Citrus Sinensis ID: 002135

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-

MNKSRGDNSSCLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHDDSIVIINVSTEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVKERRTDVRGNEVKRARRSQSSTSSSHSFQRRCSDKSQLLPLEMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDRHPGGTGVSKQVTDMKMN

ccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHccccccHHHHHHHHHcccccEEEEccccccccccccEEEEcccccccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEEccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHccccEEEEcHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHcccccEEEEcccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHcccccEEEEEccHHcccccccccEEEEEcccccHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccccEEEEEcccccccccccccccccccEEEEEccccEEEEEcccccHHHHcccccEEEEccEEEEEEEEEccccEEEEEEccccccccccccEEcccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEccccEEEEEEEcccccEEEEEEEEEEEEcHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHccc

cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEcEHHHHHHEEEcccEEEEEcccccccccccEEEEEEccccccccEEcccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEEEEccccccccccccHHccHHHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHcccEEEEcHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHccEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccEEEEEccccccccEEEEEEcccccccccccHHccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEccHHHcccEcccccEEEEEccccHHHHHHHHHcccccccccEEEEEEEccccccEEEEccHHHHHcccccEEEEcccccEEHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHccHHccccccccccccccccccccccccEEEEccccccEEEEEccccEEEEEEcccccHHHccccEEEEEcccEEEEEEccccccEEEEEEccccccccccccEEEEEEEccccEcccccccccccEEEEEEEEEEEEEEEEEEEEEcccccEcccccccccccEEccEEEEEEccHHHHHHcccccccHHHHHHHHHHHHHHcHHEEEccHHHccccccccccccccccEEEEEccccccccHHHHHHHHHcc

mnksrgdnssclcPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANddmesknhddsIVIINVSTEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVKErrtdvrgnevkrarrsqsstssshsfqrrcsdksqllpLEMVEHLRKgigsqgqmvHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSsgkslcynlPVLEALSHdlsssalymfptKALAQDQLRALLAMTKAFdasidigvydgdttqkdRMWLRDNARLlitnpdmlhmsilpyhgqFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDeahaykgafgcHTALILRRLCRLCshvygsdpsfvfstatsanpreHCMELANLSTLELIqndgspcaqklfvlwnptsclrsvlnksqtdmddtrnaanktsspisEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVyragyvaedrrrierdffggklcGVAATNALELGIdvghidvtlhlgfpgsIASLWQQAgrsgrrerpslAVYVAfegpldqyfmkypeklfkspiecchidaQNHKVLEQHLVCAALehplsliydekyfgsglssgittlknrgylssdpsldsSAKIFEYighekmpshtISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFtktrdytdihvsggnnayaTKISKDQLTKTTAQALACTVTTTWFGFYRLWrgsgiifdtvelylpkysyesqAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIyvrcnfsdlapecpnphdsryfperillydrhpggtgvskqvtdmkmn

mnksrgdnsscLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANddmesknhddSIVIINVSteerdkvednlgsgqkaislsKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLtyvkerrtdvrgnevkrarrsqsstssshsfqrrcsdksqllPLEMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFdasidigvydgdttqkdrMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNksqtdmddtrnaanktsspiSEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILeetaphlvdsiCVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIghekmpshtISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKtrdytdihvsggnNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYdrhpggtgvskqvtdmkmn

MNKSRGDNSSCLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHDDSIVIINVSTEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVKERRTDVRGNEVKrarrsqsstssshsfqrrcsDKSQLLPLEMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKalaqdqlrallaMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDRHPGGTGVSKQVTDMKMN

**********CLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFAND*********SIVIINV********************LSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVK******************************************VEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVL**********************EVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAG*******PSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYL*********AKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDR*****************

***************WLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHD****************************************************************LSVEDLLTY*******************************************MVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLN**********NAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASL***********RPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDRHPGGTGVSKQVTDMKM*

*********SCLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHDDSIVIINVSTEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVKERRTDV**************************DKSQLLPLEMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLW**********RPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDRHPGGTGVSKQVTDMKMN

********SSCLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHDDSIVIINVSTEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCKLQKRVMSLSVEDLLTYVKE**********************************QLLPLEMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVEQNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFPERILLYDRHPGGTGVSKQVTDMKMN

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		961	2.2.26 [Sep-21-2011]
Q05549		1077	Putative ATP-dependent he	yes	no	0.713	0.636	0.332	1e-115
P50830		749	Uncharacterized ATP-depen	yes	no	0.706	0.906	0.328	1e-111
O13983		1063	Putative ATP-dependent he	yes	no	0.673	0.608	0.326	1e-110
Q58969		684	Uncharacterized ATP-depen	yes	no	0.386	0.542	0.269	1e-32
Q57742		841	Uncharacterized ATP-depen	no	no	0.363	0.414	0.255	1e-19
P95949		875	Uncharacterized ATP-depen	no	no	0.407	0.448	0.248	1e-13
O27830		862	Uncharacterized ATP-depen	no	no	0.375	0.418	0.244	4e-13
Q9VGI8		1487	Bloom syndrome protein ho	yes	no	0.329	0.213	0.278	2e-12
O18017		988	Bloom syndrome protein ho	yes	no	0.344	0.335	0.256	4e-12
P50729		496	Probable ATP-dependent DN	no	no	0.337	0.653	0.232	5e-12

>sp\|Q05549\|HRQ1_YEAST Putative ATP-dependent helicase HRQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRQ1 PE=1 SV=1	Back alignment and function desciption

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 257/772 (33%), Positives = 403/772 (52%), Gaps = 86/772 (11%)

Query: 205 EMVEHLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESI 264
           +M+E L+       Q+ H   I +R A    +   L       ++       YSHQA++I
Sbjct: 243 QMIEKLKSTEFYASQIKHCFTIPSRTAKYKGLCFELAPEVYQGMEH---ENFYSHQADAI 299

Query: 265 MASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRA----L 320
            +   G+NV++ T TSSGKSL Y L  ++ L  D  S+ +Y+FPTKALAQDQ RA    L
Sbjct: 300 NSLHQGENVIITTSTSSGKSLIYQLAAIDLLLKDPESTFMYIFPTKALAQDQKRAFKVIL 359

Query: 321 LAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNL 380
             + +  +A +D   YDGDT  ++R ++R NAR++ TNPDM+H SILP H  +   L +L
Sbjct: 360 SKIPELKNAVVD--TYDGDTEPEERAYIRKNARVIFTNPDMIHTSILPNHANWRHFLYHL 417

Query: 381 RLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVY-GSDPSF 439
           +L                   VV+DE H YKG FG H AL++RRL RLC   Y  S   F
Sbjct: 418 KL-------------------VVVDELHIYKGLFGSHVALVMRRLLRLCHCFYENSGLQF 458

Query: 440 VFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDD 499
           +  +AT  +P +H  ++  ++ + LI  DGSP   K  V+WNP      +L + +     
Sbjct: 459 ISCSATLKSPVQHMKDMFGINEVTLIHEDGSPTGAKHLVVWNP-----PILPQHE----- 508

Query: 500 TRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETA-PHLVD 558
                 K  + I E + +  +++ + +R IAFC  R++CEL++   R I  ET    LV 
Sbjct: 509 -----RKRENFIRESAKILVQLILNNVRTIAFCYVRRVCELLMKEVRNIFIETGREDLVT 563

Query: 559 SICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLW 618
            +  YR GY A DRR+IER+ F G L  V +TNALELGID+G +D  L  GFP S+A+  
Sbjct: 564 EVMSYRGGYSASDRRKIEREMFHGNLKAVISTNALELGIDIGGLDAVLMCGFPLSMANFH 623

Query: 619 QQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFK----SPIECCHIDAQNHKVLEQH 674
           QQ+GR+GRR   SL + VA + P+DQ+++ +PE L +       +   +D  N  +LE H
Sbjct: 624 QQSGRAGRRNNDSLTLVVASDSPVDQHYVAHPESLLEVNNFESYQDLVLDFNNILILEGH 683

Query: 675 LVCAALEHPLSLIYDEKYFGSGLSSGITTLK----NRGYLSSDPSLDSSAKIFEYIGHEK 730
           + CAA E P++   D++YF       I   +      GY +S+  L              
Sbjct: 684 IQCAAFELPINFERDKQYFTESHLRKICVERLHHNQDGYHASNRFL-------------P 730

Query: 731 MPSHTISIRAIESERYEVIDMQS--NEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELN 788
            PS  +S+R  E +++ V+D+ +  N ++EEIE S+  F +Y+G +++HQG+ YLVKE N
Sbjct: 731 WPSKCVSLRGGEEDQFAVVDITNGRNIIIEEIEASRTSFTLYDGGIFIHQGYPYLVKEFN 790

Query: 789 LSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACTVTTTW- 847
              + A  Q+ D+ + T  RD+TD+      +    ++ +  L  +        + TT  
Sbjct: 791 PDERYAKVQRVDVDWVTNQRDFTDV------DPQEIELIR-SLRNSDVPVYFGKIKTTII 843

Query: 848 -FGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQ-SVKAVVEQNFSFRSGLHAASH 905
            FGF+++ +   II D +E + P     S+ +WI +P+ +++   ++  +    +H A H
Sbjct: 844 VFGFFKVDKYKRII-DAIETHNPPVIINSKGLWIDMPKYALEICQKKQLNVAGAIHGAQH 902

Query: 906 ALLHVVPIYVRCNFSDLAPECPNP-------HDSRYFPERILLYDRHPGGTG 950
           A++ ++P ++     ++  EC  P          R  P R++ YD   G  G
Sbjct: 903 AIMGMLPRFIVAGVDEIQTECKAPEKEFAERQTKRKRPARLIFYDSKGGKYG 954

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -

>sp\|P50830\|YPRA_BACSU Uncharacterized ATP-dependent helicase YprA OS=Bacillus subtilis (strain 168) GN=yprA PE=3 SV=1	Back alignment and function description

>sp\|O13983\|HRQ1_SCHPO Putative ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=3 SV=4	Back alignment and function description

>sp\|Q58969\|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1	Back alignment and function description

>sp\|Q57742\|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1	Back alignment and function description

>sp\|P95949\|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1	Back alignment and function description

>sp\|O27830\|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1	Back alignment and function description

>sp\|Q9VGI8\|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=mus309 PE=1 SV=1	Back alignment and function description

>sp\|O18017\|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2	Back alignment and function description

>sp\|P50729\|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		961
359491375		1231	PREDICTED: LOW QUALITY PROTEIN: putative	0.958	0.748	0.675	0.0
255547101		1189	dead box ATP-dependent RNA helicase, put	0.950	0.767	0.685	0.0
297734102		1188	unnamed protein product [Vitis vinifera]	0.907	0.734	0.690	0.0
449441117		1218	PREDICTED: LOW QUALITY PROTEIN: putative	0.951	0.750	0.640	0.0
334187508		1141	UBQ, helicase-c and DEAD-like helicase d	0.911	0.767	0.619	0.0
357116420		1015	PREDICTED: putative ATP-dependent helica	0.764	0.724	0.642	0.0
218199989		1049	hypothetical protein OsI_26803 [Oryza sa	0.778	0.713	0.619	0.0
222637423		1015	hypothetical protein OsJ_25054 [Oryza sa	0.744	0.704	0.593	0.0
414887527		873	TPA: hypothetical protein ZEAMMB73_11460	0.686	0.756	0.643	0.0
115443755		927	Os02g0111900 [Oryza sativa Japonica Grou	0.755	0.783	0.568	0.0

>gi\|359491375\|ref\|XP_002273025.2\| PREDICTED: LOW QUALITY PROTEIN: putative ATP-dependent helicase HRQ1-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1357 bits (3513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/982 (67%), Positives = 772/982 (78%), Gaps = 61/982 (6%)

Query: 3    KSRGDNSSCLCPVWLKKIVEAFAFVSIFSAHLQLRREKVILSHVKGALNQLEKFGVRVGI 62
            +S   +S CLCP WLKKI++ F F++IFSA LQL++  + L H+K  L+ L +FG +V +
Sbjct: 211  QSGSKSSLCLCPAWLKKIMKTFTFLNIFSAFLQLQQGHITLIHLKEGLDHLGEFGFQVDM 270

Query: 63   EDIENLAVLCPK-------------------------VVQFANDDMESKNHDDSIVIINV 97
            EDIE+L+VLCPK                         VV FA + M S+N  D++++IN 
Sbjct: 271  EDIEHLSVLCPKLVEICVYDDFLSGYVILISAWFCLKVVHFATNGMPSRNLGDNLIVINS 330

Query: 98   STEERDKVEDNLGSGQKAISLSKIFNAMKKRERSFKTNLWEAVNLLMCK-LQKRVMSLSV 156
            ST+ +D+VEDN  + QK + +SKI + MKK E  FKT+LW AV +LM K   +  M  S+
Sbjct: 331  STQHKDQVEDNSRTAQKQVPISKIVSVMKKLESCFKTHLWRAVKVLMRKNGNEMAMLFSL 390

Query: 157  EDLLTYVKERRTDVRGNEVKRARRSQSSTSSSHSFQRRCSDKSQLLPLEMVEHLRKGIGS 216
            EDLL  VKE        + K+ARRS S+ SS++S Q +C D + LLP+EMVEHLRKG+G 
Sbjct: 391  EDLLISVKEGG----AGKAKQARRSWSAVSSTNSAQSKCHDTNPLLPMEMVEHLRKGMGC 446

Query: 217  QGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVA 276
            QGQMVHVE+I AR A+ VEIPD L +NTKSAL+  G+++LYSHQAESI ASL GKNVVVA
Sbjct: 447  QGQMVHVEEICARMAIRVEIPDELSENTKSALEHIGVTRLYSHQAESIQASLGGKNVVVA 506

Query: 277  TMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVY 336
            TMTSSGKSLCYN+PVLE LS +L S ALY+FPTKALAQDQLRALLAMTK  D S+ +GVY
Sbjct: 507  TMTSSGKSLCYNVPVLEVLSQNLLSCALYLFPTKALAQDQLRALLAMTKGSDVSLKMGVY 566

Query: 337  DGDTTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIF 396
            DGDT+++DRMWLRDNARLLITNPDMLHMSILP+HGQF RILSNLR               
Sbjct: 567  DGDTSEEDRMWLRDNARLLITNPDMLHMSILPFHGQFRRILSNLR--------------- 611

Query: 397  LFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMEL 456
                FV+IDEAHAYKGAFGCHTA ILRRL RLC HVYGSDPSF+F TATSANPR+H MEL
Sbjct: 612  ----FVIIDEAHAYKGAFGCHTAFILRRLRRLCHHVYGSDPSFIFCTATSANPRDHAMEL 667

Query: 457  ANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSV--LNKSQTDMDDTRNAANKTSSPISEV 514
            ANL TLELI NDGSP   K F LWNP  C ++V   N     +           SPI E+
Sbjct: 668  ANLPTLELIHNDGSPSGPKFFALWNPALCSKTVGCFNICFXFL---------CCSPIWEI 718

Query: 515  SYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRR 574
            S LFAEM+QHGLRCIAFC+SRKLCELVLSYTREIL+ETAPHLVDSIC YRAGYVA+DRRR
Sbjct: 719  SCLFAEMIQHGLRCIAFCKSRKLCELVLSYTREILQETAPHLVDSICAYRAGYVAQDRRR 778

Query: 575  IERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAV 634
            IE DFF GKLCG+AATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLA+
Sbjct: 779  IESDFFSGKLCGIAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAI 838

Query: 635  YVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFG 694
            YVAFEGPLDQYFMK+P+KLF+ PIECCH+DAQN +VLEQHLVCAALEHPLSL+YDEKYFG
Sbjct: 839  YVAFEGPLDQYFMKFPQKLFRRPIECCHVDAQNQQVLEQHLVCAALEHPLSLLYDEKYFG 898

Query: 695  SGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSN 754
            SGL+S IT+L NRGYLS DPS  SS++I+ YIGH K+PSH +SIRAIE+E+Y+VID   +
Sbjct: 899  SGLNSAITSLTNRGYLSFDPSRGSSSRIWNYIGHAKIPSHAVSIRAIETEKYKVIDKGRD 958

Query: 755  EVLEEIEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIH 814
            E+LEEIEESKAFFQVY+GAVYMHQG TYLVKEL++S K+ALCQ+ADLKY+TKTRDYTDIH
Sbjct: 959  ELLEEIEESKAFFQVYDGAVYMHQGKTYLVKELDISRKLALCQQADLKYYTKTRDYTDIH 1018

Query: 815  VSGGNNAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYE 874
            V GG  AY  +IS+ Q  +TTAQ   C VTTTWFGF R+W+GS  +FDTVEL LP YSY+
Sbjct: 1019 VIGGEIAYQARISRIQFARTTAQVHDCRVTTTWFGFRRIWKGSNKVFDTVELSLPTYSYQ 1078

Query: 875  SQAVWIQVPQSVKAVVE-QNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSR 933
            SQAVW++VPQSVK  VE   FSFR+GLHAASHA+L+VVP+YV CN SDLAPEC NPHD+R
Sbjct: 1079 SQAVWVRVPQSVKTAVEIHRFSFRAGLHAASHAVLNVVPLYVICNSSDLAPECSNPHDTR 1138

Query: 934  YFPERILLYDRHPGGTGVSKQV 955
            Y PERILLYD HPGGTG S QV
Sbjct: 1139 YIPERILLYDPHPGGTGFSAQV 1160

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255547101\|ref\|XP_002514608.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223546212\|gb\|EEF47714.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297734102\|emb\|CBI15349.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449441117\|ref\|XP_004138330.1\| PREDICTED: LOW QUALITY PROTEIN: putative ATP-dependent helicase HRQ1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334187508\|ref\|NP_196428.2\| UBQ, helicase-c and DEAD-like helicase domain-containing protein [Arabidopsis thaliana] gi\|332003865\|gb\|AED91248.1\| UBQ, helicase-c and DEAD-like helicase domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357116420\|ref\|XP_003559979.1\| PREDICTED: putative ATP-dependent helicase HRQ1-like [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|218199989\|gb\|EEC82416.1\| hypothetical protein OsI_26803 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|222637423\|gb\|EEE67555.1\| hypothetical protein OsJ_25054 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|414887527\|tpg\|DAA63541.1\| TPA: hypothetical protein ZEAMMB73_114601 [Zea mays]	Back alignment and taxonomy information

>gi|115443755|ref|NP_001045657.1| Os02g0111900 [Oryza sativa Japonica Group] gi|41052756|dbj|BAD07625.1| putative ATP-dependent RNA helicase [Oryza sativa Japonica Group] gi|41052938|dbj|BAD07849.1| putative ATP-dependent RNA helicase [Oryza sativa Japonica Group] gi|113535188|dbj|BAF07571.1| Os02g0111900 [Oryza sativa Japonica Group] gi|125580539|gb|EAZ21470.1| hypothetical protein OsJ_05077 [Oryza sativa Japonica Group]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		961
ASPGD\|ASPL0000001605		1210	AN10757 [Emericella nidulans (	0.545	0.433	0.357	1.3e-116
TIGR_CMR\|DET_0967		764	DET_0967 "ATP-dependent RNA he	0.518	0.651	0.368	2e-115
SGD\|S000002699		1077	HRQ1 "3'-5'DNA helicase that h	0.566	0.505	0.322	7.4e-103
POMBASE\|SPAC23A1.19c		1063	hrq1 "RecQ type DNA helicase H	0.546	0.493	0.316	3.1e-102
CGD\|CAL0003767		1123	orf19.7213 [Candida albicans (	0.670	0.573	0.338	2.5e-88
UNIPROTKB\|Q59ZX8		1123	CaO19.7213 "Putative uncharact	0.670	0.573	0.338	2.5e-88
UNIPROTKB\|O06359		771	Rv3649 "PROBABLE HELICASE" [My	0.413	0.514	0.353	3.8e-84
DICTYBASE\|DDB_G0268288		1263	DDB_G0268288 "Putative ATP-dep	0.601	0.457	0.251	1.3e-28
UNIPROTKB\|A5D786		1218	RECQL4 "RECQL4 protein" [Bos t	0.162	0.128	0.294	1.6e-10
UNIPROTKB\|Q81QF0		450	BAS2301 "ATP-dependent RNA hel	0.192	0.411	0.25	6.4e-09

ASPGD\|ASPL0000001605 AN10757 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

 Score = 848 (303.6 bits), Expect = 1.3e-116, Sum P(3) = 1.3e-116
 Identities = 207/579 (35%), Positives = 313/579 (54%)

Query:   376 ILSNLRLIAFSLVTTEV-YLIFLF-IRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVY 433
             I +N  ++  +++  E  +  FL  ++FVV+DE H Y G FG H ALI+RRL R+C+ V 
Sbjct:   501 IFTNPDMLHITILPQESSWRTFLQNLKFVVVDELHVYNGLFGSHVALIMRRLRRICAAVG 560

Query:   434 GSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKS 493
                  F+  +AT ANP EH   +  +  ++LI  DGSPC +K F+ WN            
Sbjct:   561 NRHVRFISCSATVANPEEHMRAIFGVDDVQLIDFDGSPCGRKEFLCWN------------ 608

Query:   494 QTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTR-EILEET 552
              T   D  +  +     ++E + LF +++  G R IAFCR RKLCE++L   R E     
Sbjct:   609 -TPFKDPGDPTSGRGDSVAEAARLFCQLILRGARVIAFCRIRKLCEVLLQAVRSECNRLE 667

Query:   553 APHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPG 612
              P + + I  YR GY  +DRRRIE + F G+L G+ ATNALELG+D+G +D  + LGFP 
Sbjct:   668 RPEVGNMIMGYRGGYSPQDRRRIEAEMFQGQLLGIVATNALELGVDIGSLDAVITLGFPY 727

Query:   613 SIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIEC-CHIDAQNHKVL 671
             SI++L QQ+GR+GRR + SL++ +    P DQ++M+ PE+LF  P  C   +D  N  VL
Sbjct:   728 SISNLRQQSGRAGRRNKDSLSILIGERYPTDQFYMRNPEELFSKP-NCELQVDLTNELVL 786

Query:   672 EQHLVCAALEHPLSLIYDEKYFGSGLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKM 731
             E H+ CAA E P+    D+ YFG  LS   +T            L   A  F Y  HE+ 
Sbjct:   787 EGHVQCAAFELPIKPDDDQIYFGPQLSEFAST-----------RLVRDAMGF-YHCHERF 834

Query:   732 ---PSHTISIRAIESERYEVIDMQS--NEVLEEIEESKAFFQVYEGAVYMHQGHTYLVKE 786
                PS  + IR  E + + VID  +  N VLEE+E S+AFF +YEG +++HQG TYLVKE
Sbjct:   835 RPQPSRCVPIRDTEDQHFAVIDTTNARNVVLEEVEASRAFFTLYEGGIFLHQGQTYLVKE 894

Query:   787 LNLSSKIALCQKADLKYFTKTRDYTDI------H---VSGGNNAYATKISKDQLTKTTAQ 837
             LN     A      + + T  RD+TDI      H   ++  +   ATKI+    T++  +
Sbjct:   895 LNPDRFFARVVCVTVDWNTMQRDFTDIDPVETEHMRLITSSSPTKATKITDSSSTRSLER 954

Query:   838 ALACTVTTTW---------FGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKA 888
                  +   +         +GF+++ +  G + D V +  P  +  ++ +W+ VP+    
Sbjct:   955 EKERAIRAFFGPIRIHAIVYGFFKIDK-RGRVLDAVAVDNPPITIMTKGMWLDVPKVALD 1013

Query:   889 VVE-QNFSFRSGLHAASHALLHVVPIYVRCNFSDLAPEC 926
             ++E +  +  + +HAA HA+L ++P +V  +  D+  EC
Sbjct:  1014 ILESRRLNIAAAIHAAEHAILSLLPSFVISSPGDVRTEC 1052

GO:0035861 "site of double-strand break" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0000405 "bubble DNA binding" evidence=IEA

GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0000733 "DNA strand renaturation" evidence=IEA

GO:1901255 "nucleotide-excision repair involved in interstrand cross-link repair" evidence=IEA

GO:0032508 "DNA duplex unwinding" evidence=IEA

GO:0070914 "UV-damage excision repair" evidence=IEA

TIGR_CMR\|DET_0967 DET_0967 "ATP-dependent RNA helicase, DEAD/DEAH box family" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

SGD\|S000002699 HRQ1 "3'-5'DNA helicase that has DNA strand annealing activity" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

POMBASE\|SPAC23A1.19c hrq1 "RecQ type DNA helicase Hrq1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

CGD\|CAL0003767 orf19.7213 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q59ZX8 CaO19.7213 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

UNIPROTKB\|O06359 Rv3649 "PROBABLE HELICASE" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0268288 DDB_G0268288 "Putative ATP-dependent helicase HRQ1" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|A5D786 RECQL4 "RECQL4 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q81QF0 BAS2301 "ATP-dependent RNA helicase, DEAD/DEAH box family" [Bacillus anthracis (taxid:1392)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00017542001	SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (984 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		961
TIGR03817		742	TIGR03817, DECH_helic, helicase/secretion neighbor	1e-179
COG1205		851	COG1205, COG1205, Distinct helicase family with a	1e-167
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	2e-33
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	6e-24
TIGR04121		803	TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA	1e-22
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	7e-20
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	4e-19
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	2e-14
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	6e-13
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	1e-12
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	7e-12
TIGR00614		470	TIGR00614, recQ_fam, ATP-dependent DNA helicase, R	2e-11
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	2e-10
pfam09369		82	pfam09369, DUF1998, Domain of unknown function (DU	1e-08
PRK00254		720	PRK00254, PRK00254, ski2-like helicase; Provisiona	3e-08
cd00268		203	cd00268, DEADc, DEAD-box helicases	4e-08
PRK02362		737	PRK02362, PRK02362, ski2-like helicase; Provisiona	5e-08
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	2e-07
PRK13767		876	PRK13767, PRK13767, ATP-dependent helicase; Provis	3e-07
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	5e-07
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	5e-07
PRK01172		674	PRK01172, PRK01172, ski2-like helicase; Provisiona	3e-06
PRK13767		876	PRK13767, PRK13767, ATP-dependent helicase; Provis	6e-06
TIGR03158		357	TIGR03158, cas3_cyano, CRISPR-associated helicase	1e-05
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	2e-05
TIGR01587		358	TIGR01587, cas3_core, CRISPR-associated helicase C	9e-05
PRK11057		607	PRK11057, PRK11057, ATP-dependent DNA helicase Rec	1e-04
cd09710		353	cd09710, Cas3_I-D, CRISPR/Cas system-associated pr	2e-04
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	0.001
COG4581		1041	COG4581, COG4581, Superfamily II RNA helicase [DNA	0.001
PRK11057		607	PRK11057, PRK11057, ATP-dependent DNA helicase Rec	0.003
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	0.004
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	0.004
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	0.004

>gnl\|CDD\|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

 Score =  537 bits (1386), Expect = e-179
 Identities = 267/734 (36%), Positives = 380/734 (51%), Gaps = 56/734 (7%)

Query: 220 MVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMT 279
           + HVE + AR       P     +  +AL++ GI + + HQA +   + AG++VVVAT T
Sbjct: 1   LTHVEHLPARAGRTAPWPAWAHPDVVAALEAAGIHRPWQHQARAAELAHAGRHVVVATGT 60

Query: 280 SSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGD 339
           +SGKSL Y LPVL AL+ D  ++ALY+ PTKALA DQLRA+  +T      +    YDGD
Sbjct: 61  ASGKSLAYQLPVLSALADDPRATALYLAPTKALAADQLRAVRELTLR---GVRPATYDGD 117

Query: 340 TTQKDRMWLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFI 399
           T  ++R W R++AR ++TNPDMLH  ILP H +++R L  LR                  
Sbjct: 118 TPTEERRWAREHARYVLTNPDMLHRGILPSHARWARFLRRLR------------------ 159

Query: 400 RFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANL 459
            +VVIDE H+Y+G FG H AL+LRRL RLC+  YG+ P FV ++AT+A+P      L   
Sbjct: 160 -YVVIDECHSYRGVFGSHVALVLRRLRRLCAR-YGASPVFVLASATTADPAAAASRLIGA 217

Query: 460 STLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFA 519
             +  +  DGSP   +   LW P            T++    N A    S  +E + L A
Sbjct: 218 -PVVAVTEDGSPRGARTVALWEP----------PLTELTGE-NGAPVRRSASAEAADLLA 265

Query: 520 EMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDF 579
           ++V  G R + F RSR+  ELV +  R +L E  P L + +  YRAGY+ EDRR +ER  
Sbjct: 266 DLVAEGARTLTFVRSRRGAELVAAIARRLLGEVDPDLAERVAAYRAGYLPEDRRELERAL 325

Query: 580 FGGKLCGVAATNALELGIDVGHIDVTLHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFE 639
             G+L GVA TNALELG+D+  +D  +  GFPG+ ASLWQQAGR+GRR + +L V VA +
Sbjct: 326 RDGELLGVATTNALELGVDISGLDAVVIAGFPGTRASLWQQAGRAGRRGQGALVVLVARD 385

Query: 640 GPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLSLIYDEKYFGSGLSS 699
            PLD Y + +PE LF  P+E    D  N  VL  HL CAA E PL+   D + FG   + 
Sbjct: 386 DPLDTYLVHHPEALFDRPVEATVFDPDNPYVLGPHLCCAAAELPLTEA-DLELFGPAAAE 444

Query: 700 GITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSNEVLEE 759
            +  L  +G L   P+         +    +     + IR        +++ ++  +L  
Sbjct: 445 VLDQLVEQGLLRRRPA-------GWFWTRRERAHDAVDIRGGGGAPVAIVEAETGRLLGT 497

Query: 760 IEESKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGN 819
           ++   A   V+ GAVY+HQG +Y+V EL+L   +AL    D  Y T  R+ TDI V    
Sbjct: 498 VDAGAAHSTVHPGAVYLHQGESYVVDELDLEDGVALVHAEDPDYTTFARETTDISVVE-- 555

Query: 820 NAYATKISKDQLTKTTAQALACTVTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVW 879
                +  +       A      VT+   G+ R    +G + D V L LP  +  ++AVW
Sbjct: 556 ----ERRRRAWGDVRVALGEVE-VTSQVVGYLRRRLITGEVLDEVPLDLPPRTLRTRAVW 610

Query: 880 IQVPQSVKAVVEQNFSFRS---GLHAASHALLHVVPIYVRCNFSDLAPECPNPHDSRYFP 936
             V    + + +           LHAA HA + ++P+   C+  D+       H     P
Sbjct: 611 YTVTP--ELLDDAGIDAADVPGALHAAEHAAIGLLPLVATCDRWDIGGVSTAVHPDTGLP 668

Query: 937 ERILLYDRHPGGTG 950
             + +YD HPGG G
Sbjct: 669 T-VFVYDGHPGGAG 681

A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA. Length = 742

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|220208 pfam09369, DUF1998, Domain of unknown function (DUF1998)	Back alignment and domain information

>gnl\|CDD\|234702 PRK00254, PRK00254, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|235032 PRK02362, PRK02362, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

>gnl\|CDD\|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|100801 PRK01172, PRK01172, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|234127 TIGR03158, cas3_cyano, CRISPR-associated helicase Cas3, subtype CYANO	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3	Back alignment and domain information

>gnl\|CDD\|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>gnl\|CDD\|187841 cd09710, Cas3_I-D, CRISPR/Cas system-associated protein Cas3; Distinct diverged subfamily of Cas3 helicase domain	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		961
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
COG1205		851	Distinct helicase family with a unique C-terminal	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
PTZ00110		545	helicase; Provisional	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG4284		980	consensus DEAD box protein [Transcription]	100.0
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	100.0
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	100.0
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
KOG0353		695	consensus ATP-dependent DNA helicase [General func	100.0
PHA02558		501	uvsW UvsW helicase; Provisional	100.0
PRK14701		1638	reverse gyrase; Provisional	100.0
PRK13766		773	Hef nuclease; Provisional	100.0
KOG0354		746	consensus DEAD-box like helicase [General function	100.0
PRK09401		1176	reverse gyrase; Reviewed	99.97
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.97
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.97
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.97
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.97
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.97
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.97
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.97
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.97
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.97
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.97
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.97
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.97
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.97
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.96
PRK09694		878	helicase Cas3; Provisional	99.96
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.96
PRK05580		679	primosome assembly protein PriA; Validated	99.96
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.95
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.94
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.94
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.94
PRK04914		956	ATP-dependent helicase HepA; Validated	99.93
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.93
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.93
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.92
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.91
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.91
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.91
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.9
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.9
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.9
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.89
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.89
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.88
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.87
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.86
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.85
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.85
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.85
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.85
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.84
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.83
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.81
PRK05298		652	excinuclease ABC subunit B; Provisional	99.8
COG4096		875	HsdR Type I site-specific restriction-modification	99.76
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.76
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.76
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.75
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.74
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.74
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.74
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.73
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.7
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.69
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.68
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.66
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.65
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.65
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.65
KOG1123		776	consensus RNA polymerase II transcription initiati	99.63
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.6
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.6
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.54
COG4889		1518	Predicted helicase [General function prediction on	99.54
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.53
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	99.53
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.5
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	99.49
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	99.49
KOG0387		923	consensus Transcription-coupled repair protein CSB	99.47
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.45
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.44
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	99.41
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	99.38
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	99.36
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.36
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.35
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	99.27
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	99.25
PRK14873		665	primosome assembly protein PriA; Provisional	99.24
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	99.16
cd08674		185	Cdt1_m The middle winged helix fold of replication	99.16
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	99.15
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	99.06
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	98.99
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.92
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.88
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	98.83
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	98.83
PF08839		163	CDT1: DNA replication factor CDT1 like; InterPro:	98.76
KOG1002		791	consensus Nucleotide excision repair protein RAD16	98.73
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	98.73
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	98.71
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.68
KOG4439		901	consensus RNA polymerase II transcription terminat	98.67
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	98.66
COG0610		962	Type I site-specific restriction-modification syst	98.65
PF09369		84	DUF1998: Domain of unknown function (DUF1998); Int	98.63
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	98.57
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	98.52
PRK15483		986	type III restriction-modification system StyLTI en	98.49
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.49
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	98.23
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.01
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	97.98
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.97
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	97.82
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	97.69
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.66
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.57
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.5
KOG2340		698	consensus Uncharacterized conserved protein [Funct	97.44
PRK10536		262	hypothetical protein; Provisional	97.41
PF13245		76	AAA_19: Part of AAA domain	97.38
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.12
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	97.06
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	97.06
KOG1016		1387	consensus Predicted DNA helicase, DEAD-box superfa	96.84
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	96.71
COG3587		985	Restriction endonuclease [Defense mechanisms]	96.61
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.43
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.34
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	96.13
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	96.1
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	96.09
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	95.98
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	95.81
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	95.75
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	95.53
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	95.5
PRK13889		988	conjugal transfer relaxase TraA; Provisional	95.47
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	95.43
TIGR00376		637	DNA helicase, putative. The gene product may repre	95.31
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	95.28
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	95.24
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	95.21
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	95.09
PHA02533		534	17 large terminase protein; Provisional	94.83
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	94.76
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	94.75
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.69
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	94.67
PRK11054		684	helD DNA helicase IV; Provisional	94.6
KOG1803		649	consensus DNA helicase [Replication, recombination	94.46
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	94.38
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	94.33
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	94.3
KOG1805		1100	consensus DNA replication helicase [Replication, r	94.25
TIGR00595		505	priA primosomal protein N'. All proteins in this f	94.14
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	94.06
PRK08181		269	transposase; Validated	93.96
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	93.96
PRK00149		450	dnaA chromosomal replication initiation protein; R	93.93
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	93.87
PRK14873		665	primosome assembly protein PriA; Provisional	93.84
PRK05580		679	primosome assembly protein PriA; Validated	93.84
PRK13826		1102	Dtr system oriT relaxase; Provisional	93.71
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	93.59
smart00382		148	AAA ATPases associated with a variety of cellular	93.58
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	93.57
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	93.52
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	93.18
PRK06526		254	transposase; Provisional	93.07
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	93.02
PF13871		278	Helicase_C_4: Helicase_C-like	92.97
PRK07952		244	DNA replication protein DnaC; Validated	92.95
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	92.78
COG2256		436	MGS1 ATPase related to the helicase subunit of the	92.73
PRK08903		227	DnaA regulatory inactivator Hda; Validated	92.66
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	92.64
PRK08084		235	DNA replication initiation factor; Provisional	92.56
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	92.41
PRK08727		233	hypothetical protein; Validated	92.39
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	92.26
PRK05707		328	DNA polymerase III subunit delta'; Validated	92.26
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	92.14
PRK14087		450	dnaA chromosomal replication initiation protein; P	92.13
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	92.12
PRK08006		471	replicative DNA helicase; Provisional	92.03
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	92.0
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	91.95
PRK06904		472	replicative DNA helicase; Validated	91.94
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	91.93
PRK13833		323	conjugal transfer protein TrbB; Provisional	91.93
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	91.86
PRK06921		266	hypothetical protein; Provisional	91.85
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	91.81
KOG0298		1394	consensus DEAD box-containing helicase-like transc	91.54
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	91.49
PRK14088		440	dnaA chromosomal replication initiation protein; P	91.45
PRK08769		319	DNA polymerase III subunit delta'; Validated	91.32
PRK05973		237	replicative DNA helicase; Provisional	91.17
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	91.15
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	91.03
PLN03025		319	replication factor C subunit; Provisional	90.89
PRK14086		617	dnaA chromosomal replication initiation protein; P	90.8
COG1198		730	PriA Primosomal protein N' (replication factor Y)	90.8
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	90.79
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	90.61
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	90.61
KOG0701		1606	consensus dsRNA-specific nuclease Dicer and relate	90.39
PRK10689		1147	transcription-repair coupling factor; Provisional	90.33
PRK06893		229	DNA replication initiation factor; Validated	90.32
PRK12377		248	putative replication protein; Provisional	90.16
PRK05642		234	DNA replication initiation factor; Validated	90.02
COG3972		660	Superfamily I DNA and RNA helicases [General funct	89.89
PRK11823		446	DNA repair protein RadA; Provisional	89.87
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	89.86
PHA03368		738	DNA packaging terminase subunit 1; Provisional	89.45
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	89.37
PRK08116		268	hypothetical protein; Validated	89.35
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	89.33
PF00004		132	AAA: ATPase family associated with various cellula	89.32
PTZ00112		1164	origin recognition complex 1 protein; Provisional	89.24
PRK00411		394	cdc6 cell division control protein 6; Reviewed	89.18
PRK14974		336	cell division protein FtsY; Provisional	89.04
PRK05595		444	replicative DNA helicase; Provisional	88.95
PRK08840		464	replicative DNA helicase; Provisional	88.66
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	88.55
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	88.45
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	88.39
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	88.26
COG3973		747	Superfamily I DNA and RNA helicases [General funct	88.22
PRK06964		342	DNA polymerase III subunit delta'; Validated	88.13
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	88.04
PRK12422		445	chromosomal replication initiation protein; Provis	87.93
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	87.85
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	87.81
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	87.67
COG0593		408	DnaA ATPase involved in DNA replication initiation	87.45
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	87.33
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	87.26
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	87.24
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	87.19
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	87.14
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	86.94
PRK08506		472	replicative DNA helicase; Provisional	86.91
PRK06321		472	replicative DNA helicase; Provisional	86.81
PRK10263		1355	DNA translocase FtsK; Provisional	86.75
PRK00771		437	signal recognition particle protein Srp54; Provisi	86.74
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	86.72
PRK05748		448	replicative DNA helicase; Provisional	86.71
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	86.71
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	86.66
PRK07004		460	replicative DNA helicase; Provisional	86.54
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	86.48
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	86.43
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	86.38
PRK06871		325	DNA polymerase III subunit delta'; Validated	86.32
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	86.14
PF13173		128	AAA_14: AAA domain	86.04
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	85.95
PRK06067		234	flagellar accessory protein FlaH; Validated	85.92
PRK09165		497	replicative DNA helicase; Provisional	85.89
PRK13851		344	type IV secretion system protein VirB11; Provision	85.87
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	85.83
TIGR00665		434	DnaB replicative DNA helicase. This model describe	85.79
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	85.75
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	85.7
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	85.7
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	85.64
KOG1001		674	consensus Helicase-like transcription factor HLTF/	85.58
PRK08699		325	DNA polymerase III subunit delta'; Validated	85.41
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	85.39
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	85.33
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	85.22
PRK04328		249	hypothetical protein; Provisional	85.2
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	85.14
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	85.13
PHA03333		752	putative ATPase subunit of terminase; Provisional	85.03
PRK13341		725	recombination factor protein RarA/unknown domain f	84.76
PRK08760		476	replicative DNA helicase; Provisional	84.75
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	84.71
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	84.7
PRK13342		413	recombination factor protein RarA; Reviewed	84.67
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	84.66
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	84.45
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	84.32
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	83.89
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	83.85
PRK05636		505	replicative DNA helicase; Provisional	83.69
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	83.59
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	83.57
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	83.46
PRK06090		319	DNA polymerase III subunit delta'; Validated	83.34
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	83.22
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	83.16
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	83.13
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	83.1
COG5008		375	PilU Tfp pilus assembly protein, ATPase PilU [Cell	83.05
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	82.91
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	82.51
PRK14701		1638	reverse gyrase; Provisional	82.27
PRK07993		334	DNA polymerase III subunit delta'; Validated	82.27
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	82.26
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	82.12
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	82.08
PRK07471		365	DNA polymerase III subunit delta'; Validated	82.08
PF12846		304	AAA_10: AAA-like domain	82.06
COG3598		402	RepA RecA-family ATPase [DNA replication, recombin	82.0
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	81.9
PRK09112		351	DNA polymerase III subunit delta'; Validated	81.82
PRK04195		482	replication factor C large subunit; Provisional	81.78
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	81.77
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	81.61
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	81.47
COG1484		254	DnaC DNA replication protein [DNA replication, rec	81.23
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	81.09
PRK07940		394	DNA polymerase III subunit delta'; Validated	80.99
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	80.63
PF05729		166	NACHT: NACHT domain	80.26
KOG2028		554	consensus ATPase related to the helicase subunit o	80.21
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	80.17
CHL00095		821	clpC Clp protease ATP binding subunit	80.05
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	80.02

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=8.3e-127  Score=1042.11  Aligned_cols=876  Identities=35%  Similarity=0.496  Sum_probs=749.3

Q ss_pred             CcHHHHHHHHHHHHHHHHHHHHhhcccee-chhhhHHHHHHhhhcCCccchhhhhhhhhhcCCceEEeecCccccCCC--
Q 002135           13 CPVWLKKIVEAFAFVSIFSAHLQLRREKV-ILSHVKGALNQLEKFGVRVGIEDIENLAVLCPKVVQFANDDMESKNHD--   89 (961)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--   89 (961)
                      =-..|....|+|+.+|+.|||+.||||+. ||+++..+++-.+  +|-++-+|+|.|.+++|+.+.|.|+|++++.++  
T Consensus        19 ~~~~~~~~~Q~~~~~~~~~~~~~~~~~~~P~~~s~~~~~~~~~--~~~~~~~~~A~i~~~~~~~~~~~~~~~~~~~~~~K   96 (1034)
T KOG4150|consen   19 SINGESTTVQVSSDGTIRDLKKALKSCFPPASSSSNFHLYIKG--EKLKLDTRVAAITINDGDILGLFPFKKKELRQTPK   96 (1034)
T ss_pred             cccccceeEEEEecccHHHHHHHHHhhCCCccccccceeeeec--hhhhhhhhhhhhhccCCCeEEEeecchhhhccCCC
Confidence            34578889999999999999999999999 6999999999554  789999999999999999999999999999877  


Q ss_pred             -------------CcEE-EEecccccc---c----ccccccCCCc------------cccCHHHHHHHHHHhhHhhhhhH
Q 002135           90 -------------DSIV-IINVSTEER---D----KVEDNLGSGQ------------KAISLSKIFNAMKKRERSFKTNL  136 (961)
Q Consensus        90 -------------~~~~-~~~~~~~~~---~----~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~  136 (961)
                                   |+|+ +.+...|..   +    .+++.+|.-+            +-...++|.+++++|+..+...+
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~~~~~~~~S~~~~~~K~~~TE~~~~~~~~R~~L~~~~~  176 (1034)
T KOG4150|consen   97 PDLSKPSSLSSRTSTMKDENAKRAEDHCVGEKRKRDEEACPYGFFNDDLESECKDAFKGQNTEKLAEVLKSRNCLTSPGS  176 (1034)
T ss_pred             ccccCCcccccccchhhhhhcchhhhhhhhhhhhhhHhhCCcccccchhhhHHHHhhccccHHHHHHHHhhhhhhcCCcc
Confidence                         3555 333332211   1    5666666311            22458999999999999998877


Q ss_pred             HHHHHHHHHHHhhhhcCcCHHHHHHHHh----hccCCCCc----hhhhhhhccCCCCCCCcccccccccccCCChHHHHH
Q 002135          137 WEAVNLLMCKLQKRVMSLSVEDLLTYVK----ERRTDVRG----NEVKRARRSQSSTSSSHSFQRRCSDKSQLLPLEMVE  208 (961)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  208 (961)
                      .    ++|-+....... +..|++..+.    ..+.+.++    ..+|.....+.-+..++       ..+-..-++|++
T Consensus       177 ~----~~~~~~~~s~~~-P~~E~~~~~~~~~~R~R~~~~~~~s~~~~K~~s~~~~~~NY~N-------~~VI~~~~~M~E  244 (1034)
T KOG4150|consen  177 T----KCLMSWDSSSSC-PDWESLSRLAMSGVRVRIQDVKNLSVICPKVITDDYEAVNYEN-------AIVIADYLEMDE  244 (1034)
T ss_pred             h----hheeecccccCC-ccHHHHHHHHhhcCceeecccchhhhhcccccccccccccccC-------ceeeechHhHhh
Confidence            6    444321222222 4445453332    22211111    23444444444333322       111222367776


Q ss_pred             HHHccCCCCCceEEeeecCCcccccccCCccccHHHHHHHHhCCCCCCcHHHHHHHHHHhCCCcEEEEecCCchhHHHHH
Q 002135          209 HLRKGIGSQGQMVHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYN  288 (961)
Q Consensus       209 ~lr~~~~~~~~iv~~~~~p~~~~~f~~l~~~L~~~l~~~L~~~g~~~l~~~Q~~ai~~il~G~~vIv~apTGSGKTla~~  288 (961)
                        ++...+..++-+...+|.|.++|..+.   -+.+.+.+.++..+..+.||.++++.+.+|+++++...|.+||++||+
T Consensus       245 --KS~~~~~~~~K~~~~~~~R~A~~K~~~---~E~~~~~~~~~~~E~~~~~~~~~~~~~~~G~~~~~~~~~~~GK~~~~~  319 (1034)
T KOG4150|consen  245 --KSGRKKIPLAKLFSAMKKREASFKSDF---WESIRSLLNKNTGESGIAISLELLKFASEGRADGGNEARQAGKGTCPT  319 (1034)
T ss_pred             --hcccccchHHHHHhhccchhhhhhhhH---HHHHHHHHhcccccchhhhhHHHHhhhhhcccccccchhhcCCccCcc
Confidence              445556677888889999999998763   344445566777789999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCeEEEEcccHHHHHHHHHHHHHhHhhCC--CCccEEEEcCCCcHHHHHHHhcCCcEEEeChhHHHHhh
Q 002135          289 LPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFD--ASIDIGVYDGDTTQKDRMWLRDNARLLITNPDMLHMSI  366 (961)
Q Consensus       289 Lpil~~l~~~~~~~aLvl~PtraLa~qq~~~l~~l~~~~~--~~i~v~~~~Gd~~~~~r~~l~~~~~IlItTPe~L~~~l  366 (961)
                      +.+...+...+....++++|++++++++.+.+.-....+.  ....|..++|++...++..++.+.++++++|++.+..+
T Consensus       320 ~~s~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~V~~~~I~~~K~A~V~~~D~~sE~~~~A~~R~~~~~~~s~~~~~~s~~  399 (1034)
T KOG4150|consen  320 SGSRKFQTLCHATNSLLPSEMVEHLRNGSKGQVVHVEVIKARKSAYVEMSDKLSETTKSALKRIGLNTLYSHQAEAISAA  399 (1034)
T ss_pred             cchhhhhhcCcccceecchhHHHHhhccCCceEEEEEehhhhhcceeecccCCCchhHHHHHhcCcceeecCHHHHHHHH
Confidence            9999988888888999999999999998766533222221  13458899999999999999999999999999999999


Q ss_pred             cCCCchhHHHhhhhhhhhhhcchhhhhhhhcceeEEEEecchhhhcccchHHHHHHHHHHHHhhcccC-CCCcEEEeccC
Q 002135          367 LPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLCRLCSHVYG-SDPSFVFSTAT  445 (961)
Q Consensus       367 L~~~~~~~~~L~~l~~~~~~~~~~~~~~~~~~i~~VVIDEaH~~~~~fg~~~~~ilrrL~~~~~~~~~-~~~q~I~lSAT  445 (961)
                      |+++..|+.++-.+                   .++++||+|.|.+.||++++..||+|.++|..++. .+.|++-+|||
T Consensus       400 L~~~~~~~~~~~~~-------------------~~~~~~~~~~Y~~~~~~~~~~~~R~L~~L~~~F~~~~~~~~~~~~~~  460 (1034)
T KOG4150|consen  400 LAKSLCYNVPVFEE-------------------LCKDTNSCALYLFPTKALAQDQLRALSDLIKGFEASINMGVYDGDTP  460 (1034)
T ss_pred             hhhccccccHHHHH-------------------HHhcccceeeeecchhhHHHHHHHHHHHHHHHHHhhcCcceEeCCCC
Confidence            99999999999888                   89999999999999999999999999999876553 46799999999


Q ss_pred             CCChHHHHHHHcccCCeEEEecCCCccceeEEEEeCCCccccccccccccccchhhhcccCCCCcHHHHHHHHHHHHHCC
Q 002135          446 SANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHG  525 (961)
Q Consensus       446 l~n~~e~~~~L~~~~~~~~i~~~g~p~~~~~~~l~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~l~~~g  525 (961)
                      ..+|..+.+.+++...+.+|..||+|.+.+.+++|||+.....               ...++++..+...++.+++.+|
T Consensus       461 ~K~~~~~~~~~~~~~E~~Li~~DGSPs~~K~~V~WNP~~~P~~---------------~~~~~~~i~E~s~~~~~~i~~~  525 (1034)
T KOG4150|consen  461 YKDRTRLRSELANLSELELVTIDGSPSSEKLFVLWNPSAPPTS---------------KSEKSSKVVEVSHLFAEMVQHG  525 (1034)
T ss_pred             cCCHHHHHHHhcCCcceEEEEecCCCCccceEEEeCCCCCCcc---------------hhhhhhHHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999999999999999876322               2346678889999999999999


Q ss_pred             CcEEEEecChHHHHHHHHHHHHHHHhhCCcccccEEEEcCCCCHHHHHHHHHHHhCCCceEEEeccccccccccCCccEE
Q 002135          526 LRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVT  605 (961)
Q Consensus       526 ~k~IVF~~sr~~ae~l~~~L~~~l~~~~~~l~~~v~~~hggls~~eR~~ie~~f~~G~~~vLVAT~aLe~GIDIp~vd~V  605 (961)
                      .++|.||.+|+.||.+....++.+.+..+++...++.|+||++.++|++|+++++.|++..+||||+||+||||+++|+|
T Consensus       526 ~R~IAFC~~R~~CEL~~~~~R~I~~ET~~~LV~~i~SYRGGY~A~DRRKIE~~~F~G~L~giIaTNALELGIDIG~LDAV  605 (1034)
T KOG4150|consen  526 LRCIAFCPSRKLCELVLCLTREILAETAPHLVEAITSYRGGYIAEDRRKIESDLFGGKLCGIIATNALELGIDIGHLDAV  605 (1034)
T ss_pred             CcEEEeccHHHHHHHHHHHHHHHHHHhhHHHHHHHHhhcCccchhhHHHHHHHhhCCeeeEEEecchhhhccccccceeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCCHhhHHHHhccCCCCCCCceEEEEeeCCcchhHHHhchHHhhcCCCcccccCCCCHHHHHHHHHHHHhcCCCC
Q 002135          606 LHLGFPGSIASLWQQAGRSGRRERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHLVCAALEHPLS  685 (961)
Q Consensus       606 I~~~~P~s~~sy~QR~GRAGR~g~~g~~i~l~~~~~~d~~~~~~~e~l~~~~ie~~~~~~~n~~vl~~~l~~aa~e~p~~  685 (961)
                      ++.|+|.|+++++|+.|||||++++++++++++..|.||+|+.||+.++..|.+++.+|..|..+|.+|++|||.|+|++
T Consensus       606 l~~GFP~S~aNl~QQ~GRAGRRNk~SLavyva~~~PVDQ~Y~~HP~~l~~~pN~EL~LD~~N~~iL~~HlQCAA~ELPIN  685 (1034)
T KOG4150|consen  606 LHLGFPGSIANLWQQAGRAGRRNKPSLAVYVAFLGPVDQYYMSHPDKLFGSPNEELHLDSQNKHVLMQHLQCAALELPIN  685 (1034)
T ss_pred             EEccCchhHHHHHHHhccccccCCCceEEEEEeccchhhHhhcCcHHHhCCCcceeEEecccHHHHHHHHhHHhhcCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhccC-CHHHHHHHHHHCCccccCCCCCcccchhhhccCCCCCCccccccccCCCceEEEeccCC--ceeeeccc
Q 002135          686 LIYDEKYFGS-GLSSGITTLKNRGYLSSDPSLDSSAKIFEYIGHEKMPSHTISIRAIESERYEVIDMQSN--EVLEEIEE  762 (961)
Q Consensus       686 ~~~~~~~f~~-~~~~~l~~L~~~g~l~~~~~~~~~~~~~~~~~~~~~p~~~v~lr~~~~~~~~v~d~~~~--~~i~~~~~  762 (961)
                      +.+|+++|++ .+.+++..-     |....+.+  .+.|.|.   ++|+..|+||+++++.|.+||.+++  .+||++++
T Consensus       686 ~~~D~q~Fg~~~lr~IC~~~-----L~~~~dsY--~~~~~yL---P~P~~~VriRs~~ED~F~~VDvTN~kN~IlEeiE~  755 (1034)
T KOG4150|consen  686 LQYDQQHFGSGELRNICFLS-----LDPSRDSY--SRIWNYL---PRPKNPVRIRSIREDEFVRVDVTNKKNDILEEIEE  755 (1034)
T ss_pred             cchhhhhcccHHHHhhHHhh-----cCcccccc--ccccccC---CCCCCceEeeeeccceEEEEEecCCchhHHHHHhh
Confidence            9999999997 677766542     22222222  3456664   5899999999999999999999864  57899999


Q ss_pred             chhhhhhccCcEEEEcCeEEEEEEEecCCCeEEEEEcCCCcccccCCceeeEEecccccccccccccccccceeEeEEEE
Q 002135          763 SKAFFQVYEGAVYMHQGHTYLVKELNLSSKIALCQKADLKYFTKTRDYTDIHVSGGNNAYATKISKDQLTKTTAQALACT  842 (961)
Q Consensus       763 ~~a~~~~~~gai~~~~g~~y~v~~~d~~~~~~~v~~~~~~~~T~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  842 (961)
                      +|+++++|+||||+|||++|+|+++|+++|+|.++++||+|||.+||+|||++.+.+..++...     +++++|||.|+
T Consensus       756 sR~~fT~YeGaiy~~QG~~ylv~~lNi~eR~a~~~~VDVdW~T~QRDFTDVDP~~~~~~~~~~~-----S~~~~YFGa~K  830 (1034)
T KOG4150|consen  756 SRAFFTVYEGAIYMNQGRNYLVTSLNIKERVALCELVDVDWYTRQRDFTDVDPTGGDTAYPVKA-----SKPTPYFGACK  830 (1034)
T ss_pred             hhheeEeecccEEEecCcceeeeecCchhheeeeEEecceeeeccccccccCCcccceeeeccC-----CCCCcceeeeE
Confidence            9999999999999999999999999999999999999999999999999999999887765532     37899999999


Q ss_pred             EEEEEEEEEEEEcCCCceEeEEeCCCCcceeeeEEEEEEeChhhHHhhh-ccCChhhHHHHHHHHHHhhcccccccCCCC
Q 002135          843 VTTTWFGFYRLWRGSGIIFDTVELYLPKYSYESQAVWIQVPQSVKAVVE-QNFSFRSGLHAASHALLHVVPIYVRCNFSD  921 (961)
Q Consensus       843 v~~~v~g~~~~~~~~~~~~~~~~~~~p~~~~~t~~~w~~~~~~~~~~~~-~~~~~~~~~ha~~ha~~~~~p~~~~~~~~d  921 (961)
                      +|..||||+|++++ .+++|.+++.+||++++++|+|||+|..+++.++ ++++++|+||||+|||++++|.|+.|+-+|
T Consensus       831 ~T~~VFGfFKV~K~-K~IiD~ve~~~pPV~I~S~G~WIDvP~~~~E~~~~K~lN~Aa~IHaAQHAl~~~~P~FI~~~~~d  909 (1034)
T KOG4150|consen  831 VTTKVFGFFKVRKR-KEIIDDVELSLPPVTIQSQGVWIDVPMSVKEAVETKNLNFAAGIHAAQHALVNVVPTFITCNYSD  909 (1034)
T ss_pred             EEEEEEEEEEEech-hhhhhhhhccCCCEEEecceEEEeCcHHHHHHHhhcCCCchhhhHHHHHHHHhhcceEEecCchh
Confidence            99999999999987 8999999999999999999999999999999999 999999999999999999999999999999


Q ss_pred             CCccCCCC-------CCCCCCCcEEEEEcCCCC--cchhhhhhhh
Q 002135          922 LAPECPNP-------HDSRYFPERILLYDRHPG--GTGVSKQVTD  957 (961)
Q Consensus       922 i~~~~~~~-------~~~~~~~~~i~~yD~~~g--G~G~~~~~~~  957 (961)
                      |.|+|++|       +++|+||+|++|||...|  |+|++-|+|+
T Consensus       910 I~TECKApEKEfaErqt~R~RPaRLIFYD~~G~~~GaGLC~KAfE  954 (1034)
T KOG4150|consen  910 IATECKAPEKEFAERQTQRYRPARLIFYDPGGTGIGAGLCPKAFE  954 (1034)
T ss_pred             hcccCCCchHHHHHhhhhccCcceEEEEcCCCCcccccccHHHHH
Confidence            99999999       478999999999999977  8899999996

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>cd08674 Cdt1_m The middle winged helix fold of replication licensing factor Cdt1 binds geminin to inhibit binding of the MCM complex to origins of replication and DNA	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>PF08839 CDT1: DNA replication factor CDT1 like; InterPro: IPR014939 CDT1 is a component of the replication licensing system and promotes the loading of the mini-chromosome maintenance complex onto chromatin	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PF09369 DUF1998: Domain of unknown function (DUF1998); InterPro: IPR018973 This entry represents a family of DEAD/DEAH-box-containing family of helicases	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10263 DNA translocase FtsK; Provisional	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		961
2zj2_A		720	Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt		2e-06
1oyy_A		523	Structure Of The Recq Catalytic Core Bound To Atp-G		2e-04
2z0m_A		337	Crystal Structure Of Hypothetical Atp-Dependent Rna		4e-04
1oyw_A		523	Structure Of The Recq Catalytic Core Length = 523		5e-04

>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720

Back alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 105/454 (23%), Positives = 170/454 (37%), Gaps = 99/454 (21%) Query: 242 DNTKSALKSTGISKLYSHQAESIMAS-LAGKNVVVATMTSSGKSLCYNLPVLEALSHDL- 299 + KS LK GI Y QAE++ + L GKN +++ T+SGK+L + A+ H + Sbjct: 10 ERIKSTLKERGIESFYPPQAEALKSGILEGKNALISIPTASGKTLIAEI----AMVHRIL 65 Query: 300 --SSSALYMFPTKXXXXXXXXXXXXMTKAFDASIDIGVYDGDTTQKDRMWLRDNARLLIT 357 A+Y+ P K K + + + GD KD WL ++ T Sbjct: 66 TQGGKAVYIVPLKALAEEKFQEFQDWEK---IGLRVAMATGDYDSKDE-WLGKYDIIIAT 121 Query: 358 NPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCH 417 L HG S + ++++ LV E++LI +GA Sbjct: 122 AE---KFDSLLRHG--SSWIKDVKI----LVADEIHLI-----------GSRDRGA---- 157 Query: 418 TALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLF 477 L + +H+ G + +AT NP ELA ELI +D Sbjct: 158 ------TLEVILAHMLGK-AQIIGLSATIGNPE----ELAEWLNAELIVSD--------- 197 Query: 478 VLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSY----------LFAEMVQHGLR 527 W P R V + +D + ++ SS E+ Y +F M + R Sbjct: 198 --WRPVKLRRGVFYQGFVTWED--GSIDRFSS-WEELVYDAIRKKKGALIFVNMRRKAER 252 Query: 528 CIAFCRSRKLCELVLSYTREILEETAPHLVDS-------------ICVYRAGYVAEDRRR 574 +A S+K+ L+ L E A L ++ + + AG ++R Sbjct: 253 -VALELSKKVKSLLTKPEIRALNELADSLEENPTNEKLAKAIRGGVAFHHAGLGRDERVL 311 Query: 575 IERDFFGGKLCGVAATNALELGIDVGHIDVTLHLGFPGS--------IASLWQQAGRSGR 626 +E +F G + V AT L GI+ V + + S I + Q GR+GR Sbjct: 312 VEENFRKGIIKAVVATPTLSAGINTPAFRVIIRDIWRYSDFGMERIPIIEVHQMLGRAGR 371 Query: 627 RERPSLA---VYVAFEGP---LDQYFMKYPEKLF 654 + + + + P ++ Y PEKLF Sbjct: 372 PKYDEVGEGIIVSTSDDPREVMNHYIFGKPEKLF 405

PyMOL of 2zj2

>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523

Back alignment and structure

>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337

Back alignment and structure

>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		961
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	6e-20
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	6e-16
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	4e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-04
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	9e-10
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	2e-08
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	6e-08
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	3e-07
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	4e-07
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	3e-05
3b6e_A		216	Interferon-induced helicase C domain-containing P;	4e-07
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	2e-06
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	3e-06
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	4e-06
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	5e-06
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	2e-05
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	4e-05
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	7e-05
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	1e-04
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	2e-04
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	3e-04
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	3e-04

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702	Back alignment and structure

 Score = 94.1 bits (234), Expect = 6e-20
 Identities = 84/478 (17%), Positives = 158/478 (33%), Gaps = 100/478 (20%)

Query: 235 EIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEA 294
           E+ +++       LK  GI +L+  QAE++    +GKN+++A  T++GK+L   + ++  
Sbjct: 5   ELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVRE 64

Query: 295 LSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARL 354
                   +LY+ P +ALA ++  +     K     + IG+  GD   +D      +  +
Sbjct: 65  AIKG--GKSLYVVPLRALAGEKYESF---KKWEKIGLRIGISTGDYESRDEHL--GDCDI 117

Query: 355 LITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYK--- 411
           ++T  +      L  +      +  +                     +V+DE H      
Sbjct: 118 IVTTSEKAD--SLIRNRA--SWIKAVSC-------------------LVVDEIHLLDSEK 154

Query: 412 -GAFGCHTAL--ILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQND 468
            GA      L  ++ ++ R+   +       +  +AT+ N      E+A     +   +D
Sbjct: 155 RGA-----TLEILVTKMRRMNKAL-----RVIGLSATAPNVT----EIAEWLDADYYVSD 200

Query: 469 GSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRC 528
             P      VL   T      L         +R               L  E V      
Sbjct: 201 WRPVPLVEGVLCEGT------LELFDGAFSTSRRVK---------FEELVEECVAENGGV 245

Query: 529 IAFCRSRKLCELV--------------LSYTREILEETAPH--------LVDSICVYRAG 566
           + F  +R+  E                    + ILEE            +      + AG
Sbjct: 246 LVFESTRRGAEKTAVKLSAITAKYVENEGLEKAILEENEGEMSRKLAECVRKGAAFHHAG 305

Query: 567 YVAEDRRRIERDFFGGKLCGVAATNALELGIDV-GHI----DVTLHLGFPG--SIASLWQ 619
            +   RR +E  F  G +  V AT  L  G+++         +    G+     ++   Q
Sbjct: 306 LLNGQRRVVEDAFRRGNIKVVVATPTLAAGVNLPARRVIVRSLYRFDGYSKRIKVSEYKQ 365

Query: 620 QAGRSGRR--ERPSLAVYVAFEGPLDQYFMKYPEKLFKSPIECCHIDAQNHKVLEQHL 675
            AGR+GR   +    A+ +  +   +       ++      E           L  H 
Sbjct: 366 MAGRAGRPGMDERGEAIIIVGKRDREIAV----KRYIFGEPERITSKLGVETHLRFHS 419

PyMOL of 2p6r

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		961
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	100.0
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	100.0
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	100.0
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	100.0
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	100.0
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	100.0
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	100.0
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	100.0
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	100.0
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	100.0
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	100.0
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	100.0
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	100.0
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	100.0
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	100.0
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	100.0
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	100.0
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	100.0
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	100.0
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	100.0
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	100.0
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	100.0
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	100.0
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	100.0
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	100.0
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	100.0
4gl2_A		699	Interferon-induced helicase C domain-containing P;	100.0
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	100.0
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	100.0
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	100.0
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	100.0
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	100.0
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	100.0
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	100.0
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	100.0
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	100.0
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	100.0
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	100.0
1yks_A		440	Genome polyprotein [contains: flavivirin protease	100.0
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	100.0
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	100.0
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	100.0
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	100.0
3h1t_A		590	Type I site-specific restriction-modification syst	99.98
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	99.97
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	99.97
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.96
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.96
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	99.96
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	99.95
3jux_A		822	Protein translocase subunit SECA; protein transloc	99.95
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	99.95
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	99.95
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	99.94
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	99.94
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	99.94
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	99.94
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	99.94
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	99.94
3bor_A		237	Human initiation factor 4A-II; translation initiat	99.94
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	99.94
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	99.94
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	99.94
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	99.94
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	99.94
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	99.93
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	99.93
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	99.92
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	99.9
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	99.88
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	99.87
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	99.86
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	99.86
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	99.85
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	99.85
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	99.85
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	99.83
3b6e_A		216	Interferon-induced helicase C domain-containing P;	99.82
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	99.82
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	99.82
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	99.68
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	99.77
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	99.76
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	99.76
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	99.67
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	99.63
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	99.58
2zxx_C		197	DNA replication factor CDT1; coiled-coil, cell cyc	99.12
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	98.12
1wlq_C		201	CDT1 protein; coiled-coil; 2.80A {Mus musculus} PD	97.78
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	97.48
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	97.3
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	97.23
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	97.16
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	97.09
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	96.98
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	96.95
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	96.66
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	96.36
3hgt_A		328	HDA1 complex subunit 3; RECA-like domain, SWI2/SNF	96.21
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	95.89
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	95.74
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	95.31
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	94.58
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	94.35
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	94.12
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	93.71
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	93.47
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	92.85
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	92.75
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	92.17
3bos_A		242	Putative DNA replication factor; P-loop containing	92.06
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	91.96
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	91.81
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	91.58
2r6a_A		454	DNAB helicase, replicative helicase; replication,	91.5
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	91.4
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	90.62
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	90.37
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	90.35
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	90.19
2iut_A		574	DNA translocase FTSK; nucleotide-binding, chromoso	89.84
2cvh_A		220	DNA repair and recombination protein RADB; filamen	89.54
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	89.53
2chg_A		226	Replication factor C small subunit; DNA-binding pr	89.0
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	88.98
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	88.98
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	88.9
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	88.12
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	87.91
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	87.62
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	87.53
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	87.48
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	87.32
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	86.74
2ius_A		512	DNA translocase FTSK; nucleotide-binding, chromoso	86.37
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	86.3
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	86.21
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	86.15
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	86.01
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	85.81
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	85.14
2z43_A		324	DNA repair and recombination protein RADA; archaea	84.97
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	84.88
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	84.65
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	84.54
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	83.88
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	83.54
1xp8_A		366	RECA protein, recombinase A; recombination, radior	83.26
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	82.18
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	81.55
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	81.23
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	80.58
1u94_A		356	RECA protein, recombinase A; homologous recombinat	80.55
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	80.38
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	80.1

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

Probab=100.00  E-value=6.6e-49  Score=457.55  Aligned_cols=350  Identities=19%  Similarity=0.237  Sum_probs=269.6

Q ss_pred             EEeeecCCcccccccCCccccHHHHHHHHhCCCCCCcHHHHHHHHHHhCCCcEEEEecCCchhHHHHHHHHHHHHhcCC-
Q 002135          221 VHVEDISARKAVLVEIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEALSHDL-  299 (961)
Q Consensus       221 v~~~~~p~~~~~f~~l~~~L~~~l~~~L~~~g~~~l~~~Q~~ai~~il~G~~vIv~apTGSGKTla~~Lpil~~l~~~~-  299 (961)
                      +...+.|.+..+|.++  +|++.+.++|++.||.+|+|+|.+||+.+++|+|++++||||||||++|++|++..+...+ 
T Consensus        46 ~~~~~~p~~~~~f~~~--~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~  123 (434)
T 2db3_A           46 VTGSDVPQPIQHFTSA--DLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPH  123 (434)
T ss_dssp             EESSSCCCCCCCGGGS--CCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCC
T ss_pred             ecCCCCCCCcCChhhc--CCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhccc
Confidence            4556778888889998  6999999999999999999999999999999999999999999999999999999886542 


Q ss_pred             -----CCeEEEEcccHHHHHHHHHHHHHhHhhCCCCccEEEEcCCCc-HHHHHHHhcCCcEEEeChhHHHHhhcCCCchh
Q 002135          300 -----SSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTT-QKDRMWLRDNARLLITNPDMLHMSILPYHGQF  373 (961)
Q Consensus       300 -----~~~aLvl~PtraLa~qq~~~l~~l~~~~~~~i~v~~~~Gd~~-~~~r~~l~~~~~IlItTPe~L~~~lL~~~~~~  373 (961)
                           ++++||++||++|+.|+++++++++...+  +++..+.|+.. ..+...+..+++|+|+||++|.+.+...    
T Consensus       124 ~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~--~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~----  197 (434)
T 2db3_A          124 ELELGRPQVVIVSPTRELAIQIFNEARKFAFESY--LKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRT----  197 (434)
T ss_dssp             CCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSS--CCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTT----
T ss_pred             ccccCCccEEEEecCHHHHHHHHHHHHHHhccCC--cEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhC----
Confidence                 56899999999999999999999876544  55555566554 4455667778999999999998765211    


Q ss_pred             HHHhhhhhhhhhhcchhhhhhhhcceeEEEEecchhhhc-ccchHHHHHHHHHHHHhhcccCCCCcEEEeccCCCChHH-
Q 002135          374 SRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKG-AFGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPRE-  451 (961)
Q Consensus       374 ~~~L~~l~~~~~~~~~~~~~~~~~~i~~VVIDEaH~~~~-~fg~~~~~ilrrL~~~~~~~~~~~~q~I~lSATl~n~~e-  451 (961)
                      ...+.++                   ++||+||||++.+ +|+.++..++..+.      .....|++++|||+++..+ 
T Consensus       198 ~~~l~~~-------------------~~lVlDEah~~~~~gf~~~~~~i~~~~~------~~~~~q~l~~SAT~~~~~~~  252 (434)
T 2db3_A          198 FITFEDT-------------------RFVVLDEADRMLDMGFSEDMRRIMTHVT------MRPEHQTLMFSATFPEEIQR  252 (434)
T ss_dssp             SCCCTTC-------------------CEEEEETHHHHTSTTTHHHHHHHHHCTT------SCSSCEEEEEESCCCHHHHH
T ss_pred             CcccccC-------------------CeEEEccHhhhhccCcHHHHHHHHHhcC------CCCCceEEEEeccCCHHHHH
Confidence            1123444                   9999999999987 46666655544321      1356799999999975432 


Q ss_pred             HHHHHcccCCeEEEecC--CCc-cceeEEEEeCCCccccccccccccccchhhhcccCCCCcHHHHHHHHHHHHHCCCcE
Q 002135          452 HCMELANLSTLELIQND--GSP-CAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANKTSSPISEVSYLFAEMVQHGLRC  528 (961)
Q Consensus       452 ~~~~L~~~~~~~~i~~~--g~p-~~~~~~~l~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~l~~~g~k~  528 (961)
                      .+..+..  +...+...  +.. ......+..                           .........++..+...+.++
T Consensus       253 ~~~~~l~--~~~~i~~~~~~~~~~~i~~~~~~---------------------------~~~~~k~~~l~~~l~~~~~~~  303 (434)
T 2db3_A          253 MAGEFLK--NYVFVAIGIVGGACSDVKQTIYE---------------------------VNKYAKRSKLIEILSEQADGT  303 (434)
T ss_dssp             HHHTTCS--SCEEEEESSTTCCCTTEEEEEEE---------------------------CCGGGHHHHHHHHHHHCCTTE
T ss_pred             HHHHhcc--CCEEEEeccccccccccceEEEE---------------------------eCcHHHHHHHHHHHHhCCCCE
Confidence            2222222  22222211  111 111111111                           011122233344444456679


Q ss_pred             EEEecChHHHHHHHHHHHHHHHhhCCcccccEEEEcCCCCHHHHHHHHHHHhCCCceEEEeccccccccccCCccEEEEe
Q 002135          529 IAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCGVAATNALELGIDVGHIDVTLHL  608 (961)
Q Consensus       529 IVF~~sr~~ae~l~~~L~~~l~~~~~~l~~~v~~~hggls~~eR~~ie~~f~~G~~~vLVAT~aLe~GIDIp~vd~VI~~  608 (961)
                      ||||++++.|+.+++.|++        .+..+..+||++++.+|++++++|++|+.+|||||+++++|||+|++++||+|
T Consensus       304 lVF~~t~~~a~~l~~~L~~--------~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~  375 (434)
T 2db3_A          304 IVFVETKRGADFLASFLSE--------KEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINY  375 (434)
T ss_dssp             EEECSSHHHHHHHHHHHHH--------TTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEES
T ss_pred             EEEEeCcHHHHHHHHHHHh--------CCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEE
Confidence            9999999999999998876        34578999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHhhHHHHhccCCCCCCCceEEEEeeCC
Q 002135          609 GFPGSIASLWQQAGRSGRRERPSLAVYVAFEG  640 (961)
Q Consensus       609 ~~P~s~~sy~QR~GRAGR~g~~g~~i~l~~~~  640 (961)
                      |+|.+..+|+||+||+||.|+.|.+++++...
T Consensus       376 d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~  407 (434)
T 2db3_A          376 DMPSKIDDYVHRIGRTGRVGNNGRATSFFDPE  407 (434)
T ss_dssp             SCCSSHHHHHHHHTTSSCTTCCEEEEEEECTT
T ss_pred             CCCCCHHHHHHHhcccccCCCCCEEEEEEecc
Confidence            99999999999999999999999999887643

PyMOL of 2db3

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>2zxx_C DNA replication factor CDT1; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus}	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>1wlq_C CDT1 protein; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_C*	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		961
d2p6ra3		202	c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus	2e-12
d1gkub1		237	c.37.1.16 (B:1-250) Helicase-like "domain" of reve	2e-12
d1a1va2		299	c.37.1.14 (A:326-624) HCV helicase domain {Human h	4e-10
d1wp9a2		286	c.37.1.19 (A:201-486) putative ATP-dependent RNA h	1e-09
d1oywa2		206	c.37.1.19 (A:1-206) RecQ helicase domain {Escheric	2e-08
d2g9na1		218	c.37.1.19 (A:21-238) Initiation factor 4a {Human (	9e-08
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	2e-07
d2p6ra4		201	c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob	2e-07
d1hv8a1		208	c.37.1.19 (A:3-210) Putative DEAD box RNA helicase	6e-06
d1jr6a_		138	c.37.1.14 (A:) HCV helicase domain {Human hepatiti	9e-06
d1veca_		206	c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma	2e-05
d2fwra1		200	c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar	2e-05
d2j0sa2		168	c.37.1.19 (A:244-411) Probable ATP-dependent RNA h	5e-05
d1wrba1		238	c.37.1.19 (A:164-401) putative ATP-dependent RNA h	2e-04
d1t6na_		207	c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5	3e-04
d1yksa2		299	c.37.1.14 (A:325-623) YFV helicase domain {Yellow	5e-04
d1gkub2		248	c.37.1.16 (B:251-498) Helicase-like "domain" of re	5e-04
d1wp9a1		200	c.37.1.19 (A:1-200) putative ATP-dependent RNA hel	0.001
d2j0sa1		222	c.37.1.19 (A:22-243) Probable ATP-dependent RNA he	0.001
d1qdea_		212	c.37.1.19 (A:) Initiation factor 4a {Baker's yeast	0.003

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 65.0 bits (157), Expect = 2e-12
 Identities = 42/223 (18%), Positives = 88/223 (39%), Gaps = 36/223 (16%)

Query: 235 EIPDALLDNTKSALKSTGISKLYSHQAESIMASLAGKNVVVATMTSSGKSLCYNLPVLEA 294
           E+ +++       LK  GI +L+  QAE++    +GKN+++A  T++GK+L   + ++  
Sbjct: 5   ELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVRE 64

Query: 295 LSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRMWLRDNARL 354
                   +LY+ P +ALA ++  +     K     + IG+  GD   +D      +  +
Sbjct: 65  AIKG--GKSLYVVPLRALAGEKYESF---KKWEKIGLRIGISTGDYESRDEHL--GDCDI 117

Query: 355 LITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGA- 413
           ++T  +      L  +                            +  +V+DE H      
Sbjct: 118 IVTTSEKADS--LIRNRASW---------------------IKAVSCLVVDEIHLLDSEK 154

Query: 414 FGCHTALILRRLCRLCSHVYGSDPSFVFSTATSANPREHCMEL 456
            G    +++ ++ R+   +       +  +AT+ N  E    L
Sbjct: 155 RGATLEILVTKMRRMNKALR-----VIGLSATAPNVTEIAEWL 192

PyMOL of d2p6ra3

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207	Back information, alignment and structure

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		961
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	99.97
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	99.97
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	99.97
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.96
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	99.96
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	99.96
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	99.96
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	99.95
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.94
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	99.94
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.93
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.91
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	99.9
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	99.9
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	99.89
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.89
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.88
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	99.88
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.87
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	99.86
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	99.85
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.85
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	99.85
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.82
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	99.76
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.71
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	99.64
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	99.63
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	99.63
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	99.61
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.61
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.61
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.56
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	99.55
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	99.55
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.5
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.49
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	99.24
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	99.11
d1wlqc_		187	DNA replication factor Cdt1 {Mouse (Mus musculus)	99.08
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.05
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.03
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.94
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	98.89
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	98.24
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	98.12
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	98.04
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	97.05
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	96.78
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	96.75
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	96.72
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	96.37
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	96.32
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	95.4
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	93.43
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	93.37
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	91.73
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	90.48
d1ls1a2		207	GTPase domain of the signal sequence recognition p	89.67
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	89.52
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	89.18
d2qy9a2		211	GTPase domain of the signal recognition particle r	88.93
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	88.69
d1okkd2		207	GTPase domain of the signal recognition particle r	88.46
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	88.05
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	87.79
d1vmaa2		213	GTPase domain of the signal recognition particle r	87.04
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	85.81
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	85.28
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	85.27
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	84.06
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	83.07
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	82.12
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	82.11
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	81.88
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	81.85
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	80.83
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	80.61
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	80.31
d1j8yf2		211	GTPase domain of the signal sequence recognition p	80.04

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.97  E-value=1.9e-31  Score=291.96  Aligned_cols=277  Identities=15%  Similarity=0.121  Sum_probs=182.3

Q ss_pred             HhCCCcEEEEecCCchhHHHHHHHHHHHHhcCCCCeEEEEcccHHHHHHHHHHHHHhHhhCCCCccEEEEcCCCcHHHHH
Q 002135          267 SLAGKNVVVATMTSSGKSLCYNLPVLEALSHDLSSSALYMFPTKALAQDQLRALLAMTKAFDASIDIGVYDGDTTQKDRM  346 (961)
Q Consensus       267 il~G~~vIv~apTGSGKTla~~Lpil~~l~~~~~~~aLvl~PtraLa~qq~~~l~~l~~~~~~~i~v~~~~Gd~~~~~r~  346 (961)
                      +.+|+++|+.||||||||++|++|++..... .+.++||++||++||+|+.++++.+...    ......        ..
T Consensus         6 ~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~-~~~~~lvi~Ptr~La~q~~~~l~~~~~~----~~~~~~--------~~   72 (305)
T d2bmfa2           6 FRKKRLTIMDLHPGAGKTKRYLPAIVREAIK-RGLRTLILAPTRVVAAEMEEALRGLPIR----YQTPAI--------RA   72 (305)
T ss_dssp             SSTTCEEEECCCTTSSTTTTHHHHHHHHHHH-HTCCEEEEESSHHHHHHHHHHTTTSCCB----CCC-------------
T ss_pred             hhcCCcEEEEECCCCCHHHHHHHHHHHHHHh-cCCEEEEEccHHHHHHHHHHHHhcCCcc----eeeeEE--------ee
Confidence            3578999999999999999998888876554 3678999999999999998887654221    111111        12


Q ss_pred             HHhcCCcEEEeChhHHHHhhcCCCchhHHHhhhhhhhhhhcchhhhhhhhcceeEEEEecchhhhcccchHHHHHHHHHH
Q 002135          347 WLRDNARLLITNPDMLHMSILPYHGQFSRILSNLRLIAFSLVTTEVYLIFLFIRFVVIDEAHAYKGAFGCHTALILRRLC  426 (961)
Q Consensus       347 ~l~~~~~IlItTPe~L~~~lL~~~~~~~~~L~~l~~~~~~~~~~~~~~~~~~i~~VVIDEaH~~~~~fg~~~~~ilrrL~  426 (961)
                      .......++++||+.|...++..     ..+.++                   ++||+||+|++.. .+.....+++.+.
T Consensus        73 ~~~~~~~i~~~t~~~l~~~~~~~-----~~~~~~-------------------~~vViDE~H~~~~-~~~~~~~~l~~~~  127 (305)
T d2bmfa2          73 EHTGREIVDLMCHATFTMRLLSP-----IRVPNY-------------------NLIIMDEAHFTDP-ASIAARGYISTRV  127 (305)
T ss_dssp             ---CCCSEEEEEHHHHHHHHTSS-----SCCCCC-------------------SEEEEESTTCCSH-HHHHHHHHHHHHH
T ss_pred             cccCccccccCCcHHHHHHHhcC-----ccccce-------------------eEEEeeeeeecch-hhHHHHHHHHHhh
Confidence            23345789999999886543211     123344                   9999999999854 2322223333332


Q ss_pred             HHhhcccCCCCcEEEeccCCCChHHHHHHHcccCCeEEEecCCCccceeEEEEeCCCccccccccccccccchhhhcccC
Q 002135          427 RLCSHVYGSDPSFVFSTATSANPREHCMELANLSTLELIQNDGSPCAQKLFVLWNPTSCLRSVLNKSQTDMDDTRNAANK  506 (961)
Q Consensus       427 ~~~~~~~~~~~q~I~lSATl~n~~e~~~~L~~~~~~~~i~~~g~p~~~~~~~l~~p~~~~~~~~~~~~~~~~~~~~~~~~  506 (961)
                      .      ....+++++|||++.....   .           .......  .........                   ..
T Consensus       128 ~------~~~~~~v~~SAT~~~~~~~---~-----------~~~~~~~--~~~~~~~~~-------------------~~  166 (305)
T d2bmfa2         128 E------MGEAAGIFMTATPPGSRDP---F-----------PQSNAPI--MDEEREIPE-------------------RS  166 (305)
T ss_dssp             H------HTSCEEEEECSSCTTCCCS---S-----------CCCSSCE--EEEECCCCC-------------------SC
T ss_pred             c------cccceEEEeecCCCcceee---e-----------cccCCcc--eEEEEeccH-------------------HH
Confidence            1      2467899999998643210   0           0000000  000000000                   00


Q ss_pred             CCCcHHHHHHHHHHHHHCCCcEEEEecChHHHHHHHHHHHHHHHhhCCcccccEEEEcCCCCHHHHHHHHHHHhCCCceE
Q 002135          507 TSSPISEVSYLFAEMVQHGLRCIAFCRSRKLCELVLSYTREILEETAPHLVDSICVYRAGYVAEDRRRIERDFFGGKLCG  586 (961)
Q Consensus       507 ~~~~~~~~~~ll~~l~~~g~k~IVF~~sr~~ae~l~~~L~~~l~~~~~~l~~~v~~~hggls~~eR~~ie~~f~~G~~~v  586 (961)
                      ....       +..+...+.++||||++++.|+.+++.|++        .+..+..+||++.+..|    ..|++|..++
T Consensus       167 ~~~~-------~~~~~~~~~~~lvf~~~~~~~~~l~~~L~~--------~~~~~~~l~~~~~~~~~----~~~~~~~~~~  227 (305)
T d2bmfa2         167 WNSG-------HEWVTDFKGKTVWFVPSIKAGNDIAACLRK--------NGKKVIQLSRKTFDSEY----IKTRTNDWDF  227 (305)
T ss_dssp             CSSC-------CHHHHSSCSCEEEECSCHHHHHHHHHHHHH--------HTCCCEECCTTCHHHHG----GGGGTSCCSE
T ss_pred             HHHH-------HHHHHhhCCCEEEEeccHHHHHHHHHHHHh--------CCCCEEEeCCcChHHHH----hhhhccchhh
Confidence            0011       122334677999999999999999998876        23467889999866554    4678999999


Q ss_pred             EEeccccccccccCCccEEEE----------eC----------CCCCHhhHHHHhccCCCCCCCceEEEEeeCCcc
Q 002135          587 VAATNALELGIDVGHIDVTLH----------LG----------FPGSIASLWQQAGRSGRRERPSLAVYVAFEGPL  642 (961)
Q Consensus       587 LVAT~aLe~GIDIp~vd~VI~----------~~----------~P~s~~sy~QR~GRAGR~g~~g~~i~l~~~~~~  642 (961)
                      +|||+++++|+|++ ++.||.          ++          .|.|.++|+||+||+||.|+.+..++++...+.
T Consensus       228 lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~~~  302 (305)
T d2bmfa2         228 VVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPL  302 (305)
T ss_dssp             EEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSCCC
T ss_pred             hhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCCCC
Confidence            99999999999994 555542          33          456899999999999999999888877765544

PyMOL of d2bmfa2

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1wlqc_ a.4.5.52 (C:) DNA replication factor Cdt1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure