Citrus Sinensis ID: 002131

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-

MKKLFFFRSSSNSGNNNSVSPPSTEKEIYWENPLRSGYGVKHQADDKSENNFRSPRGLFSKSKKQISDSQGCNSSSSLRRCRSLSSAAFLVDGLEQKNFSCSGDQSISPSSSSTSARHQQCNRSSRRSRALTPERQCREKRFEVTSISNAYGSERSCSSGSSSNVSTKILDRYIDGEQHQERSRPTNSSSQRNYIGNGNGNGGGRLPPRVQYTAPTSPVDSVKGKPKSHSFREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIPITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNSIETEEDEDVELRRRSKEAEGRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFKLEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVASKSQSLHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVLPKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDLLASPDNMQEFLLK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccHHHHHHcccccccHHHHHccccHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcc

ccEEEEEEEcccccccccccccccccEEEEccccccccccccccccccHcccccccccccccccccccccccccccHcccccccccHHHccccccccccccccccccccccccccccHHccccccccccccccHHccccccEEEEEEcccccccccccccccccccHHHHHHHcccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHHHHEEEccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHccHEHHcHHHHHHHHHHHHHHHHHHHHHHHcccHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHcc

mkklfffrsssnsgnnnsvsppstekeiywenplrsgygvkhqaddksennfrsprglfskskkqisdsqgcnsssslrrcrslsSAAFLVDgleqknfscsgdqsispsssstsarhqqcnrssrrsraltperqcrekRFEVTSIsnaygserscssgsssnvstkildryidgeqhqersrptnsssqrnyigngngngggrlpprvqytaptspvdsvkgkpkshsfreakgtrlrfssrdwvengfghesprSLAKNVVERLAQTyvlprssskdvdqdipitiediycgstnrysdsnsdviarksyslddpfetvkngcekddlsglqkqnyfygdhceglnsieteedEDVELRRRSKEAEGRVMVLSEELehetflhdtgfdvPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFKLEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGlrdgfsdqiekkpaldkYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLqnqgismlnESTQLCSQLLEFIKgkagqlsetKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVasksqslhedvnlsgklndqtAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMkgvlpkvseERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILkdtigskpfdllaspdnmqefllk

MKKLFFFRsssnsgnnnsvsppstEKEIYWENPLRSGYGVKHQADDKSENNFRSPRglfskskkqisdsqgcnsssslrrCRSLSSAAFLVDGLEQKNFSCSGdqsispsssstsarhqqcnrssrrsraltperqcrekrfevtsisnaygserscssgsssnvsTKILDRYIdgeqhqersrptnsssqrnyIGNGNGNGGGRLPPRVQYTAPtspvdsvkgkpkshsfreakgtrlrfssrdWVENGfghesprslAKNVVERLAQtyvlprssskdvdqdipiTIEDiycgstnrysdsnsdVIARKsyslddpfetvKNGCEKDDLSGLQKQNYFYGDHCEglnsieteededvelrrrskeaegrVMVLSEELEhetflhdtgfdvPAMIQTIRILTEEKMSLALEVSGLLQSRIVErasakeelrmvkadlesrtrrlerekvelqsglekeldrrssdwsfklekyQMEEQRLRERVRELAEqnvslqrevstfnereaesrsmithseqqlKDLTRRAEQYteengdlrqnLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKtiaglrdgfsdqIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISllnrlkgngkeSAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVASKSQSLHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKgvlpkvseerdMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITIlkdtigskpfdllaspdnmqefllk

MKKLFFFRsssnsgnnnsvsppsTEKEIYWENPLRSGYGVKHQADDKSENNFRSPRGLFSKSKKQISDSQGCNsssslrrcrslssAAFLVDGLEQKNFscsgdqsispsssstsARHQQCNRSSRRSRALTPERQCREKRFEVTSISNAYGserscssgsssnvsTKILDRYIDGEQHQERSRPTNSSSQRNYIgngngngggRLPPRVQYTAPTSPVDSVKGKPKSHSFREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIPITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNSIETEEDEDVELRRRSKEAEGRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFKLEKYQMeeqrlrervrelaeqNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVASKSQSLHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKeleveqlqaelaTAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVLPKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDLLASPDNMQEFLLK

****************************YW***************************************************************************************************************************************************************************************************************************************NVVERLAQTYVL*******VDQDIPITIEDIYCGSTNRY******VI**********F*TVKNGC***DLSGLQKQNYFYGDHCEGL************************MVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIV*****************************************************************************************************************************FRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSE**KTIAGLR************LDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSA*****************************************ETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKD*SINQLQIDL******LKIMKGVL********MMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDL*************

*KKLFFF***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************MQEFL**

MKKLFFFR*****************KEIYWENPLRSGYGVKHQADDKSENNFRSPRGLFS*********************RSLSSAAFLVDGLEQKNFS***********************************QCREKRFEVTSISNAY*************VSTKILDRYIDG**************QRNYIGNGNGNGGGRLPPRVQYTA*******************AKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIPITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNSIETE***************GRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFKLEKYQMEEQRLRERVRELAEQNVSLQ******************HSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSS************VNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVLPKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDLLASPDNMQEFLLK

*KKLFFFRSS***********************************************************************************************************************************FE**S*********************KILDRYIDGEQHQ*************************LPP********************HSFREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQT******SSKDVDQDIPITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNSIETEEDEDVELRRRSKEAEGRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFKLEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSS*********************QTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVLPKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDLLASPDNMQEFLLK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKLFFFRSSSNSGNNNSVSPPSTEKEIYWENPLRSGYGVKHQADDKSENNFRSPRGLFSKSKKQISDSQGCNSSSSLRRCRSLSSAAFLVDGLEQKNFSCSGDQSISPSSSSTSARHQQCNRSSRRSRALTPERQCREKRFEVTSISNAYGSERSCSSGSSSNVSTKILDRYIDGEQHQERSRPTNSSSQRNYIGNGNGNGGGRLPPRVQYTAPTSPVDSVKGKPKSHSFREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIPITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNSxxxxxxxxxxxxxxxxxxxxxVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLALEVSGLLQSRIVERASAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRSSDWSFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAESRSMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYCIKRNxxxxxxxxxxxxxxxxxxxxxCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVASKSQSLHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDILRCExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQDSAKELKIMKGVLPKVSEERDMMWEExxxxxxxxxxxxxxxxxxxxxxxxxxxxLLLKEGQITILKDTIGSKPFDLLASPDNMQEFLLK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		961
224109640		954	predicted protein [Populus trichocarpa]	0.981	0.988	0.657	0.0
224100891		955	predicted protein [Populus trichocarpa]	0.985	0.991	0.655	0.0
359486312		926	PREDICTED: uncharacterized protein LOC10	0.959	0.995	0.654	0.0
255568185		914	ATP binding protein, putative [Ricinus c	0.950	0.998	0.643	0.0
297736450		920	unnamed protein product [Vitis vinifera]	0.907	0.947	0.649	0.0
147845106		884	hypothetical protein VITISV_012437 [Viti	0.903	0.981	0.607	0.0
357445019		918	hypothetical protein MTR_1g116070 [Medic	0.936	0.980	0.554	0.0
356574999		907	PREDICTED: uncharacterized protein LOC10	0.909	0.963	0.577	0.0
356536522		935	PREDICTED: uncharacterized protein LOC10	0.865	0.889	0.598	0.0
449464232		966	PREDICTED: uncharacterized protein LOC10	0.885	0.880	0.531	0.0

>gi\|224109640\|ref\|XP_002315264.1\| predicted protein [Populus trichocarpa] gi\|222864304\|gb\|EEF01435.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/970 (65%), Positives = 768/970 (79%), Gaps = 27/970 (2%)

Query: 1   MKKLFFFRSSSNSGNNNSVSPP-STEKEIYWENPLRSGYGVKHQADDKSENNFRSPRGLF 59
           MKKLFFFRSSS++  NN+ S P S +K++YWE PL       +Q +D ++ NF SPRGLF
Sbjct: 1   MKKLFFFRSSSSNDGNNNTSSPLSADKQVYWEAPLEGK--PNNQDNDNAQCNFWSPRGLF 58

Query: 60  SKSKKQISDSQGCNSSSSLRRCRSLSSAAFLVDGLEQKNFSCSGDQSISPSSSSTSARHQ 119
           SKS KQ  DSQ  ++SS LRR RSLSSAAFL DG+ Q NFSC+ D++IS SSSS+ A HQ
Sbjct: 59  SKSGKQTYDSQIPSNSSGLRRSRSLSSAAFLDDGMGQMNFSCTNDETISSSSSSSGA-HQ 117

Query: 120 QCNRSSRRSRALTPERQCREKRFEVTSISNAYGSERSCSSGSSSNVST---------KIL 170
           Q + SSRR R LTPER+ + KRFEV     A G ERS  S S  + S          KI+
Sbjct: 118 QRDHSSRR-RNLTPERRAKTKRFEVA----ATGLERSGHSKSHYDSSGNSSSSNVSSKIV 172

Query: 171 DRYIDGEQHQERSRPTNSSSQRNYIGNGNGNGGGRLPPRVQYTAPTSPVDSVKGKPKSHS 230
           DRYIDGEQ QE S+P + S QRN+ G+GN   GGRLPPRVQYTAP SP D++K KP+SHS
Sbjct: 173 DRYIDGEQEQEMSKPKHCS-QRNFTGSGNA--GGRLPPRVQYTAPASPADNIKDKPRSHS 229

Query: 231 FREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIPITIE 290
           FRE +G R +FSSR+WV+ GFGHESP+ LA+NV+ERL+Q    P+SSSK  D+DIPITIE
Sbjct: 230 FREFRGARQKFSSRNWVDKGFGHESPQKLARNVMERLSQARAYPKSSSKKYDRDIPITIE 289

Query: 291 DIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCEGLNS 350
           D+Y GSTN Y D    V ARKSYSL++P ET+ NG   DD SG QK NYF GD    +NS
Sbjct: 290 DVYGGSTNSYMD----VPARKSYSLEEPCETI-NGYNGDDFSGFQKLNYFLGDDFGDMNS 344

Query: 351 IETEEDEDVELRRRSKEAEGRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEEKMSLA 410
           + +++  DVEL+RRSKEAE R+ +LSEELE E+FL D+GFDVP ++QTI+ L E+K+SLA
Sbjct: 345 VGSDDMVDVELQRRSKEAEERIALLSEELEQESFLQDSGFDVPPLMQTIQSLIEDKISLA 404

Query: 411 LEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSSDWSFK 470
           +EVSGLL+SRI +R SAKE  R+ KA+ E+R RRLE+EK ELQ+ LEKELDRRSSDWS K
Sbjct: 405 IEVSGLLKSRIADRDSAKEGFRLAKAEWEARNRRLEKEKSELQTALEKELDRRSSDWSSK 464

Query: 471 LEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQY 530
           LEKYQ+EEQRLRERVRELAE NVSLQREVS+F+EREAE++S+IT+SEQQL+ LT + E+ 
Sbjct: 465 LEKYQLEEQRLRERVRELAEHNVSLQREVSSFSEREAENKSVITYSEQQLRHLTSKVEEV 524

Query: 531 TEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTI 590
           ++EN DL+ NLSEL  K+  AE DL CIKRNFEEK  ECKDL KSITRLLRTCS QE+TI
Sbjct: 525 SDENQDLKHNLSELQNKYAVAEEDLDCIKRNFEEKNKECKDLHKSITRLLRTCSNQERTI 584

Query: 591 AGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENI 650
            GLR+ FS+ IEKK + DK+DKHV  +Q EQMRLTGVE++LRRE+ES R E+DSLRHENI
Sbjct: 585 GGLREKFSEDIEKKTSFDKFDKHVTQMQMEQMRLTGVELTLRREVESCRHEIDSLRHENI 644

Query: 651 SLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKGKAGQL 710
           +LL RLKGNG+E  ALT KLDKE+WTR+CCLQNQG+S+LNES QL ++L+E+IKGK G  
Sbjct: 645 NLLKRLKGNGEEVGALTFKLDKEMWTRVCCLQNQGLSLLNESIQLSAKLMEYIKGKMGHF 704

Query: 711 SETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVASKSQS 770
            E KQG+E + NGLDGQFI+ESDMKVQGFKR  ESL  SLQT+S+LL EKS+  ASKS S
Sbjct: 705 QEFKQGMEVLGNGLDGQFIVESDMKVQGFKRGTESLTRSLQTISSLLQEKSNPGASKSHS 764

Query: 771 LHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGND 830
              + + S KLN  T  E +R ELKAE LLTSLLREKLY KE EVEQLQAE+A AVRGND
Sbjct: 765 PSSNFDGSEKLN-HTPEESLRFELKAEALLTSLLREKLYFKESEVEQLQAEIAAAVRGND 823

Query: 831 ILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVLPKVSE 890
           ILRCEV NALDNL+CV+H+LK+L+LQMLKKDE++++L+ DLQ S KEL +++GVL KVS+
Sbjct: 824 ILRCEVGNALDNLACVSHQLKNLDLQMLKKDENVDRLRSDLQASVKELTMIRGVLAKVSQ 883

Query: 891 ERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFDLLA 950
           ERDMMWEEVKQY E++MLLNSE+NVLKKKIE LDED LLKEGQITILKDT+GS+PFDLL 
Sbjct: 884 ERDMMWEEVKQYKEQDMLLNSEINVLKKKIEALDEDSLLKEGQITILKDTLGSRPFDLLG 943

Query: 951 SPDNMQEFLL 960
           SP   +EFLL
Sbjct: 944 SPSCTREFLL 953

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224100891\|ref\|XP_002312055.1\| predicted protein [Populus trichocarpa] gi\|222851875\|gb\|EEE89422.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359486312\|ref\|XP_002275708.2\| PREDICTED: uncharacterized protein LOC100241537 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255568185\|ref\|XP_002525068.1\| ATP binding protein, putative [Ricinus communis] gi\|223535649\|gb\|EEF37315.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297736450\|emb\|CBI25321.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147845106\|emb\|CAN81622.1\| hypothetical protein VITISV_012437 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357445019\|ref\|XP_003592787.1\| hypothetical protein MTR_1g116070 [Medicago truncatula] gi\|355481835\|gb\|AES63038.1\| hypothetical protein MTR_1g116070 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356574999\|ref\|XP_003555630.1\| PREDICTED: uncharacterized protein LOC100804358 [Glycine max]	Back alignment and taxonomy information

>gi\|356536522\|ref\|XP_003536786.1\| PREDICTED: uncharacterized protein LOC100780589 [Glycine max]	Back alignment and taxonomy information

>gi\|449464232\|ref\|XP_004149833.1\| PREDICTED: uncharacterized protein LOC101204321 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		961
TAIR\|locus:2097243		896	AT3G55060 "AT3G55060" [Arabido	0.792	0.850	0.512	3.3e-195
TAIR\|locus:2056053		837	AT2G39300 [Arabidopsis thalian	0.709	0.814	0.386	4.2e-115
ZFIN\|ZDB-GENE-030131-5870		1964	myh9a "myosin, heavy polypepti	0.618	0.302	0.205	8e-14
UNIPROTKB\|G3V6P7		1960	Myh9 "Myosin-9" [Rattus norveg	0.608	0.298	0.203	3.5e-13
SGD\|S000002216		1790	USO1 "Protein involved in the	0.607	0.326	0.213	5.2e-13
MGI\|MGI:107717		1960	Myh9 "myosin, heavy polypeptid	0.617	0.302	0.200	5.7e-13
UNIPROTKB\|F1PJ01		1972	MYH11 "Uncharacterized protein	0.616	0.300	0.194	9.5e-13
UNIPROTKB\|F1MQ37		1964	MYH9 "Uncharacterized protein"	0.609	0.298	0.211	1.2e-12
DICTYBASE\|DDB_G0286985		1024	zipA "zipper-like domain-conta	0.584	0.548	0.204	1.4e-12
DICTYBASE\|DDB_G0285101		1922	kif4 "kinesin-7" [Dictyosteliu	0.582	0.291	0.203	1.9e-12

TAIR\|locus:2097243 AT3G55060 "AT3G55060" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1867 (662.3 bits), Expect = 3.3e-195, Sum P(2) = 3.3e-195
 Identities = 404/788 (51%), Positives = 536/788 (68%)

Query:   167 TKILDRYIDGEQHQERSRPTNSSSQRNYIXXXXXXXXXRLPPRVQYTAPTSPVDSVKGKP 226
             +K+LDRYIDGE+H E   P    S  ++          RLPPRVQ+T PTSP D+   K 
Sbjct:   131 SKVLDRYIDGEEHLE---PCKQKSNSSHSGVSESINRRRLPPRVQWTVPTSPSDTFDEKR 187

Query:   227 KSHSFREAKGTRLRFSSRDWVENGFGHESPRSLAKNVVERLAQTYVLPRSSSKDVDQDIP 286
             KS SFREAKGT LR+SS D V+NG  H SPRS+A+NV+ERL+QT+   + S+ +     P
Sbjct:   188 KSQSFREAKGTHLRYSSADCVDNGLRHGSPRSVARNVIERLSQTHGKSKGSNHE-----P 242

Query:   287 ITIEDIYCGSTNRYSDSNSDVIARKSYSLDDPFETVKNGCEKDDLSGLQKQNYFYGDHCE 346
             ITI+D+Y GS NR  DS+SD+ A  + SL + +E V N     D  G Q QN        
Sbjct:   243 ITIQDVYGGSLNRTFDSSSDIAA--NVSLAEHYEPV-NEYYTQDYGGHQ-QNCI-----R 293

Query:   347 GLNSIETEEDE-DVELRRRSKEAEGRVMVLSEELEHETFLHDTGFDVPAMIQTIRILTEE 405
               N  +  ED+ D EL  + KEAE R  + S ELE +  L D  FDV +++  IR L +E
Sbjct:   294 SRNVYKCMEDDLDSELEMKIKEAEKRAKLFSAELEQQRCLSDCDFDVSSLVGAIRKLEDE 353

Query:   406 KMSLALEVSGLLQSRIVERASAKEELRMVKADLESRTRRLEREKVELQSGLEKELDRRSS 465
             ++ LA E   LL+S+IVERASA+EE+R +K+D +   +RLE+EK ELQ+GLEKELDRRS 
Sbjct:   354 RLHLAFENVNLLRSQIVERASAREEIRWLKSDWDLHIQRLEKEKSELQAGLEKELDRRSG 413

Query:   466 DWSFKLEKYQMXXXXXXXXXXXXXXXNVSLQREVSTFNEREAESRSMITHSEQQLKDLTR 525
             +W+ KLEK+Q+               NVSLQRE+S F+E E E++ MITH E+++ +LT 
Sbjct:   414 EWTSKLEKFQLEEKKLRERVRELAEHNVSLQRELSAFHENETENKDMITHLERRVAELTT 473

Query:   526 RAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSE 585
              A++  EEN  ++Q LS+L E +  A  DL  ++RNFEEK+ EC++L KS+T+  RTC E
Sbjct:   474 TADKLHEENNYVKQTLSKLQESYAGATEDLDFLRRNFEEKDQECRELHKSVTKFFRTCKE 533

Query:   586 QEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSL 645
             Q KTI GLRDG S++++K+P+ +K D+ V  LQ EQ+RLTG+E+SLRRE+ES ++E DSL
Sbjct:   534 QGKTIEGLRDGVSEEVKKQPS-EKLDQLVKKLQVEQVRLTGIELSLRREVESMKLETDSL 592

Query:   646 RHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQGISMLNESTQLCSQLLEFIKG 705
             RHENI LLNRLKGNG+E    T+KL+ EL  R+C LQ QG+SMLNES+QLC +LL+FIKG
Sbjct:   593 RHENICLLNRLKGNGQEIDITTLKLENELKMRVCYLQEQGLSMLNESSQLCYKLLKFIKG 652

Query:   706 KAGQLSETKQGIEFIKNGLDGQFIIESDMKVQGFKRKIESLITSLQTMSALLHEKSSLVA 765
             K  QL ET Q    +K+GL  QF+IES+MKV G +R  E+L  SLQT++       S+VA
Sbjct:   653 KLTQLPETYQDKNSVKDGLSEQFMIESEMKVHGIRRGTENLKRSLQTVT-------SVVA 705

Query:   766 SKSQSLHEDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKXXXXXXXXXXXXTA 825
             S S+S   +     +  +Q+  E +R+EL AETL+TSL+REKLYSK             A
Sbjct:   706 SNSESSSSNTGRPREQRNQSVEENLRAELSAETLITSLVREKLYSKEKEIEQLQAELAAA 765

Query:   826 VRGNDILRCEVQNALDNLSCVTHKLKDLELQMLKKDESINQLQIDLQDSAKELKIMKGVL 885
             VRGN+ILRCEVQ++LDNLS  TH+LKDL+ QMLKK+ESI +L+ +LQ++AKE+  +  +L
Sbjct:   766 VRGNEILRCEVQSSLDNLSVTTHELKDLKHQMLKKEESIRRLESNLQEAAKEMARLNALL 825

Query:   886 PKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKP 945
              KVS ER  +W E KQY EKNMLLNSE   LK  +E L+E +L KEG+ITIL+DTIGSK 
Sbjct:   826 SKVSNERGQIWSEYKQYGEKNMLLNSENETLKGMVEKLEEKVLEKEGEITILQDTIGSKH 885

Query:   946 FDLLASPD 953
              +LL+SPD
Sbjct:   886 LNLLSSPD 893

GO:0003674 "molecular_function" evidence=ND

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2056053 AT2G39300 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5870 myh9a "myosin, heavy polypeptide 9a, non-muscle" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V6P7 Myh9 "Myosin-9" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

SGD\|S000002216 USO1 "Protein involved in the ER to Golgi transport step of secretion" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

MGI\|MGI:107717 Myh9 "myosin, heavy polypeptide 9, non-muscle" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PJ01 MYH11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MQ37 MYH9 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0285101 kif4 "kinesin-7" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00102079	hypothetical protein (954 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		961
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-05
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	8e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-04
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	0.001
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	0.001
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.001
TIGR03319		514	TIGR03319, RNase_Y, ribonuclease Y	0.002
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	0.002
pfam00038		312	pfam00038, Filament, Intermediate filament protein	0.002
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.003
PRK00409		782	PRK00409, PRK00409, recombination and DNA strand e	0.003
pfam13514		1118	pfam13514, AAA_27, AAA domain	0.004

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

 Score = 61.6 bits (150), Expect = 2e-09
 Identities = 60/267 (22%), Positives = 107/267 (40%), Gaps = 20/267 (7%)

Query: 421 IVERASAKEELR--------------MVKADLESRTRRLEREKVELQSGLEKELDRRSSD 466
           I+ER    EEL                  A+L      LE E  +L+  LE EL R+ S 
Sbjct: 672 ILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELE-ELSRQISA 730

Query: 467 WSFKLEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRR 526
               L + + E ++L ER+ +L+++   L+ E+    ER  E+   +  +E ++++L  +
Sbjct: 731 LRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQ 790

Query: 527 AEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQ 586
            EQ  EE   LR+ L EL  +      +   ++   E  E      ++ +  L     E 
Sbjct: 791 IEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEEL 850

Query: 587 EKTIAGLRDGFSDQIEKKPAL-DKYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSL 645
            + I  L     +  E    L  + +  +      +  L      LR E+E    E+  L
Sbjct: 851 SEDIESLAAEIEELEELIEELESELEALLNERASLEEAL----ALLRSELEELSEELREL 906

Query: 646 RHENISLLNRLKGNGKESAALTMKLDK 672
             +   L   L+   ++ A L ++L+ 
Sbjct: 907 ESKRSELRRELEELREKLAQLELRLEG 933

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|188306 TIGR03319, RNase_Y, ribonuclease Y	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|200948 pfam00038, Filament, Intermediate filament protein	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|205692 pfam13514, AAA_27, AAA domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		961
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.93
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.92
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.86
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.79
PRK02224		880	chromosome segregation protein; Provisional	99.56
PRK04863		1486	mukB cell division protein MukB; Provisional	99.54
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.51
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.47
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.47
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.46
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.46
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.43
PRK03918		880	chromosome segregation protein; Provisional	99.41
PRK02224		880	chromosome segregation protein; Provisional	99.35
KOG0018		1141	consensus Structural maintenance of chromosome pro	99.32
PRK01156		895	chromosome segregation protein; Provisional	99.31
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.26
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	99.23
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.22
PRK03918		880	chromosome segregation protein; Provisional	99.21
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.19
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.19
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.09
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.06
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.97
PRK01156		895	chromosome segregation protein; Provisional	98.95
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.89
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.86
KOG0933		1174	consensus Structural maintenance of chromosome pro	98.85
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.79
PHA02562		562	46 endonuclease subunit; Provisional	98.79
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.76
KOG0979		1072	consensus Structural maintenance of chromosome pro	98.76
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.59
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.55
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.52
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.47
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.45
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.42
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.41
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	98.34
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.33
PRK04863		1486	mukB cell division protein MukB; Provisional	98.32
KOG0979		1072	consensus Structural maintenance of chromosome pro	98.32
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.31
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.27
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	98.26
PHA02562		562	46 endonuclease subunit; Provisional	98.24
KOG0018		1141	consensus Structural maintenance of chromosome pro	98.23
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.23
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.2
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.16
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.15
PRK04778		569	septation ring formation regulator EzrA; Provision	98.14
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	98.13
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.11
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.11
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	98.06
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.05
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.96
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.96
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.9
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.87
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	97.86
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	97.83
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.78
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	97.77
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.75
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.73
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.71
PRK04778		569	septation ring formation regulator EzrA; Provision	97.71
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.66
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.64
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.64
KOG0971		1243	consensus Microtubule-associated protein dynactin	97.64
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.61
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.6
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.6
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.57
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.55
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.54
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.52
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.52
PRK09039		343	hypothetical protein; Validated	97.5
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.48
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.48
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.48
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.47
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.45
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.44
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.43
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.41
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.39
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.38
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.37
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.37
PRK11281		1113	hypothetical protein; Provisional	97.36
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.34
PRK09039		343	hypothetical protein; Validated	97.33
COG4372		499	Uncharacterized protein conserved in bacteria with	97.31
COG4372		499	Uncharacterized protein conserved in bacteria with	97.28
KOG1003		205	consensus Actin filament-coating protein tropomyos	97.27
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.23
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.21
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	97.21
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	97.2
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	97.2
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	97.18
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.18
KOG2991		330	consensus Splicing regulator [RNA processing and m	97.14
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.14
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.12
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	97.11
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	97.1
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.09
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.99
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	96.97
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	96.97
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	96.92
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.91
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	96.91
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.91
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	96.91
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.88
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	96.83
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.83
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.81
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.75
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.75
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.73
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.73
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.69
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.64
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	96.64
COG4942		420	Membrane-bound metallopeptidase [Cell division and	96.57
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	96.57
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	96.56
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.56
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.55
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.54
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	96.53
KOG1937		521	consensus Uncharacterized conserved protein [Funct	96.53
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.53
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	96.52
KOG2991		330	consensus Splicing regulator [RNA processing and m	96.5
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.48
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.48
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	96.45
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.44
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	96.41
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	96.36
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.36
PF13514		1111	AAA_27: AAA domain	96.33
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	96.33
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	96.26
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	96.14
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	96.1
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.05
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	96.04
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.01
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.99
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.99
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	95.94
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	95.88
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	95.86
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.74
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	95.7
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	95.69
PRK10869		553	recombination and repair protein; Provisional	95.63
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	95.57
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	95.57
PLN02939		977	transferase, transferring glycosyl groups	95.56
PF13166		712	AAA_13: AAA domain	95.55
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	95.49
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	95.46
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	95.44
PRK11281		1113	hypothetical protein; Provisional	95.35
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	95.32
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.29
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	95.27
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	95.26
PRK10929		1109	putative mechanosensitive channel protein; Provisi	95.23
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	95.19
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	95.17
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	95.12
PF13166		712	AAA_13: AAA domain	95.11
PF10186		302	Atg14: UV radiation resistance protein and autopha	95.1
PF10186		302	Atg14: UV radiation resistance protein and autopha	94.97
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.89
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	94.81
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.79
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.74
COG4477		570	EzrA Negative regulator of septation ring formatio	94.67
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	94.67
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	94.65
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.6
PF15294		278	Leu_zip: Leucine zipper	94.54
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	94.53
PRK10869		553	recombination and repair protein; Provisional	94.53
KOG0249		916	consensus LAR-interacting protein and related prot	94.51
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	94.47
KOG1937		521	consensus Uncharacterized conserved protein [Funct	94.46
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	94.39
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	94.32
PRK10361		475	DNA recombination protein RmuC; Provisional	94.09
COG2433		652	Uncharacterized conserved protein [Function unknow	93.95
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	93.95
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	93.94
KOG0249		916	consensus LAR-interacting protein and related prot	93.87
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	93.81
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	93.68
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	93.65
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	93.58
PLN02939		977	transferase, transferring glycosyl groups	93.53
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.48
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	93.47
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	93.43
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	93.39
COG3096		1480	MukB Uncharacterized protein involved in chromosom	93.37
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	93.25
KOG0993		542	consensus Rab5 GTPase effector Rabaptin-5 [Intrace	93.16
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	93.15
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	93.09
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	93.06
PF13514		1111	AAA_27: AAA domain	92.82
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	92.76
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	92.68
PRK10246		1047	exonuclease subunit SbcC; Provisional	92.64
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	92.36
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	92.32
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	92.23
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	92.11
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	92.07
PRK10361		475	DNA recombination protein RmuC; Provisional	91.89
PF07798		177	DUF1640: Protein of unknown function (DUF1640); In	91.88
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	91.87
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	91.84
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	91.82
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	91.72
KOG4302		660	consensus Microtubule-associated protein essential	91.67
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	91.54
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	91.44
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	91.43
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	91.39
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	91.32
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	91.17
PRK12704		520	phosphodiesterase; Provisional	90.99
COG2433		652	Uncharacterized conserved protein [Function unknow	90.96
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	90.91
KOG0972		384	consensus Huntingtin interacting protein 1 (Hip1)	90.77
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	90.6
PRK10246		1047	exonuclease subunit SbcC; Provisional	90.56
KOG4677		554	consensus Golgi integral membrane protein [Intrace	90.42
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	90.07
PRK10698		222	phage shock protein PspA; Provisional	90.04
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	89.92
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	89.88
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	89.6
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	89.56
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	89.44
KOG4677		554	consensus Golgi integral membrane protein [Intrace	89.41
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	89.2
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	89.19
COG4477		570	EzrA Negative regulator of septation ring formatio	89.16
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	89.05
PF13863		126	DUF4200: Domain of unknown function (DUF4200)	89.04
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	88.84
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	88.47
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	88.37
PRK00106		535	hypothetical protein; Provisional	88.3
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	88.28
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	87.98
KOG3091		508	consensus Nuclear pore complex, p54 component (sc	87.92
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	87.82
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	87.72
KOG4460		741	consensus Nuclear pore complex, Nup88/rNup84 compo	87.72
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	87.61
KOG4637		464	consensus Adaptor for phosphoinositide 3-kinase [S	87.57
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	87.45
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	87.35
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	87.22
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	87.14
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	87.08
KOG0288		459	consensus WD40 repeat protein TipD [General functi	86.93
KOG4302		660	consensus Microtubule-associated protein essential	86.85
PF12329		74	TMF_DNA_bd: TATA element modulatory factor 1 DNA b	86.46
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	86.41
PRK10698		222	phage shock protein PspA; Provisional	86.11
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	85.87
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	85.54
PF08581		79	Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t	85.45
PRK03947		140	prefoldin subunit alpha; Reviewed	85.42
COG5283		1213	Phage-related tail protein [Function unknown]	85.24
PF09486		158	HrpB7: Bacterial type III secretion protein (HrpB7	85.23
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	85.22
KOG2685		421	consensus Cystoskeletal protein Tektin [Cytoskelet	85.18
PRK12704		520	phosphodiesterase; Provisional	84.58
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	84.56
PF14992		280	TMCO5: TMCO5 family	84.04
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	84.03
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	84.01
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	83.95
PRK11519		719	tyrosine kinase; Provisional	83.84
KOG1962		216	consensus B-cell receptor-associated protein and r	83.8
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	83.77
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	83.73
PRK15422		79	septal ring assembly protein ZapB; Provisional	83.68
cd07666		243	BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S	83.48
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	83.37
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	83.24
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	83.22
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	83.14
PF06120		301	Phage_HK97_TLTM: Tail length tape measure protein;	83.09
PF15294		278	Leu_zip: Leucine zipper	82.92
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	82.86
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	82.79
PF02994		370	Transposase_22: L1 transposable element; InterPro:	82.77
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	82.76
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	82.51
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	82.29
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	82.19
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	82.04
COG4026		290	Uncharacterized protein containing TOPRIM domain,	81.98
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	81.91
KOG0288		459	consensus WD40 repeat protein TipD [General functi	81.7
TIGR02338		110	gimC_beta prefoldin, beta subunit, archaeal. Chape	81.62
KOG4657		246	consensus Uncharacterized conserved protein [Funct	81.59
PF07200		150	Mod_r: Modifier of rudimentary (Mod(r)) protein; I	81.51
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	81.5
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	81.16
PF04949		159	Transcrip_act: Transcriptional activator; InterPro	81.01
KOG2751		447	consensus Beclin-like protein [Signal transduction	81.0
PF14992		280	TMCO5: TMCO5 family	80.96
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	80.88
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	80.86
PRK11519		719	tyrosine kinase; Provisional	80.82
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	80.65
PF05335		188	DUF745: Protein of unknown function (DUF745); Inte	80.6
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	80.52
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	80.4
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	80.38
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	80.28
KOG3850		455	consensus Predicted membrane protein [Function unk	80.26
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	80.17
PRK15422		79	septal ring assembly protein ZapB; Provisional	80.05
KOG4787		852	consensus Uncharacterized conserved protein [Funct	80.03

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

Probab=99.93  E-value=2.3e-21  Score=233.23  Aligned_cols=516  Identities=16%  Similarity=0.202  Sum_probs=353.1

Q ss_pred             cChHHHHHHHHHHhhhhHHHHHH-hh-hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHhhhhhHHHHHHHHHH
Q 002131          401 ILTEEKMSLALEVSGLLQSRIVE-RA-SAKEELRMVKADLESRTRRLEREKVELQSGLE--KELDRRSSDWSFKLEKYQM  476 (961)
Q Consensus       401 ~~~edRR~i~EEaaGi~Kyk~ae-rk-~t~enL~Ri~~ELe~QLepLEkQaekAK~yLE--KEL~rrqnE~~~kI~~~Es  476 (961)
                      ..|.+...+|-+|.-+-.-+-.. .. .+.++...++...+..+.+|+++...++.-+.  ..++.    +...+..+..
T Consensus       194 ~~p~dkYklfmkaT~L~qi~~~~~~~~~~~~~~~~~i~~~~e~i~~l~k~i~e~~e~~~~~~~~e~----~~~~l~~Lk~  269 (1074)
T KOG0250|consen  194 SNPKDKYKLFMKATQLEQITESYSEIMESLDHAKELIDLKEEEIKNLKKKIKEEEEKLDNLEQLED----LKENLEQLKA  269 (1074)
T ss_pred             CChHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH
Confidence            45777777777766554333211 11 33344444777777777777777777666551  11111    1111111111


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002131          477 EEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLY  556 (961)
Q Consensus       477 Ekk~LrERlreLeEknvsLqrEIe~leeKi~El~~kIe~leeqIe~ltselEeleeELeeleqeleEl~ee~qeaeEeld  556 (961)
                      +  +.=-.|-.-..+...+..++-..+++...+..+++.....+..+...+.++++.+..+..++....++++.+++.++
T Consensus       270 k--~~W~~V~~~~~ql~~~~~~i~~~qek~~~l~~ki~~~~~k~~~~r~k~teiea~i~~~~~e~~~~d~Ei~~~r~~~~  347 (1074)
T KOG0250|consen  270 K--MAWAWVNEVERQLNNQEEEIKKKQEKVDTLQEKIEEKQGKIEEARQKLTEIEAKIGELKDEVDAQDEEIEEARKDLD  347 (1074)
T ss_pred             H--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhhhhhhHHHHHHHHHHH
Confidence            1  11112222223333333444445555555555666666666666667777777778888888888889999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHhhhcchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002131          557 CIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRLTGVEMSLRREIE  636 (961)
Q Consensus       557 ~iR~e~eEleeei~eleKeIa~Lq~~Ik~lEKtIe~LrqEL~eEleke~~vee~ek~Ie~lq~ElerLt~~eE~LReELE  636 (961)
                      ..++++.+++.++...++.|..++..+..++++|..++.++-..+++.  ..+.+..++.+..+++.++.....|+.+++
T Consensus       348 ~~~re~~~~~~~~~~~~n~i~~~k~~~d~l~k~I~~~~~~~~~~~~~~--~~e~e~k~~~L~~evek~e~~~~~L~~e~~  425 (1074)
T KOG0250|consen  348 DLRREVNDLKEEIREIENSIRKLKKEVDRLEKQIADLEKQTNNELGSE--LEERENKLEQLKKEVEKLEEQINSLREELN  425 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999986777766  666666666666666666666666666666


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcCCchhhhHhhhhHHHHHHHHHHHhc---cccCCCCChHHHHHHHHHHh-ccccccc-
Q 002131          637 SYRVEVDSLRHENISLLNRLKGNGKESAALTMKLDKELWTRICCLQNQ---GISMLNESTQLCSQLLEFIK-GKAGQLS-  711 (961)
Q Consensus       637 sle~EIEsLReEl~~L~rRLq~~~ne~~~~~~kl~~El~~~I~~lq~q---~lS~~d~n~~lm~KLL~~IK-~k~~~~~-  711 (961)
                      .+...+....++...+...+..+....        +-....|.+|..-   +++.||++   |+.||++|. ++++|+. 
T Consensus       426 ~~~~~~~~~~ee~~~i~~~i~~l~k~i--------~~~~~~l~~lk~~k~dkvs~FG~~---m~~lL~~I~r~~~~f~~~  494 (1074)
T KOG0250|consen  426 EVKEKAKEEEEEKEHIEGEILQLRKKI--------ENISEELKDLKKTKTDKVSAFGPN---MPQLLRAIERRKRRFQTP  494 (1074)
T ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHhcccchhhhcchh---hHHHHHHHHHHHhcCCCC
Confidence            666666666666655554443332221        1114444444333   99999999   999999999 5667654 


Q ss_pred             ---------cccccc-----h-hcccCCccceEEE----------------Ee--------cccccc--cccchhhhcc-
Q 002131          712 ---------ETKQGI-----E-FIKNGLDGQFIIE----------------SD--------MKVQGF--KRKIESLITS-  749 (961)
Q Consensus       712 ---------sVK~~~-----q-~ig~tLds~FVV~----------------~~--------iK~q~f--~~Gka~l~~s-  749 (961)
                               ||+.+-     + +||+.|+| |||+                |+        -++.+|  ..|-.  .+. 
T Consensus       495 P~GPlG~~Vtl~~~KWa~aIE~~L~n~lna-Fiv~sh~D~~~Lr~i~~~~~~~~~~ptIvvs~~~~~~y~~~~~--p~~~  571 (1074)
T KOG0250|consen  495 PKGPLGKYVTLKEPKWALAIERCLGNLLNA-FIVTSHKDARILRAIMRRLKIPGNRPTIVVSSFTPFDYSVGRN--PGYE  571 (1074)
T ss_pred             CCCCccceeEecCcHHHHHHHHHHHHhhhh-heeCCHhhHHHHHHHHHHcCCCCCCCcEEEecCCccccccccC--CCCC
Confidence                     777765     6 99999999 9998                11        166666  66666  555 


Q ss_pred             HHHHH---------------------------------HHhcc---cCcccc-cccccccccc-cCCccccccccchhhh
Q 002131          750 LQTMS---------------------------------ALLHE---KSSLVA-SKSQSLHEDV-NLSGKLNDQTAGEIMR  791 (961)
Q Consensus       750 l~TIl---------------------------------slL~~---k~NV~~-~~~~SG~~~s-gglD~v~Y~~~~d~lr  791 (961)
                      ||||+                                 .+|..   |.||.. +.-+ |+++- ||.....|.+-....+
T Consensus       572 ~pTil~~le~ddp~V~N~LID~s~iE~~lLiEdk~Ea~~~m~s~~~p~n~~~aytld-g~~~~~~g~~~~~ySt~~~~~r  650 (1074)
T KOG0250|consen  572 FPTILDALEFDDPEVLNVLIDKSGIEQVLLIEDKKEAREFMQSDKPPANVTKAYTLD-GRQIFAGGPNYRVYSTRGTRAR  650 (1074)
T ss_pred             CCceeeeeecCChHHHHHhhhhccceeEEEecchHHHHHHHhcCCCCccceeeeccC-ccccccCCCCcceeccCCCCCC
Confidence            89998                                 56663   777776 2211 22222 3332222411134444


Q ss_pred             --ccchhhhhh-hHHHHHHHHHHHHHHHHHHHHHHHhhhchHHHHHHHHHHHHHhHHHHHHHHHHHHhh--------hhh
Q 002131          792 --SELKAETLL-TSLLREKLYSKELEVEQLQAELATAVRGNDILRCEVQNALDNLSCVTHKLKDLELQM--------LKK  860 (961)
Q Consensus       792 --~klkses~~-~s~LkE~I~~ee~eleqlq~elas~~~~~~~lr~Eiq~l~dels~~~~k~k~LE~q~--------~K~  860 (961)
                        ..+..+.+. +.+|+..+..++.++..++.++..+..-.+.+++.++.+...+..++.+++.+...|        .+.
T Consensus       651 ~~~~~~~s~d~~ie~le~e~~~l~~~~~~l~~~~~~~e~~l~e~~~~~~~l~~~~~q~~~~~~~~~~em~el~n~~e~~~  730 (1074)
T KOG0250|consen  651 RPGVDEFSFDDEIEDLEREASRLQKEILELENQRREAEKNLEELEKKLRELSEHIEQIKRRIRKKRAEMTELKNTAEEKQ  730 (1074)
T ss_pred             CccccchhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhh
Confidence              333444444 888888888888888888877777777778888888888888888885444444333        333


Q ss_pred             hh--hHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHhhhhchhHHhh
Q 002131          861 DE--SINQLQIDLQDSAKELKIMKGVLPKVSEERDMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILK  938 (961)
Q Consensus       861 ~D--~I~~lq~dlqe~~keis~~~g~L~~v~eerd~~~ee~k~lke~~~~~k~Ev~~lkk~ie~Leedi~~kEgqIsil~  938 (961)
                      .|  .|+.+..++....++|+.+++.+..+.+++..+..+.+++.+.+......++..-.++.+|++++..++..+....
T Consensus       731 ~~~~~~~~l~~ei~~~~~eIe~~~~~~e~l~~e~e~~~~e~~e~~~~~~~~~~~l~~e~~~l~~l~~el~~r~dk~~s~e  810 (1074)
T KOG0250|consen  731 VDISKLEDLAREIKKKEKEIEEKEAPLEKLKEELEHIELEAQELEEYYAAGREKLQGEISKLDALKEELKLREDKLRSAE  810 (1074)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhhh
Confidence            44  8999999999999999999999999999999999999999999999999999999999999999998888776643


Q ss_pred             h
Q 002131          939 D  939 (961)
Q Consensus       939 D  939 (961)
                      |
T Consensus       811 ~  811 (1074)
T KOG0250|consen  811 D  811 (1074)
T ss_pred             h
Confidence            3

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13863 DUF4200: Domain of unknown function (DUF4200)	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []	Back alignment and domain information

>PRK03947 prefoldin subunit alpha; Reviewed	Back alignment and domain information

>COG5283 Phage-related tail protein [Function unknown]	Back alignment and domain information

>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton]	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12)	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal	Back alignment and domain information

>KOG4657 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae []	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>KOG3850 consensus Predicted membrane protein [Function unknown]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>KOG4787 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		961
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-20
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-13
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-09
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-04
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-08
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-05
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	5e-05
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-04
2xs1_A		704	Programmed cell death 6-interacting protein; prote	6e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 95.7 bits (237), Expect = 3e-20
 Identities = 74/490 (15%), Positives = 158/490 (32%), Gaps = 93/490 (18%)

Query: 515 HSEQQLKDLTRRAEQYTEENGDLRQNLSELGEKFRAAEADLYCIKRNFEE------KEME 568
           H      D      QY     D+   LS   + F     +  C  ++ ++       + E
Sbjct: 1   HHHHHHMDFETGEHQYQ--YKDI---LSVFEDAFVD---NFDC--KDVQDMPKSILSKEE 50

Query: 569 CKDLQKSITRLLRT-------CSEQEKTIA-----GLRDGFS---DQIE---KKPALD-- 608
              +  S   +  T        S+QE+ +       LR  +      I+   ++P++   
Sbjct: 51  IDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTR 110

Query: 609 KYDKHVALLQREQMRLTGVEMSLRREIESYRVEVDSLRHENISLLNRLKGNGKESAALTM 668
            Y +    L  +        +S  +     R  +  LR     L++ + G+GK   AL +
Sbjct: 111 MYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDV 170

Query: 669 KLDKEL---------WTRI--CCLQNQGISMLNESTQLCSQLLEFIKGKAGQLSETKQGI 717
            L  ++         W  +  C      + ML    +L  Q+      ++   S  K  I
Sbjct: 171 CLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQ---KLLYQIDPNWTSRSDHSSNIKLRI 227

Query: 718 EFIKNGLDGQFIIESDMKVQGFKRKIESLIT-----SLQTMSALLHEKSSLVASKSQSLH 772
             I+  L          K + ++     L+      + +  +A       L+ ++ + + 
Sbjct: 228 HSIQAELRRLL------KSKPYEN---CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVT 278

Query: 773 EDVNLSGKLNDQTAGEIMRSELKAETLLTSLLREKLYSKELEVEQLQAELATAVRGNDIL 832
           + ++ +      +      +    E    SLL + L   +   + L  E    +  N   
Sbjct: 279 DFLS-AATTTHISLDHHSMTLTPDEVK--SLLLKYL---DCRPQDLPRE---VLTTNPRR 329

Query: 833 RCEVQNALDNLSCVTHKLKDLELQMLKK--DESINQLQ-IDLQDSAKELKIM-KGVLPKV 888
              +  ++ +        K +    L    + S+N L+  + +     L +        +
Sbjct: 330 LSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSA--HI 387

Query: 889 SEER-DMMWEEVKQYSEKNMLLNSEVNVLKKKIEVLDEDLLLKEGQITILKDTIGSKPFD 947
                 ++W +V +     +     VN L K   ++++    KE  I+I      S   +
Sbjct: 388 PTILLSLIWFDVIKSDVMVV-----VNKLHKY-SLVEKQ--PKESTISIP-----SIYLE 434

Query: 948 LLASPDNMQE 957
           L    +N   
Sbjct: 435 LKVKLENEYA 444

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		961
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	99.19
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	99.16
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	98.88
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	98.68
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.9
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	97.77
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.72
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	97.59
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.57
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.48
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	97.38
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	97.21
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	97.09
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	97.0
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.81
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	96.68
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	96.56
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.54
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.36
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	95.6
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	94.91
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	94.88
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	94.62
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	93.95
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	93.64
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	93.63
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	93.32
3l4q_C		170	Phosphatidylinositol 3-kinase regulatory subunit b	93.15
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	93.13
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	93.1
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	93.04
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	92.44
1x79_B		112	RAB GTPase binding effector protein 1; rabaptin5,	92.35
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	92.16
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	91.91
2xzr_A		114	Immunoglobulin-binding protein EIBD; cell adhesion	91.74
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	91.39
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	91.39
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	91.36
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	91.28
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	90.55
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	90.54
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	90.12
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	90.01
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	89.79
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	89.69
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	89.04
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	88.69
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	88.67
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	88.57
3swk_A		86	Vimentin; cytoskeleton, intermediate filament, alp	88.56
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	88.43
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	88.4
1l8d_A		112	DNA double-strand break repair RAD50 ATPase; zinc	87.95
3swk_A		86	Vimentin; cytoskeleton, intermediate filament, alp	87.71
3cvf_A		79	Homer-3, homer protein homolog 3; coiled coil, alt	87.69
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	86.72
3cve_A		72	Homer protein homolog 1; coiled coil, alternative	86.66
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	86.39
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	85.83
2e7s_A		135	RAB guanine nucleotide exchange factor SEC2; coile	84.95
1x79_B		112	RAB GTPase binding effector protein 1; rabaptin5,	84.67
2e7s_A		135	RAB guanine nucleotide exchange factor SEC2; coile	83.8
1m1j_B		464	Fibrinogen beta chain; coiled coils, disulfide rin	82.68
3mq7_A		121	Bone marrow stromal antigen 2; HIV, antiviral prot	82.36
3hhm_B		373	NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil	82.26
2no2_A		107	HIP-I, huntingtin-interacting protein 1; clathrin	82.06
3cvf_A		79	Homer-3, homer protein homolog 3; coiled coil, alt	81.86
3cve_A		72	Homer protein homolog 1; coiled coil, alternative	81.54
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	81.13
3jsv_C		94	NF-kappa-B essential modulator; ubiquitin, coiled-	81.06
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	80.89
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	80.74
3mq7_A		121	Bone marrow stromal antigen 2; HIV, antiviral prot	80.24

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

Probab=99.19  E-value=2.8e-07  Score=93.69  Aligned_cols=183  Identities=14%  Similarity=0.137  Sum_probs=80.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002131          465 SDWSFKLEKYQMEEQRLRERVRELAEQNVSLQREVSTFNEREAESRSMITHSEQQLKDLTRRAEQYTEENGDLRQNLSEL  544 (961)
Q Consensus       465 nE~~~kI~~~EsEkk~LrERlreLeEknvsLqrEIe~leeKi~El~~kIe~leeqIe~ltselEeleeELeeleqeleEl  544 (961)
                      ..+...+..++.++..+..++..+......+..++..+...+..+...+..+...+..+...+..+...+..+...+.++
T Consensus        72 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  151 (284)
T 1c1g_A           72 ELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEA  151 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHH
Confidence            33444444455555555555555555555555555444444444444444444444444444444444444444444444


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHhhhcchhhhhhHHHHHHHHHHHHHH
Q 002131          545 GEKFRAAEADLYCIKRNFEEKEMECKDLQKSITRLLRTCSEQEKTIAGLRDGFSDQIEKKPALDKYDKHVALLQREQMRL  624 (961)
Q Consensus       545 ~ee~qeaeEeld~iR~e~eEleeei~eleKeIa~Lq~~Ik~lEKtIe~LrqEL~eEleke~~vee~ek~Ie~lq~ElerL  624 (961)
                      ...+..+       +..+..+...+..+...+..+...+..+...+..+...+ ..+...  +..+...+..+...+..+
T Consensus       152 ~~~~~~~-------~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~--~~~~~~~~~~~~~~~~~~  221 (284)
T 1c1g_A          152 KHIAEDA-------DRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEI-KTVTNN--LKSLEAQAEKYSQKEDKY  221 (284)
T ss_dssp             HHHHHHH-------HHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHH--HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHH--HHHHHHhHHHHHHHHHHH
Confidence            4444444       444444444444444444444444444444444444443 222222  222333333333333444


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 002131          625 TGVEMSLRREIESYRVEVDSLRHENISLLNRLK  657 (961)
Q Consensus       625 t~~eE~LReELEsle~EIEsLReEl~~L~rRLq  657 (961)
                      ......++.++..+...+..+...+..+...+.
T Consensus       222 ~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (284)
T 1c1g_A          222 EEEIKVLSDKLKEAETRAEFAERSVTKLEKSID  254 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444444444444444444444444444444433

PyMOL of 1c1g

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1	Back alignment and structure

>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens}	Back alignment and structure

>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2	Back alignment and structure

>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B*	Back alignment and structure

>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A	Back alignment and structure

>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A	Back alignment and structure

>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens}	Back alignment and structure

>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens}	Back alignment and structure

>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus}	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		961
d2ap3a1		185	Hypothetical protein MW0975 (SA0943) {Staphylococc	94.14
d2ap3a1		185	Hypothetical protein MW0975 (SA0943) {Staphylococc	94.07
d2efla1		288	Formin-binding protein 1, FNBP1 {Human (Homo sapie	89.16
d1f5na1		300	Interferon-induced guanylate-binding protein 1 (GB	82.03
d1f5na1		300	Interferon-induced guanylate-binding protein 1 (GB	81.84
d1fxka_		107	Prefoldin beta subunit {Archaeon Methanobacterium	80.02

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]

Probab=94.14  E-value=1.1  Score=39.34  Aligned_cols=30  Identities=7%  Similarity=0.173  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002131          617 LQREQMRLTGVEMSLRREIESYRVEVDSLR  646 (961)
Q Consensus       617 lq~ElerLt~~eE~LReELEsle~EIEsLR  646 (961)
                      +...+..|......+...+..+...+..+.
T Consensus       149 l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  178 (185)
T d2ap3a1         149 VNEKSKAIEQNYKKLKEVSDKYTKVLNKVQ  178 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333334444444444444444444444333

PyMOL of d2ap3a1

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure