+.+.+++.+|+||||+|||++++.|||+|+++|.+|+||+|+|++|+........ .......+.|.++
T Consensus 470 ~~~~~~~~~~~g~GLGL~i~~~i~~~~gG~i~v~s~~~~Gt~f~i~lp~~~~~~~~~----------~~~~~~~~~g~~i 539 (919)
T PRK11107 470 QADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHLPLDLNPNPII----------DGLPTDCLAGKRL 539 (919)
T ss_pred cCCCCCCCCCCCcchhHHHHHHHHHHhCCEEEEEecCCCCEEEEEEEEeccCCcccc----------ccCCccccCCCeE
Confidence 999888888899999999999999999999999999999999999999965332110 1112345779999
Q ss_pred EEeCCchhhHHHHHHHHHHcCCEEEEecCHHHHHHHHhcCCCcccEEEEeccccccCccchHHHHHHHHhcCCCCCceEE
Q 001941 742 LVVDPRPIRAKVSRYHIQRLGIQVEVVSDQLQCLSQIASGSKIINMILVEQEVWEKDTSVSTLFVNNLRKLGCGFQSKLF 821 (993)
Q Consensus 742 Lvvdd~~~~~~v~~~~L~~lG~~v~~~~~~~~al~~l~~~~~~~~~ilid~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 821 (993)
+++||++..+..+..+|+.+|+.+..+.+..+ + ....+|++++|..++...... .....++..... .+.++
T Consensus 540 li~d~~~~~~~~l~~~L~~~g~~v~~~~~~~~-l-----~~~~~d~il~~~~~~~~~~~~--~~~~~~~~~~~~-~~~~i 610 (919)
T PRK11107 540 LYVEPNSAAAQATLDILSETPLEVTYSPTLSQ-L-----PEAHYDILLLGLPVTFREPLT--MLHERLAKAKSM-TDFLI 610 (919)
T ss_pred EEEeCCHHHHHHHHHHHHHCCCEEEEcCCHHH-h-----ccCCCCEEEecccCCCCCCHH--HHHHHHHhhhhc-CCcEE
Confidence 99999999999999999999999999998877 2 235689999998776433222 222222222211 22333
Q ss_pred EEeccCCcccccccCCCCCCCcccccCCcchHHHHHHHHHhcCCCCCCcccCCCCcchhhhccCCCeEEEEeCChHHHHH
Q 001941 822 LLANSISSSRANTSTDGVSIPSVIMKPLRSSMLAASLQRAMGVGNKGNIRNWELPSMSLRHLLLGRKILIVDDNNVNLKV 901 (993)
Q Consensus 822 lla~~~~~~~~~~~~~~~~~~~~l~KPl~~~~l~~~l~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~ILIVdDn~~n~~v 901 (993)
++..+......... ...|...++.||+....+...+............. .......+.+|||||||+.++..
T Consensus 611 ~~~~~~~~~~~~~~-~~~g~~~~l~kp~~~~~l~~~l~~~~~~~~~~~~~-------~~~~~~~~~~vLivdd~~~~~~~ 682 (919)
T PRK11107 611 LALPCHEQVLAEQL-KQDGADACLSKPLSHTRLLPALLEPCHHKQPPLLP-------PTDESRLPLTVMAVDDNPANLKL 682 (919)
T ss_pred EEeCCcchhhHHHH-hhCCCceEECCCCCHHHHHHHHHHhhccccccccc-------ccccccCCCeEEEEeCCHHHHHH
Confidence 33332222222222 23367789999999999988887654211110000 00111234689999999999999
Q ss_pred HHHHHHhCCCEEEEEcCHHHHHHHhCCCCCCcEEEEcCCCCCCCHHHHHHHHhcc---CCceEEEEc
Q 001941 902 AAAGLKRYGAAVVCVERGKKATELLMPPHQFDACFMDIQMPEMDGYEMLPCFESF---LLIAILVWK 965 (993)
Q Consensus 902 l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~~DlIlmDi~MP~mdG~e~~~~Ir~~---~~~~~~~~~ 965 (993)
+..+|+..|+.+..+.+|.+|++.+. .+.||+||||+.||+|||+++++.||+. ..+|||+.+
T Consensus 683 l~~~L~~~~~~v~~~~~~~~al~~~~-~~~~dlil~D~~mp~~~g~~~~~~lr~~~~~~~~pii~lt 748 (919)
T PRK11107 683 IGALLEEQVEHVVLCDSGHQAVEQAK-QRPFDLILMDIQMPGMDGIRACELIRQLPHNQNTPIIAVT 748 (919)
T ss_pred HHHHHHHcCCEEEEECCHHHHHHHHH-hCCCCEEEEeCCCCCCcHHHHHHHHHhcccCCCCCEEEEe
Confidence 99999999999999999999999995 5789999999999999999999999974 468888774
|
|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09303 adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10604 sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >PRK10815 sensor protein PhoQ; Provisional | Back alignment and domain information |
|---|
| >PRK10549 signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >PRK10364 sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >PRK10755 sensor protein BasS/PmrB; Provisional | Back alignment and domain information |
|---|
| >PRK09835 sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >TIGR01386 cztS_silS_copS heavy metal sensor kinase | Back alignment and domain information |
|---|
| >TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase | Back alignment and domain information |
|---|
| >COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09470 cpxA two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09467 envZ osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK10337 sensor protein QseC; Provisional | Back alignment and domain information |
|---|
| >TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >PRK11100 sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >PF03924 CHASE: CHASE domain; InterPro: IPR006189 The CHASE domain is an extracellular domain of 200-230 amino acids, which is found in transmembrane receptors from bacteria, lower eukaryotes and plants | Back alignment and domain information |
|---|
| >TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >PRK11644 sensory histidine kinase UhpB; Provisional | Back alignment and domain information |
|---|
| >COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >COG3614 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10935 nitrate/nitrite sensor protein NarQ; Provisional | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10600 nitrate/nitrite sensor protein NarX; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10547 chemotaxis protein CheA; Provisional | Back alignment and domain information |
|---|
| >PRK04184 DNA topoisomerase VI subunit B; Validated | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >smart00387 HATPase_c Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >PRK14868 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01052 top6b DNA topoisomerase VI, B subunit | Back alignment and domain information |
|---|
| >PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK14867 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >TIGR01925 spIIAB anti-sigma F factor | Back alignment and domain information |
|---|
| >COG3452 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK03660 anti-sigma F factor; Provisional | Back alignment and domain information |
|---|
| >COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04069 serine-protein kinase RsbW; Provisional | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01924 rsbW_low_gc serine-protein kinase RsbW | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >smart00388 HisKA His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PF14501 HATPase_c_5: GHKL domain | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00585 mutl DNA mismatch repair protein MutL | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13581 HATPase_c_2: Histidine kinase-like ATPase domain | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >PRK00095 mutL DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK05559 DNA topoisomerase IV subunit B; Reviewed | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >PRK14083 HSP90 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05644 gyrB DNA gyrase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01059 gyrB DNA gyrase, B subunit | Back alignment and domain information |
|---|
| >PRK05218 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00130 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >smart00433 TOP2c TopoisomeraseII | Back alignment and domain information |
|---|
| >COG5381 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 993 | ||||
| 3t4j_A | 270 | Arabidopsis Histidine Kinase 4 Sensor Domain In Com | 1e-98 | ||
| 4ew8_A | 268 | Crystal Structure Of A C-Terminal Part Of Tyrosine | 6e-13 | ||
| 2c2a_A | 258 | Structure Of The Entire Cytoplasmic Portion Of A Se | 1e-11 | ||
| 3dge_A | 258 | Structure Of A Histidine Kinase-response Regulator | 1e-11 | ||
| 3mm4_A | 206 | Crystal Structure Of The Receiver Domain Of The His | 3e-08 | ||
| 3sl2_A | 177 | Atp Forms A Stable Complex With The Essential Histi | 4e-08 | ||
| 3a0r_A | 349 | Crystal Structure Of Histidine Kinase Thka (Tm1359) | 9e-08 | ||
| 1r62_A | 160 | Crystal Structure Of The C-terminal Domain Of The T | 1e-05 | ||
| 3dge_C | 122 | Structure Of A Histidine Kinase-response Regulator | 1e-04 | ||
| 3d36_A | 244 | How To Switch Off A Histidine Kinase: Crystal Struc | 3e-04 | ||
| 3c97_A | 140 | Crystal Structure Of The Response Regulator Receive | 4e-04 |
| >pdb|3T4J|A Chain A, Arabidopsis Histidine Kinase 4 Sensor Domain In Complex With N- Isopentenyl Adenine Length = 270 | Back alignment and structure |
|
| >pdb|4EW8|A Chain A, Crystal Structure Of A C-Terminal Part Of Tyrosine Kinase (Divl) From Caulobacter Crescentus Cb15 At 2.50 A Resolution Length = 268 | Back alignment and structure |
| >pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 | Back alignment and structure |
| >pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 | Back alignment and structure |
| >pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 | Back alignment and structure |
| >pdb|3SL2|A Chain A, Atp Forms A Stable Complex With The Essential Histidine Kinase Walk (yycg) Domain Length = 177 | Back alignment and structure |
| >pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 | Back alignment and structure |
| >pdb|1R62|A Chain A, Crystal Structure Of The C-terminal Domain Of The Two-component System Transmitter Protein Nrii (ntrb) Length = 160 | Back alignment and structure |
| >pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|3D36|A Chain A, How To Switch Off A Histidine Kinase: Crystal Structure Of Geobacillus Stearothermophilus Kinb With The Inhibitor Sda Length = 244 | Back alignment and structure |
| >pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 993 | |||
| 3t4l_A | 270 | Histidine kinase 4; PAS domain, hormone receptor, | 5e-88 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 8e-80 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 4e-76 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 1e-35 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 7e-34 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 5e-32 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 4e-30 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 7e-30 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 1e-26 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 4e-25 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 2e-24 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 2e-24 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 2e-21 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 5e-21 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 4e-20 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 4e-20 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 1e-19 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 4e-19 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 4e-19 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 7e-19 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 2e-18 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 9e-18 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 5e-18 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 1e-12 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 5e-18 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 1e-17 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 5e-17 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 1e-16 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 2e-16 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 2e-14 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 4e-14 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 6e-14 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 8e-13 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 8e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 5e-11 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 6e-11 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 1e-10 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 1e-05 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 3e-10 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 3e-10 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 3e-10 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 3e-10 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 4e-10 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 5e-10 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 6e-10 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 8e-10 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 9e-10 | |
| 1th8_A | 145 | Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s | 2e-09 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 2e-09 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 2e-09 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 3e-09 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 3e-09 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 6e-09 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 6e-09 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 6e-09 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 7e-09 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 7e-09 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 8e-09 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 9e-09 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 1e-08 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 1e-08 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 2e-08 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 4e-08 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 5e-08 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 5e-08 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 5e-08 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 6e-08 | |
| 4fmt_A | 228 | CHPT protein; A phosphotransfer protein, A two-com | 7e-08 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 7e-08 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 7e-08 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 1e-07 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 1e-07 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 4e-07 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 5e-07 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 5e-07 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 6e-07 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 7e-07 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 7e-07 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 1e-06 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 1e-06 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 1e-06 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 1e-06 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 2e-06 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 2e-06 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 4e-06 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 4e-06 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 4e-06 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 5e-06 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 6e-06 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 6e-06 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 7e-06 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 8e-06 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 8e-06 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 9e-06 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 2e-05 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 2e-05 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 3e-05 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 4e-05 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 5e-05 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 7e-05 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 1e-04 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 1e-04 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 1e-04 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 2e-04 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 2e-04 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 2e-04 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 8e-04 |
| >3t4l_A Histidine kinase 4; PAS domain, hormone receptor, endop reticulum; HET: ZEA; 1.53A {Arabidopsis thaliana} PDB: 3t4k_A* 3t4j_A* 3t4o_A* 3t4q_A* 3t4s_A* 3t4t_A* Length = 270 | Back alignment and structure |
|---|
Score = 282 bits (721), Expect = 5e-88
Identities = 175/278 (62%), Positives = 209/278 (75%), Gaps = 10/278 (3%)
Query: 107 MSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFT 166
M +R E L SMCD+RARMLQDQF+VS+NHV A++IL+STFH+ KNPSAIDQ TF
Sbjct: 1 MDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFA 60
Query: 167 RYTERTAFERPLTSGVAYAVRVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEE 226
YT RTAFERPL SGVAYA +V+ ERE FE+Q W IK MD + EPSP+ +E
Sbjct: 61 EYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWVIKTMD--------RGEPSPVRDE 112
Query: 227 YAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVLTAPFRLLKTNRLGVILTFAV 286
YAPVIF+QD+VS++ SLDM+SG+EDREN+LRAR +GK VLT+PFRLL+T+ LGV+LTF V
Sbjct: 113 YAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPFRLLETHHLGVVLTFPV 172
Query: 287 YKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPIS 346
YK LP N T ERI AT GYLGG FD+ESLVE LL QLA Q I V+VYDITN S P+
Sbjct: 173 YKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLV 232
Query: 347 MYGSN--VSDDGLWLVSTLNFGDPFRKHEMRCRFKQKA 382
MYG+ +D L S L+FGDPFRKH+M CR+ QKA
Sbjct: 233 MYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKA 270
|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 | Back alignment and structure |
|---|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Length = 145 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 993 | |||
| 3t4l_A | 270 | Histidine kinase 4; PAS domain, hormone receptor, | 100.0 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 100.0 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 100.0 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 100.0 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 100.0 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 100.0 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 100.0 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 100.0 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 99.97 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 99.97 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 99.97 | |
| 4fpp_A | 247 | Phosphotransferase; four helix bundle, bergerat fo | 99.97 | |
| 1b3q_A | 379 | Protein (chemotaxis protein CHEA); histine kinase, | 99.94 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 99.9 | |
| 3ehh_A | 218 | Sensor kinase (YOCF protein); four-helix bundle, G | 99.9 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 99.9 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 99.89 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 99.89 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 99.89 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 99.88 | |
| 1i58_A | 189 | Chemotaxis protein CHEA; beta-alpha sandwich, sign | 99.86 | |
| 3ehg_A | 128 | Sensor kinase (YOCF protein); GHL ATPase domain, t | 99.77 | |
| 3zxo_A | 129 | Redox sensor histidine kinase response regulator; | 99.77 | |
| 3zxq_A | 124 | Hypoxia sensor histidine kinase response regulato; | 99.72 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.69 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.65 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 99.64 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 99.63 | |
| 1th8_A | 145 | Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s | 99.63 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.53 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.48 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.46 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.43 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 99.36 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.28 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.26 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.24 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.16 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.13 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.11 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.11 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.09 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.09 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.09 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.08 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.05 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.04 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.03 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.03 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.02 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.01 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.01 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.01 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.01 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.01 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 98.99 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 98.99 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 98.99 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 98.98 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 98.98 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 98.98 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 98.98 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 98.97 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 98.97 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 98.97 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 98.96 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 98.96 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 98.96 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 98.96 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 98.96 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 98.95 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 98.95 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 98.94 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 98.94 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 98.94 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 98.94 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 98.93 | |
| 3r0j_A | 250 | Possible two component system response transcript | 98.93 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 98.93 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 98.93 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 98.93 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 98.93 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 98.92 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 98.92 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 98.91 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 98.91 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 98.91 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 98.91 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 98.9 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 98.9 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 98.9 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 98.9 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 98.9 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 98.89 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 98.89 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 98.89 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 98.88 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 98.88 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 98.88 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 98.87 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 98.87 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 98.86 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 98.86 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 98.86 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 98.86 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 98.85 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 98.85 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 98.84 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 98.83 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 98.83 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 98.83 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 98.83 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 98.82 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 98.82 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 98.82 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 98.82 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 98.81 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 98.8 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 98.8 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 98.79 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 98.78 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 98.76 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 98.76 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 98.76 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 98.75 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 98.74 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 98.73 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 98.71 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 98.7 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 98.7 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 98.66 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 98.66 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 98.64 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 98.64 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 98.63 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 98.61 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 98.61 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 98.61 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 98.6 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 98.5 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 98.49 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 98.46 | |
| 3r0j_A | 250 | Possible two component system response transcript | 98.43 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 98.42 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 98.38 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 98.36 | |
| 1kij_A | 390 | DNA gyrase subunit B; topoisomerase, gyrase B-coum | 98.31 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 98.31 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 98.3 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 98.29 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 98.29 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 98.28 | |
| 1b63_A | 333 | MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A | 98.27 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 98.25 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 98.24 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 98.24 | |
| 1h7s_A | 365 | PMS1 protein homolog 2; DNA repair, GHL ATPase, mi | 98.23 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 98.22 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 98.22 | |
| 3na3_A | 348 | DNA mismatch repair protein MLH1; MUTL protein hom | 98.22 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 98.22 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 98.21 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 98.21 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 98.2 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 98.2 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 98.2 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 98.15 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 98.14 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 98.13 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 98.12 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 98.1 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 98.1 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 98.1 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 98.1 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 98.1 | |
| 3zcc_A | 114 | HAMP, osmolarity sensor protein ENVZ; signaling pr | 98.09 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 98.08 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 98.07 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 98.07 | |
| 3ke6_A | 399 | Protein RV1364C/MT1410; anti-sigma factor, anti-si | 98.06 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 98.06 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 98.05 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 98.05 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 98.04 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 98.04 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 98.04 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 98.03 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 98.03 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 98.02 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 98.01 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 98.01 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 98.01 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 98.0 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 97.99 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 97.97 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 97.97 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 97.96 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 97.96 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 97.96 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 97.94 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 97.94 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 97.94 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 97.94 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 97.93 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 97.93 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 97.92 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 97.92 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 97.92 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 97.92 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 97.91 | |
| 3h4l_A | 367 | DNA mismatch repair protein PMS1; ATP binding, DNA | 97.89 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 97.88 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 97.87 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 97.86 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 97.85 | |
| 1ixm_A | 192 | SPO0B, protein (sporulation response regulatory pr | 97.85 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 97.85 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 97.84 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 97.83 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 97.81 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 97.81 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 97.8 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 97.79 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 97.77 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 97.76 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 97.74 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 97.71 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 97.7 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 97.69 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 97.69 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 97.65 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 97.64 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 97.64 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 97.63 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 97.61 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 97.6 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 97.54 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 97.54 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 97.53 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 97.52 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 97.52 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 97.49 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 97.47 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 97.44 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 97.39 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 97.39 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 97.38 | |
| 3zrx_A | 115 | AF1503 protein, osmolarity sensor protein ENVZ; si | 97.37 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 97.15 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 97.13 | |
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 96.99 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 96.97 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 96.9 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 96.87 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.76 | |
| 1s16_A | 390 | Topoisomerase IV subunit B; two-domain protein com | 96.71 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 96.19 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 96.1 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 95.93 | |
| 3lib_A | 290 | Hypothetical sensory transduction histidine kinas; | 95.52 | |
| 4dah_A | 217 | Sporulation kinase D; alpha-beta-alpha structure, | 95.38 | |
| 1ei1_A | 391 | DNA gyrase B, GYRB; ATPase domain, dimer, isomeras | 95.37 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 95.13 | |
| 3lif_A | 254 | Putative diguanylate cyclase (ggdef) with PAS/PAC; | 95.13 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 95.12 | |
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 94.95 | |
| 3li9_A | 291 | Hypothetical sensory transduction histidine kinas; | 94.62 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 94.62 | |
| 3lic_A | 274 | Sensor protein; PDC fold, ATP-binding, kinase, nuc | 94.5 | |
| 3fv5_A | 201 | DNA topoisomerase 4 subunit B; topoisomerase IV B | 94.22 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 94.0 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 93.69 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 93.67 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 93.28 | |
| 3cwv_A | 369 | DNA gyrase, B subunit, truncated; structural genom | 93.08 | |
| 4emv_A | 226 | DNA topoisomerase IV, B subunit; protein-inhibitor | 90.12 | |
| 4duh_A | 220 | DNA gyrase subunit B; structure-based drug design, | 90.07 | |
| 1zxm_A | 400 | TOPO IIA ATPase, DNA topoisomerase II, alpha isozy | 89.7 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 89.34 | |
| 1pvg_A | 418 | DNA topoisomerase II; GHKL ATPase domain; HET: DNA | 87.04 | |
| 3ttz_A | 198 | DNA gyrase subunit B; protein-inhibitor complex, A | 86.03 |
| >3t4l_A Histidine kinase 4; PAS domain, hormone receptor, endop reticulum; HET: ZEA; 1.53A {Arabidopsis thaliana} PDB: 3t4k_A* 3t4j_A* 3t4o_A* 3t4q_A* 3t4s_A* 3t4t_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-48 Score=421.08 Aligned_cols=268 Identities=65% Similarity=1.011 Sum_probs=248.4
Q ss_pred HhHHHHHHHHHHHhhhhHHHHHHHHHHHHHhHhHHHHHHHHHhcccCCCCCCCCCHHHHHHHHhhhhhcCCCcceeeeec
Q 001941 107 MSSQATEKRREALGSMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKNPSAIDQMTFTRYTERTAFERPLTSGVAYAV 186 (993)
Q Consensus 107 ~~~~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~id~~~f~~~t~~~~~~~p~i~~~~~~~ 186 (993)
|+.+..++|++.|.++||+++.+||++|+.++++++++++||+++||+++++.||+++|..|+++++.++|+|+|++|+|
T Consensus 1 ~~~~~~~~~~~~~~~~a~~~a~~L~~~l~~~~~~l~~la~l~~~~~f~~~~~~v~~~~F~~~a~~l~~~~pgi~~l~~ap 80 (270)
T 3t4l_A 1 MDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAE 80 (270)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSSCCCCHHHHHHHHHHTGGGCTTEEEEEEEE
T ss_pred CChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCHHHHHHHHHHHhhcCCCceEEEEEe
Confidence 46788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCchhHHHHHHHhcceeeecccCCCCCCCCCCCCCCCCccceeEeecCCccceeeeccccCcccHHHHHHHHhcCCccc
Q 001941 187 RVLRSEREEFEKQQGWTIKRMDTFEHNPVHKDEPSPIEEEYAPVIFAQDTVSHVISLDMLSGKEDRENVLRARASGKGVL 266 (993)
Q Consensus 187 ~v~~~er~~fE~~~~~~i~~~~~~~~~~~~~~~~~~~~~~Y~pvi~~~~~~~~~~g~D~~s~~~~r~~i~~Ar~tg~~~~ 266 (993)
+|+++||++||++++|.|+++.. ..|++.|++|+||+|+++.|+.++||||+|+|.||++|.+||+||++++
T Consensus 81 ~V~~~~r~~fe~~~~~~I~~~~~--------~~p~~~r~~y~pi~y~ep~N~~alG~D~~S~p~rr~al~~Ar~tg~~~l 152 (270)
T 3t4l_A 81 KVVNFEREMFERQHNWVIKTMDR--------GEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVL 152 (270)
T ss_dssp CEEGGGHHHHHHHHTSCCBCTTT--------CCBCCCCSEECBEEEECGGGGGGBTBBGGGSHHHHHHHHHHHHHSSCEE
T ss_pred ecCHhHHHHHHhccCceeeccCC--------cccCCCCCccceEEEeCCCCccceeeccCCCHHHHHHHHHHHHhCCcEE
Confidence 99999999999999999988752 4699999999999999999999999999999999999999999999999
Q ss_pred ccceeecccCCceeEEEEEeeccCCCCCCChHHHHHhhcceeeeeeehHHHHHHHHHhhcccceEEEEeecccCCCCcee
Q 001941 267 TAPFRLLKTNRLGVILTFAVYKRELPSNATPNERIEATDGYLGGIFDIESLVEKLLHQLASKQTIFVNVYDITNLSHPIS 346 (993)
Q Consensus 267 t~p~~l~~~~~~G~~l~~pvy~~~~~~~~~~~~r~~~~~G~v~~~~~v~~l~~~ll~~~~~~~~i~v~~yd~~~~~~~~~ 346 (993)
|+|++|+|.++.|+++++|||..+.+++.|+++|+++++||++++|++++|++.++.++...+.+.+.+||.++.+.+..
T Consensus 153 s~pv~Lvq~~~~G~ll~~PVy~~~~~~~~t~~~R~~~~~G~v~~v~~~~~l~~~~l~~~~~~~~l~l~i~D~~~~~~~~~ 232 (270)
T 3t4l_A 153 TSPFRLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLV 232 (270)
T ss_dssp CCCEECTTTCCEEEEEEEEEECTTCCSSCCHHHHHHTEEEEEEEEECHHHHHHHHHHTSTTGGGEEEEEEECSSTTSCEE
T ss_pred ecCeeeccCCCceEEEEEEeecCCCCCCCCHHHHHHHHhhEEEEEEEHHHHHHHHhhccccCCcEEEEEEECCCCCCCcc
Confidence 99999999889999999999999877778999999999999999999999999999877656789999999988777889
Q ss_pred cccCccCC--CcceEEEeccCCCccccccceehhcccC
Q 001941 347 MYGSNVSD--DGLWLVSTLNFGDPFRKHEMRCRFKQKA 382 (993)
Q Consensus 347 ~y~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~~~~ 382 (993)
+|++.... .++.+.+.++||+|+|+|+|+|+|++++
T Consensus 233 ly~s~~~~~~~~~~~~~~l~~g~~~~~~~~~~~~~~~~ 270 (270)
T 3t4l_A 233 MYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKA 270 (270)
T ss_dssp EECC--CCCCTTCCEEEEECCSCTTCCEEEEEEECC--
T ss_pred cccCCCCCCCCcceEEEEeecCCchhhhheeeecccCC
Confidence 99987754 3447899999999999999999999874
|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* | Back alignment and structure |
|---|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A | Back alignment and structure |
|---|
| >1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A | Back alignment and structure |
|---|
| >3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* | Back alignment and structure |
|---|
| >3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* | Back alignment and structure |
|---|
| >3lib_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; 2.99A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* | Back alignment and structure |
|---|
| >3lif_A Putative diguanylate cyclase (ggdef) with PAS/PAC; PDC fold, signaling protein; HET: CIT; 2.70A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* | Back alignment and structure |
|---|
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A | Back alignment and structure |
|---|
| >3li9_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; HET: BTB; 1.70A {Methanosarcina mazei} PDB: 3li8_A* 3lia_A* | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lic_A Sensor protein; PDC fold, ATP-binding, kinase, nucleotide-binding, phosphopr transferase, transmembrane; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* | Back alignment and structure |
|---|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A | Back alignment and structure |
|---|
| >3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* | Back alignment and structure |
|---|
| >4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* | Back alignment and structure |
|---|
| >1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* | Back alignment and structure |
|---|
| >3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 993 | ||||
| d2c2aa2 | 161 | d.122.1.3 (A:321-481) Sensor histidine kinase TM08 | 2e-35 | |
| d1ysra1 | 148 | d.122.1.3 (A:299-446) Sensor-type histidine kinase | 6e-29 | |
| d1jm6a2 | 190 | d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin | 2e-27 | |
| d1bxda_ | 161 | d.122.1.3 (A:) Histidine kinase domain of the osmo | 6e-27 | |
| d1id0a_ | 146 | d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche | 6e-27 | |
| d1gkza2 | 193 | d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci | 3e-19 | |
| d1r62a_ | 156 | d.122.1.3 (A:) Nitrogen regulation protein NtrB, C | 2e-15 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 6e-12 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 4e-05 | |
| d2c2aa1 | 89 | a.30.2.1 (A:232-320) Sensor histidine kinase TM085 | 9e-11 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 2e-10 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 3e-10 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 5e-10 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 5e-10 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 5e-10 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 1e-09 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 2e-09 | |
| d2hkja3 | 219 | d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A | 4e-09 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 5e-09 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 6e-09 | |
| d1joya_ | 67 | a.30.2.1 (A:) EnvZ histidine kinase {Escherichia c | 1e-08 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 7e-08 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 1e-07 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 1e-07 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 1e-07 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 6e-07 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 1e-06 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 1e-06 | |
| d1i58a_ | 189 | d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m | 2e-06 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-06 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 2e-06 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 2e-06 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 2e-06 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 3e-06 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 4e-06 | |
| d1y8oa2 | 125 | d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinas | 4e-06 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 5e-06 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 6e-06 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 6e-06 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 1e-05 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 3e-05 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 6e-05 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 8e-05 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 8e-05 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 8e-05 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 2e-04 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-04 | |
| d2gj4a1 | 824 | c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit | 4e-04 | |
| d1ixma_ | 179 | d.123.1.1 (A:) Sporulation response regulatory pro | 0.004 |
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Histidine kinase domain: Sensor histidine kinase TM0853 species: Thermotoga maritima [TaxId: 2336]
Score = 130 bits (327), Expect = 2e-35
Identities = 43/204 (21%), Positives = 75/204 (36%), Gaps = 49/204 (24%)
Query: 504 ELEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGN 563
++ +L +++ ++ + V + + P DP R RQ++ NL+ N
Sbjct: 1 QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNN 60
Query: 564 SIKFTEKGHIFVTVYLVEEVVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGS 623
+K+++K V ++ + D
Sbjct: 61 GVKYSKKDAPDKYVKVILDEKDG------------------------------------- 83
Query: 624 TSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKY 683
+++ VED G GIP A+ RIF F +V S++ GTG+GL+I+K
Sbjct: 84 ------------GVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKE 131
Query: 684 LVGRMKGEIGFVSIPNIGSTFTFT 707
+V G I S GS F
Sbjct: 132 IVELHGGRIWVESEVGKGSRFFVW 155
|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 | Back information, alignment and structure |
|---|
| >d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Length = 67 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 824 | Back information, alignment and structure |
|---|
| >d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Length = 179 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 993 | |||
| d2c2aa2 | 161 | Sensor histidine kinase TM0853 {Thermotoga maritim | 100.0 | |
| d1ysra1 | 148 | Sensor-type histidine kinase PrrB {Mycobacterium t | 99.96 | |
| d1id0a_ | 146 | Histidine kinase PhoQ domain {Escherichia coli [Ta | 99.96 | |
| d1bxda_ | 161 | Histidine kinase domain of the osmosensor EnvZ {Es | 99.96 | |
| d1r62a_ | 156 | Nitrogen regulation protein NtrB, C-terminal domai | 99.94 | |
| d1gkza2 | 193 | Branched-chain alpha-ketoacid dehydrogenase kinase | 99.94 | |
| d1jm6a2 | 190 | Pyruvate dehydrogenase kinase {Rat (Rattus norvegi | 99.94 | |
| d1ixma_ | 179 | Sporulation response regulatory protein Spo0B {Bac | 99.7 | |
| d2hkja3 | 219 | Topoisomerase VI-B subunit {Archaeon Sulfolobus sh | 99.6 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.53 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.52 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.51 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.5 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.5 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.5 | |
| d1i58a_ | 189 | Histidine kinase CheA {Thermotoga maritima [TaxId: | 99.5 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.48 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.47 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.47 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.47 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.46 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.45 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.45 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.45 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.44 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.44 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.44 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.43 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.43 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.42 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.42 | |
| d2c2aa1 | 89 | Sensor histidine kinase TM0853 {Thermotoga maritim | 99.41 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.41 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.41 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.41 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.38 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.38 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.38 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.36 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.36 | |
| d1th8a_ | 139 | Anti-sigma factor spoIIab {Bacillus stearothermoph | 99.35 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.35 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.27 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.26 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.24 | |
| d1y8oa2 | 125 | Pyruvate dehydrogenase kinase {Human (Homo sapiens | 99.22 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.22 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.01 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 98.96 | |
| d1joya_ | 67 | EnvZ histidine kinase {Escherichia coli [TaxId: 56 | 98.95 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 98.93 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 98.89 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 98.88 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 98.87 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 98.85 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 98.85 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 98.85 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 98.84 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 98.84 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 98.82 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 98.82 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 98.82 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 98.78 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 98.75 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 98.73 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 98.72 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 98.7 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 98.7 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 98.7 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 98.69 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 98.67 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 98.64 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 98.63 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 98.61 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 98.6 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 98.51 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 98.49 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 98.37 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 98.35 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 98.33 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 98.32 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 97.98 | |
| d1h7sa2 | 203 | DNA mismatch repair protein PMS2 {Human (Homo sapi | 96.54 | |
| d1b63a2 | 218 | DNA mismatch repair protein MutL {Escherichia coli | 95.3 | |
| d1pvga2 | 239 | DNA topoisomerase II {Baker's yeast (Saccharomyces | 92.03 | |
| d1ei1a2 | 219 | DNA gyrase B {Escherichia coli [TaxId: 562]} | 91.97 | |
| d1kija2 | 212 | DNA gyrase B {Thermus thermophilus [TaxId: 274]} | 85.92 | |
| d1uyla_ | 208 | HSP90 {Human (Homo sapiens) [TaxId: 9606]} | 81.96 |
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Histidine kinase domain: Sensor histidine kinase TM0853 species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=6.4e-33 Score=277.80 Aligned_cols=157 Identities=29% Similarity=0.406 Sum_probs=130.2
Q ss_pred eeeEeecHHHHHHHHHHHHhhhhhccCcEEEEEecCCCCceEEeCHHHHHHHHHHHHHHHHhcccCCeE--EEEEEEeec
Q 001941 505 LEAVSFNLRAILDDVLSLFSGKSQDKGVELAVYISDRVPETLIGDPGRFRQIITNLMGNSIKFTEKGHI--FVTVYLVEE 582 (993)
Q Consensus 505 l~~~~~dL~~ll~~vl~~~~~~a~~k~I~l~~~i~~~~p~~v~gD~~rL~QIL~NLL~NAiKfT~~G~I--~v~v~~~e~ 582 (993)
++.+++||.+++++++..++..+..+++++.+..+...|..+.+|+.+|+|||.||++||+|||++|.. .|.+....
T Consensus 2 l~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~- 80 (161)
T d2c2aa2 2 INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDE- 80 (161)
T ss_dssp CCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEE-
T ss_pred CccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCCEEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEEEEe-
Confidence 567789999999999999999999999999988876667678999999999999999999999987642 23332211
Q ss_pred ccccchhhhhcccccCcCCCCCccccccccCCcccccCCCCCCCCCCCCCCceeEEEEEEEcCCCCChhhHhhccCCccc
Q 001941 583 VVDSIEVETELSSSKNTLSGYPVADRCHSWKGFKTFNQDGSTSPFKSSSADLINLIVSVEDTGQGIPLEAQSRIFTPFMQ 662 (993)
Q Consensus 583 ~~~~i~i~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFepF~q 662 (993)
+...+.|+|+|+|+|||++++++||+||||
T Consensus 81 --------------------------------------------------~~~~~~i~V~D~G~GI~~~~~~~iF~~F~~ 110 (161)
T d2c2aa2 81 --------------------------------------------------KDGGVLIIVEDNGIGIPDHAKDRIFEQFYR 110 (161)
T ss_dssp --------------------------------------------------ETTEEEEEEEECSSCCCGGGTTGGGSTTCC
T ss_pred --------------------------------------------------cCCEEEEEEEEcCCCCCHHHHHHhhCCcEE
Confidence 112478999999999999999999999999
Q ss_pred cCCCCcCcCCCccchHHHHHHHHHHcCCEEEEEEeCCCeEEEEEEEEeCC
Q 001941 663 VGPSISRTHGGTGIGLSISKYLVGRMKGEIGFVSIPNIGSTFTFTAVFGN 712 (993)
Q Consensus 663 ~~~s~s~~~~GtGLGLsI~k~LVe~mgG~I~v~S~~g~GStF~~~lp~~~ 712 (993)
.+.+.++..+|+||||+|||+++++|||+|+++|.+|+||+|+|+||..+
T Consensus 111 ~~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~~~Gt~f~i~lP~~~ 160 (161)
T d2c2aa2 111 VDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKDR 160 (161)
T ss_dssp CC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEECCC
T ss_pred cCCCCCCCCCcccHHHHHHHHHHHHCCCEEEEEecCCCeeEEEEEEEccc
Confidence 99888888889999999999999999999999999999999999999753
|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|