Citrus Sinensis ID: 002159

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
cccccccccEEEEEEcHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccEEEEEcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHccccccccEEEEEcccccEEEEEEEEccccccccccccccEEccccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccccccccccccEEEEEEEEEcccccEEEEEEccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHHccEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccEEEEEEccccccccHHHHcccccEEEcccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccEEEEcccccHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc
cEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHccccccccccccccccccccccEEEEEEEEEccccccccccccccccHHHHEEccHHHHHHHcccccccEEEEEccccccEEEEEEEEcccccccccccccccccccccHHEEccccccccHcccccccccEEEcccHHHHcccccccEEEEEEcccEEEEEEEEEccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEcccccccccccHHHHHHHHHHHHcccccEEcccEEEEEEccccccccccccccccccccccEEEEEEEEEcccccEEEEEcccEEEEEEccccccccccccccccHcccccHHHHHHHHHHHHHccccccHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHccccHHHHHHHHHHHHHccccEEEEEcHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccEEEEEEccccccccHHHHcccccEEEcccccHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHccccHcccccccccHHHHHHHcccHHHHHHHHHcccccHHHHEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHcccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEccHHHHcHHcccccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHcccccccEEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHccccccHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccEcHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc
MCVCISTPFFLIQATRVFEVCIIDsmverrkplvlSSTKLLINSVLsssrrvtgenlvgddvspslqlpagilrfskdkidisdakfaslddsalLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVvvldppttrkqvcdgdvhskhssptmltfpsihlpqddMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIakvddgtsgqdgKASLIKLGLqsvgqlpkyasHLRVsfvkipecgtleslkgssaieAEDRQEKIDLALHNYFEVdrylargdVFSVCINwncssmicipcrqrlhrrsdniIYFKVVavepseetvlRVNCTKTALvlggsipsalppdllisgsndfvplqgDTVKILASIlaptlcpsvLSLKFRVAVLLhglpgcgkrTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTaqsysptilLLRDFDVFRNlvsneslpndqvglSSEVASVIReftepsaededeeshgyfpvkeIEKICRQQVLLVAAadsseglpptirrcfsheismgpltEQQRVEMLSQLLQpvseltsdtgseeFVKDIigqtsgfmprDLHALVADAGANLIrksnsevdknepgesdltakvahndnssiaatqVMGKEDLVKAMERSKKRnasalgapkvpnvkwedvggledvkksildtvqlpllhkdlfssglrkrsgvllygppgtgkTLLAKAVATECSlnflsvkgpelinmyigesEKNVRDIFQKArsarpcviffdeldslapargasgdsggVMDRVVSQMLAEIdglndssqdlfiigasnrpdlidpallrpgrfdkllyVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIakkcppnftgadMYALCADAWFHAAKRKvlssdsnsdssridqadSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
MCVCISTPFFLIQATRVFEVCIIDSMVerrkplvlsstkllinsvlsssrrvtgenlvgddvspslqlPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLvknaettkqriaqvvvldppttrkQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVvavepseetvlRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLhglpgcgkrtVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSneslpndqvglsSEVASVIREFtepsaededeesHGYFPVKEIEKICRQQVLLVAaadsseglppTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSEltsdtgseEFVKDIIGQTSGFMPRDLHALVADAGANLIRksnsevdknepgESDLtakvahndnssiaatqvmGKEDLVKAMERSKKrnasalgapkvpnvkweDVGGLEDVKKSILDTVQLPLLHKDlfssglrkrsgVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKfklledvslysIAKKCPPNFTGADMYALCADAWFHAAKRKVlssdsnsdssridqadsvvVEYDDFVKVLRelspslsmaelkkyellrdqfegssn
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFaslddsallglsTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLssdsnsdssRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
*CVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPT****VC*************LTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTS**DGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESL************EKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMAS******AALAQAFNTAQSYSPTILLLRDFDVFRNLVS************************************YFPVKEIEKICRQQVLLVAAAD****LPPTIRRCFSHEI********************************FVKDIIGQTSGFMPRDLHALVADAGAN***************************************************************NVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSL**************DRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKR******************SVVVEYDDFVKVLREL************************
*****STPFFLIQATRVFEVCIIDSMVERRKPLVLS*****************************************************LDDSALLGLSTCVLKQLSVTSGSLVLVKNAETT*QR*********************************************LDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKV*************************KYASHLRVSFVKIPECGTLESLKGS*AIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSM******QRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTA*****************SGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFR*****************EVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSN****************VAHNDNSSIAATQVMGKEDLVKAMERS*******LGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSL****************VVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKV***************DSVVVEYDDFVKVLRELSPSLSMAELKKYEL***QF*****
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREF*************GYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSN*********ESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKR**************DQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSS*******NLVGDDVSPSLQLPAGILRFSKD********FASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPP**************HSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLV****LPNDQVGLSSEVASVIREFTEP**********GYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPAR******GGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDS*SDS****QADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVCISTPFFLIQATRVFEVCIIDSMVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSPSLQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query958 2.2.26 [Sep-21-2011]
Q8RY16941 Peroxisome biogenesis pro yes no 0.965 0.982 0.676 0.0
Q54CS81201 Peroxisomal biogenesis fa yes no 0.628 0.501 0.389 1e-133
Q99LC9981 Peroxisome assembly facto yes no 0.791 0.772 0.369 1e-121
P54777978 Peroxisome assembly facto yes no 0.786 0.769 0.363 1e-120
P369661024 Peroxisomal biogenesis fa yes no 0.665 0.623 0.375 1e-119
Q13608980 Peroxisome assembly facto yes no 0.791 0.773 0.366 1e-118
P337601030 Peroxisomal ATPase PEX6 O yes no 0.565 0.526 0.389 1e-111
Q74Z131021 Peroxisomal biogenesis fa yes no 0.535 0.502 0.417 1e-111
Q6CPV11000 Peroxisomal biogenesis fa yes no 0.664 0.637 0.347 1e-109
Q9C1E91388 Peroxisomal biogenesis fa N/A no 0.448 0.309 0.458 1e-106
>sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 Back     alignment and function desciption
 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/949 (67%), Positives = 742/949 (78%), Gaps = 24/949 (2%)

Query: 26  MVERRKPLVLSSTKLLINSVLSSSRRVTGE-----NLVGDDVSPSLQLPAGILRFSKDKI 80
           MVERR PLVLSST+  + SVL+SS+  + +     N  GD +  + +L AGILR+ KD  
Sbjct: 1   MVERRNPLVLSSTRSTLRSVLNSSQPSSADGDRVLNKDGDLLRGNARLSAGILRWRKDGE 60

Query: 81  DISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPP-TTRK 139
           ++SDAK  SLDDSAL+GLST +LK+LS+ SGSLV+VKN E   QR+AQVVVLDPP TT +
Sbjct: 61  NVSDAKLDSLDDSALVGLSTQLLKRLSINSGSLVVVKNIEIGIQRVAQVVVLDPPKTTLE 120

Query: 140 QVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQ 199
                 V    S  TML FP+  L     +LLD++VAYLSP+LAFNL LHIS LK LVH+
Sbjct: 121 DASLTQVPVSDSLHTMLVFPTYDLM--GQQLLDQEVAYLSPMLAFNLSLHISCLKSLVHR 178

Query: 200 GKEVLESLFIAKVDD---GTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTL 256
           G  VLE  F AK D+   G S +DG  S I L L+ V Q+P YASHLRVSFVKIPECGT+
Sbjct: 179 GNGVLEKYFEAKCDEEFIGKSAEDG--SKIGLDLEPVSQVPGYASHLRVSFVKIPECGTI 236

Query: 257 ESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHR 316
            SLK +S+ EAE+RQ  ID AL  YF  DR L+RGD+F + I+WNC S IC PC QRL  
Sbjct: 237 PSLKVNSSFEAEERQGLIDSALQKYFGTDRQLSRGDIFRIYIDWNCGSSICNPCSQRLCS 296

Query: 317 RSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTV 376
            SD+ IYFKV+A+EPS E  LRVN ++TALVLGG++ S LPPDLL+  S   +PLQ +TV
Sbjct: 297 ESDDYIYFKVIAMEPSNERFLRVNHSQTALVLGGTVSSGLPPDLLVYRSKVPMPLQEETV 356

Query: 377 KILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMAS 436
            ILAS+L+P LCPS L+ K RVAVLLHG+PGCGKRTVV+YVARRLG+HVVE+SCH+L+AS
Sbjct: 357 NILASVLSPPLCPSALASKLRVAVLLHGIPGCGKRTVVKYVARRLGLHVVEFSCHSLLAS 416

Query: 437 SERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFT 496
           SERKTS ALAQ FN A+ YSPTILLLR FDVF+NL S +    D+VG+S E+ASVIRE T
Sbjct: 417 SERKTSTALAQTFNMARRYSPTILLLRHFDVFKNLGSQDGSLGDRVGVSFEIASVIRELT 476

Query: 497 EPSAEDE---DEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPL 553
           EP +  +   +E+S+  F   E+ K    QVLL+A+A+S+EG+ PTIRRCFSHEI MG L
Sbjct: 477 EPVSNGDSSMEEKSNSNFSENEVGKFRGHQVLLIASAESTEGISPTIRRCFSHEIRMGSL 536

Query: 554 TEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSN 613
            ++QR EMLSQ LQ VS+   +  S+EF+K ++GQTSGF+PRDL ALVADAGANL     
Sbjct: 537 NDEQRSEMLSQSLQGVSQFL-NISSDEFMKGLVGQTSGFLPRDLQALVADAGANLYISQE 595

Query: 614 SEVDKNEPGESDLTAKVAHN----DNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKV 669
           SE  K      DL     H     DNS+    ++  KED  KA++RSKKRNASALGAPKV
Sbjct: 596 SETKKINSLSDDLHGVDIHQASQIDNST---EKLTAKEDFTKALDRSKKRNASALGAPKV 652

Query: 670 PNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVA 729
           PNVKW+DVGGLEDVK SILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVA
Sbjct: 653 PNVKWDDVGGLEDVKTSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVA 712

Query: 730 TECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDS 789
           TECSLNFLSVKGPELINMYIGESEKNVRDIF+KARSARPCVIFFDELDSLAPARGASGDS
Sbjct: 713 TECSLNFLSVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGASGDS 772

Query: 790 GGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVS 849
           GGVMDRVVSQMLAEIDGL+DSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVN+D S
Sbjct: 773 GGVMDRVVSQMLAEIDGLSDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNADAS 832

Query: 850 YRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNS 909
           YRERVLKALTRKFKL EDVSLYS+AKKCP  FTGADMYALCADAWF AAKRKV  SDS  
Sbjct: 833 YRERVLKALTRKFKLSEDVSLYSVAKKCPSTFTGADMYALCADAWFQAAKRKVSKSDSGD 892

Query: 910 DSSRIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN 958
             +  D  DSVVVEY DF+K + +LSPSLS+ ELKKYE+LRDQF+G S+
Sbjct: 893 MPTEEDDPDSVVVEYVDFIKAMDQLSPSLSITELKKYEMLRDQFQGRSS 941
Involved in peroxisomal-targeting signal one (PTS1) and peroxisomal-targeting signal two (PTS2) protein import. Required for jasmonate biosynthesis. Necessary for the developmental elimination of obsolete peroxisome matix proteins. May form heteromeric AAA ATPase complexes required for the import of proteins. May be involved in PEX5 recycling.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 Back     alignment and function description
>sp|Q99LC9|PEX6_MOUSE Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=2 SV=1 Back     alignment and function description
>sp|P54777|PEX6_RAT Peroxisome assembly factor 2 OS=Rattus norvegicus GN=Pex6 PE=1 SV=1 Back     alignment and function description
>sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 Back     alignment and function description
>sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 Back     alignment and function description
>sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 Back     alignment and function description
>sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 Back     alignment and function description
>sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 Back     alignment and function description
>sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query958
296086606938 unnamed protein product [Vitis vinifera] 0.966 0.987 0.739 0.0
359479743935 PREDICTED: peroxisome biogenesis protein 0.956 0.979 0.726 0.0
224131204930 predicted protein [Populus trichocarpa] 0.955 0.983 0.737 0.0
255559284920 peroxisome assembly factor-2, putative [ 0.945 0.984 0.723 0.0
449498449938 PREDICTED: peroxisome biogenesis protein 0.965 0.986 0.682 0.0
449436535938 PREDICTED: peroxisome biogenesis protein 0.965 0.986 0.681 0.0
124360532924 AAA ATPase, central region; L-lactate de 0.954 0.989 0.689 0.0
22329309941 peroxin 6 [Arabidopsis thaliana] gi|7533 0.965 0.982 0.676 0.0
357509313952 Peroxisomal biogenesis factor [Medicago 0.954 0.960 0.668 0.0
297848522947 hypothetical protein ARALYDRAFT_470277 [ 0.966 0.977 0.669 0.0
>gi|296086606|emb|CBI32241.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1376 bits (3562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/943 (73%), Positives = 782/943 (82%), Gaps = 17/943 (1%)

Query: 26  MVERRKPLVLSSTKLLINSVLSSSR-----RVTGENLVGDDVSPSLQLPAGILRFSKDKI 80
           MVERRKPLVLSSTK+L++S+ +S+R      VTG  L  ++ SP+L LP GILR S +K 
Sbjct: 1   MVERRKPLVLSSTKILLDSIRNSARLNKRDGVTGNELSANESSPTLHLPVGILRLSDEKS 60

Query: 81  DISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQ 140
             SD K A LDDSAL+GL T  LK+LSVTSGS VLV+N ET   RIA VVVLD P     
Sbjct: 61  VSSDPKLALLDDSALVGLPTSALKRLSVTSGSPVLVRNVETNVWRIAHVVVLDSPRAHGH 120

Query: 141 VCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQG 200
             D  +   HS  TML FPS+  PQ+D  LLD +VAYLSPLLAFNLDLHIS LK LVHQG
Sbjct: 121 SSDSKLPLSHSPHTMLIFPSLKYPQNDSVLLDGEVAYLSPLLAFNLDLHISCLKSLVHQG 180

Query: 201 KEVLESLFIAKVDDGTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLK 260
           KE L  LF AK D+ T G+  +AS I L L+   +LP++ASHLR SFVKIPECGTLESL+
Sbjct: 181 KETLAYLFEAKADEETRGRGSEASPISLSLEQSARLPRFASHLRASFVKIPECGTLESLQ 240

Query: 261 GSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDN 320
           G+S+IEAEDRQE IDLALHNYF+VDRYLARGD+FSV I WNC S++CIPC QR+   SD+
Sbjct: 241 GNSSIEAEDRQEMIDLALHNYFKVDRYLARGDLFSVGIKWNCRSVMCIPCSQRMQNASDD 300

Query: 321 IIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTVKILA 380
           II+FKVVA+EP++E VLRVNCT+TALVLGGS+PSA+PPDLLI GS  F+PLQ DTVK+LA
Sbjct: 301 IIHFKVVAMEPADEPVLRVNCTQTALVLGGSVPSAVPPDLLIGGSKGFMPLQADTVKMLA 360

Query: 381 SILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERK 440
           SIL P +CPS L+ K RV VLL+GL G GKRTV+R+VA+RLG+H+VEYSCHNLM+S+ERK
Sbjct: 361 SILTPLVCPSTLASKLRVTVLLYGLAGAGKRTVIRHVAQRLGLHIVEYSCHNLMSSAERK 420

Query: 441 TSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSA 500
           TS ALAQ FNTA  YSPTILLLR FDVFR   + E   NDQVG++SEVASVIR+FTEP  
Sbjct: 421 TSVALAQVFNTAHRYSPTILLLRHFDVFR---TQEGSSNDQVGIASEVASVIRKFTEPVI 477

Query: 501 EDEDEESHGY----FPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQ 556
           EDED  S       F +K+ EKI R QVLLVAAADSSEGLPPTIRRCFSHEI MGPLTE+
Sbjct: 478 EDEDIYSEKKLTSDFQLKDAEKIKRHQVLLVAAADSSEGLPPTIRRCFSHEIRMGPLTEE 537

Query: 557 QRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEV 616
           QR +MLSQ LQ +SEL  +T SE+F+KDI+GQTSGFM RD+ AL+AD GANL+ +   + 
Sbjct: 538 QRAKMLSQSLQSISELLPNTDSEDFIKDIVGQTSGFMLRDMRALIADTGANLMPRC--QT 595

Query: 617 DKNEPGESD--LTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKW 674
           +K EPG +D  L  K   +  S   A QV+GK+DL KA+ERSKKRNASALG PKVPNVKW
Sbjct: 596 NKLEPGGTDNSLRFKAVQDTKSCEEAPQVLGKDDLAKALERSKKRNASALGTPKVPNVKW 655

Query: 675 EDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSL 734
           EDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSL
Sbjct: 656 EDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSL 715

Query: 735 NFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMD 794
           NFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMD
Sbjct: 716 NFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMD 775

Query: 795 RVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERV 854
           RVVSQMLAEIDGLNDS+QDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSD SYRERV
Sbjct: 776 RVVSQMLAEIDGLNDSTQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDTSYRERV 835

Query: 855 LKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRI 914
           LKALTRKF L EDVSLYSIAKKCPPNFTGADMYALCADAWF AAKRKVLS  S+S SS  
Sbjct: 836 LKALTRKFMLHEDVSLYSIAKKCPPNFTGADMYALCADAWFQAAKRKVLSPPSDS-SSME 894

Query: 915 DQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSS 957
           +QADSV++ YDDFVKVLR+L+PSLS+AELKKYE LRDQFEG+S
Sbjct: 895 NQADSVIIRYDDFVKVLRDLTPSLSVAELKKYERLRDQFEGAS 937

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359479743|ref|XP_002269370.2| PREDICTED: peroxisome biogenesis protein 6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131204|ref|XP_002321026.1| predicted protein [Populus trichocarpa] gi|222861799|gb|EEE99341.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255559284|ref|XP_002520662.1| peroxisome assembly factor-2, putative [Ricinus communis] gi|223540047|gb|EEF41624.1| peroxisome assembly factor-2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449498449|ref|XP_004160540.1| PREDICTED: peroxisome biogenesis protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436535|ref|XP_004136048.1| PREDICTED: peroxisome biogenesis protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|124360532|gb|ABN08542.1| AAA ATPase, central region; L-lactate dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|22329309|ref|NP_171799.2| peroxin 6 [Arabidopsis thaliana] gi|75330784|sp|Q8RY16.1|PEX6_ARATH RecName: Full=Peroxisome biogenesis protein 6; AltName: Full=Peroxin-6; Short=AtPEX6 gi|19310449|gb|AAL84960.1| At1g03000/F22D16.27 [Arabidopsis thaliana] gi|24797060|gb|AAN64542.1| At1g03000/F22D16.27 [Arabidopsis thaliana] gi|37223130|gb|AAQ90161.1| AAA family ATPase peroxin 6 [Arabidopsis thaliana] gi|332189392|gb|AEE27513.1| peroxin 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357509313|ref|XP_003624945.1| Peroxisomal biogenesis factor [Medicago truncatula] gi|355499960|gb|AES81163.1| Peroxisomal biogenesis factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|297848522|ref|XP_002892142.1| hypothetical protein ARALYDRAFT_470277 [Arabidopsis lyrata subsp. lyrata] gi|297337984|gb|EFH68401.1| hypothetical protein ARALYDRAFT_470277 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query958
TAIR|locus:2007574941 PEX6 "peroxin 6" [Arabidopsis 0.968 0.986 0.662 6.29999999982e-314
DICTYBASE|DDB_G02927881201 pex6 "peroxin 6" [Dictyosteliu 0.438 0.349 0.474 7.1e-133
RGD|621637978 Pex6 "peroxisomal biogenesis f 0.425 0.417 0.494 1.9e-122
UNIPROTKB|P54777978 Pex6 "Peroxisome assembly fact 0.425 0.417 0.494 1.9e-122
MGI|MGI:2385054981 Pex6 "peroxisomal biogenesis f 0.425 0.415 0.491 1.7e-121
UNIPROTKB|E2RDF7980 PEX6 "Uncharacterized protein" 0.427 0.418 0.491 1.9e-120
UNIPROTKB|Q13608980 PEX6 "Peroxisome assembly fact 0.427 0.418 0.491 8.2e-120
ZFIN|ZDB-GENE-081104-2521071 pex6 "peroxisomal biogenesis f 0.425 0.380 0.498 1.6e-117
UNIPROTKB|F1NYD5680 PEX6 "Uncharacterized protein" 0.427 0.602 0.491 8.6e-117
UNIPROTKB|E1B8F6980 PEX6 "Uncharacterized protein" 0.429 0.419 0.488 8.7e-115
TAIR|locus:2007574 PEX6 "peroxin 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3011 (1065.0 bits), Expect = 6.3e-314, P = 6.3e-314
 Identities = 627/946 (66%), Positives = 727/946 (76%)

Query:    26 MVERRKPLVLSSTKLLINSVLSSSR--RVTGENLV---GDDVSPSLQLPAGILRFSKDKI 80
             MVERR PLVLSST+  + SVL+SS+     G+ ++   GD +  + +L AGILR+ KD  
Sbjct:     1 MVERRNPLVLSSTRSTLRSVLNSSQPSSADGDRVLNKDGDLLRGNARLSAGILRWRKDGE 60

Query:    81 DISDAKFXXXXXXXXXXXXTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPP-TTRK 139
             ++SDAK             T +LK+LS+ SGSLV+VKN E   QR+AQVVVLDPP TT +
Sbjct:    61 NVSDAKLDSLDDSALVGLSTQLLKRLSINSGSLVVVKNIEIGIQRVAQVVVLDPPKTTLE 120

Query:   140 QVCDGDVHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQ 199
                   V    S  TML FP+  L     +LLD++VAYLSP+LAFNL LHIS LK LVH+
Sbjct:   121 DASLTQVPVSDSLHTMLVFPTYDLM--GQQLLDQEVAYLSPMLAFNLSLHISCLKSLVHR 178

Query:   200 GKEVLESLFIAKVDD---GTSGQDGKASLIKLGLQSVGQLPKYASHLRVSFVKIPECGTL 256
             G  VLE  F AK D+   G S +DG  S I L L+ V Q+P YASHLRVSFVKIPECGT+
Sbjct:   179 GNGVLEKYFEAKCDEEFIGKSAEDG--SKIGLDLEPVSQVPGYASHLRVSFVKIPECGTI 236

Query:   257 ESLKGSSAIEAEDRQEKIDLALHNYFEVDRYLARGDVFSVCINWNCSSMICIPCRQRLHR 316
              SLK +S+ EAE+RQ  ID AL  YF  DR L+RGD+F + I+WNC S IC PC QRL  
Sbjct:   237 PSLKVNSSFEAEERQGLIDSALQKYFGTDRQLSRGDIFRIYIDWNCGSSICNPCSQRLCS 296

Query:   317 RSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPPDLLISGSNDFVPLQGDTV 376
              SD+ IYFKV+A+EPS E  LRVN ++TALVLGG++ S LPPDLL+  S   +PLQ +TV
Sbjct:   297 ESDDYIYFKVIAMEPSNERFLRVNHSQTALVLGGTVSSGLPPDLLVYRSKVPMPLQEETV 356

Query:   377 KILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMAS 436
              ILAS+L+P LCPS L+ K RVAVLLHG+PGCGKRTVV+YVARRLG+HVVE+SCH+L+AS
Sbjct:   357 NILASVLSPPLCPSALASKLRVAVLLHGIPGCGKRTVVKYVARRLGLHVVEFSCHSLLAS 416

Query:   437 SERKTSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFT 496
             SERKTS ALAQ FN A+ YSPTILLLR FDVF+NL S +    D+VG+S E+ASVIRE T
Sbjct:   417 SERKTSTALAQTFNMARRYSPTILLLRHFDVFKNLGSQDGSLGDRVGVSFEIASVIRELT 476

Query:   497 EPSAEDE---DEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPTIRRCFSHEISMGPL 553
             EP +  +   +E+S+  F   E+ K    QVLL+A+A+S+EG+ PTIRRCFSHEI MG L
Sbjct:   477 EPVSNGDSSMEEKSNSNFSENEVGKFRGHQVLLIASAESTEGISPTIRRCFSHEIRMGSL 536

Query:   554 TEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSN 613
              ++QR EMLSQ LQ VS+  +   S+EF+K ++GQTSGF+PRDL ALVADAGANL     
Sbjct:   537 NDEQRSEMLSQSLQGVSQFLN-ISSDEFMKGLVGQTSGFLPRDLQALVADAGANLYISQE 595

Query:   614 SEVDKNEPGESDLTAKVAHNDNSSIAATQVM-GKEDLVKAMERSKKRNASALGAPKVPNV 672
             SE  K      DL     H  +    +T+ +  KED  KA++RSKKRNASALGAPKVPNV
Sbjct:   596 SETKKINSLSDDLHGVDIHQASQIDNSTEKLTAKEDFTKALDRSKKRNASALGAPKVPNV 655

Query:   673 KWEDVGGLEDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATEC 732
             KW+DVGGLEDVK SILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATEC
Sbjct:   656 KWDDVGGLEDVKTSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATEC 715

Query:   733 SLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGV 792
             SLNFLSVKGPELINMYIGESEKNVRDIF+KARSARPCVIFFDELDSLAPARGASGDSGGV
Sbjct:   716 SLNFLSVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGASGDSGGV 775

Query:   793 MDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRE 852
             MDRVVSQMLAEIDGL+DSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVN+D SYRE
Sbjct:   776 MDRVVSQMLAEIDGLSDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNADASYRE 835

Query:   853 RVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLXXXXXXXXX 912
             RVLKALTRKFKL EDVSLYS+AKKCP  FTGADMYALCADAWF AAKRKV          
Sbjct:   836 RVLKALTRKFKLSEDVSLYSVAKKCPSTFTGADMYALCADAWFQAAKRKVSKSDSGDMPT 895

Query:   913 RIDQADSVVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGSSN 958
               D  DSVVVEY DF+K + +LSPSLS+ ELKKYE+LRDQF+G S+
Sbjct:   896 EEDDPDSVVVEYVDFIKAMDQLSPSLSITELKKYEMLRDQFQGRSS 941
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0016558 "protein import into peroxisome matrix" evidence=IMP
GO:0006635 "fatty acid beta-oxidation" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
DICTYBASE|DDB_G0292788 pex6 "peroxin 6" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|621637 Pex6 "peroxisomal biogenesis factor 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P54777 Pex6 "Peroxisome assembly factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2385054 Pex6 "peroxisomal biogenesis factor 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDF7 PEX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13608 PEX6 "Peroxisome assembly factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-252 pex6 "peroxisomal biogenesis factor 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYD5 PEX6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B8F6 PEX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RY16PEX6_ARATHNo assigned EC number0.67650.96550.9829yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023563001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (921 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 9e-94
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-88
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-74
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-71
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-64
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-64
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 9e-58
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 4e-56
pfam00004131 pfam00004, AAA, ATPase family associated with vari 1e-55
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 8e-49
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-47
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 4e-46
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-45
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-45
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-36
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 3e-33
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-25
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 8e-21
smart00382148 smart00382, AAA, ATPases associated with a variety 6e-17
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-11
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 5e-09
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein 2e-08
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-08
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 4e-06
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 4e-06
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 4e-05
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 5e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 6e-05
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-04
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 1e-04
pfam13481154 pfam13481, AAA_25, AAA domain 4e-04
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacteria 5e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-04
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 8e-04
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 9e-04
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.001
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 0.002
pfam09848348 pfam09848, DUF2075, Uncharacterized conserved prot 0.003
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 0.003
pfam01057271 pfam01057, Parvo_NS1, Parvovirus non-structural pr 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  312 bits (801), Expect = 9e-94
 Identities = 188/561 (33%), Positives = 303/561 (54%), Gaps = 53/561 (9%)

Query: 400 VLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTI 459
           VLL+G PG GK  + + VA   G + +  +   +M+    ++   L + F  A+  +P+I
Sbjct: 215 VLLYGPPGTGKTLLAKAVANEAGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSI 274

Query: 460 LLLRDFDVF---RNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEI 516
           + + + D     R  V+ E     +  + +++ +++                        
Sbjct: 275 IFIDEIDAIAPKREEVTGEV----EKRVVAQLLTLMDGLKG------------------- 311

Query: 517 EKICRQQVLLVAAADSSEGLPPTIRRC--FSHEISMGPLTEQQRVEMLSQLLQPVSELTS 574
               R +V+++ A +  + L P +RR   F  EI +    ++ R E+L ++      L  
Sbjct: 312 ----RGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEIL-KVHTRNMPLAE 366

Query: 575 DTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTAKVAHND 634
           D   ++  +     T GF+  DL AL  +A    +R+   E   N   E  + A+V    
Sbjct: 367 DVDLDKLAE----VTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEE-IPAEVLKE- 420

Query: 635 NSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLP 694
              +  T     E L K +E S  R        +VPNV+W D+GGLE+VK+ + + V+ P
Sbjct: 421 ---LKVTMKDFMEAL-KMVEPSAIREVLV----EVPNVRWSDIGGLEEVKQELREAVEWP 472

Query: 695 LLHKDLFSS-GLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESE 753
           L H ++F   G+R   GVLL+GPPGTGKTLLAKAVATE   NF++V+GPE+++ ++GESE
Sbjct: 473 LKHPEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESE 532

Query: 754 KNVRDIFQKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLNDSSQD 813
           K +R+IF+KAR A P +IFFDE+D++APARGA  D+  V DR+V+Q+L E+DG+ + S +
Sbjct: 533 KAIREIFRKARQAAPAIIFFDEIDAIAPARGARFDT-SVTDRIVNQLLTEMDGIQELS-N 590

Query: 814 LFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSI 873
           + +I A+NRPD++DPALLRPGRFD+L+ V    D   R+ + K  TR   L EDV L  +
Sbjct: 591 VVVIAATNRPDILDPALLRPGRFDRLILVPP-PDEEARKEIFKIHTRSMPLAEDVDLEEL 649

Query: 874 AKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNS-DSSRIDQADSVVVEYDDFVKVLR 932
           A+     +TGAD+ A+C +A   A +  + S      +    +    + VE   F++ L+
Sbjct: 650 AEMT-EGYTGADIEAVCREAAMAALRESIGSPAKEKLEVGEEEFLKDLKVEMRHFLEALK 708

Query: 933 ELSPSLSMAELKKYELLRDQF 953
           ++ PS+S  ++ +YE L  + 
Sbjct: 709 KVKPSVSKEDMLRYERLAKEL 729

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|220440 pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 958
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.97
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.97
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.96
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.96
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.96
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.96
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.96
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.96
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.96
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.96
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.96
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.95
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.95
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.95
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.94
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.94
PRK03992389 proteasome-activating nucleotidase; Provisional 99.93
CHL00195489 ycf46 Ycf46; Provisional 99.93
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.93
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.93
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.92
CHL00095821 clpC Clp protease ATP binding subunit 99.92
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.91
PRK10865 857 protein disaggregation chaperone; Provisional 99.91
CHL002062281 ycf2 Ycf2; Provisional 99.91
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.91
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.9
CHL00176638 ftsH cell division protein; Validated 99.9
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.89
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.89
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.89
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.89
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.87
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.86
PF00004132 AAA: ATPase family associated with various cellula 99.86
CHL00181287 cbbX CbbX; Provisional 99.82
COG0488530 Uup ATPase components of ABC transporters with dup 99.81
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.81
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.79
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.78
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.77
PF00004132 AAA: ATPase family associated with various cellula 99.69
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.68
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.67
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.63
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.62
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.61
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.59
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.58
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.57
CHL00181287 cbbX CbbX; Provisional 99.56
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.52
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.49
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.48
PRK10865 857 protein disaggregation chaperone; Provisional 99.47
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.46
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.46
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.45
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.44
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.43
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.43
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.43
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.42
CHL00095 821 clpC Clp protease ATP binding subunit 99.42
KOG0062582 consensus ATPase component of ABC transporters wit 99.41
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.41
PLN03073718 ABC transporter F family; Provisional 99.39
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.39
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.37
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.36
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.36
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.35
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.35
PRK13342 413 recombination factor protein RarA; Reviewed 99.34
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.33
COG1123539 ATPase components of various ABC-type transport sy 99.33
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.33
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.33
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.31
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.3
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.3
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.29
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.29
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK00149450 dnaA chromosomal replication initiation protein; R 99.28
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.27
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.26
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.26
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.25
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK04195 482 replication factor C large subunit; Provisional 99.25
PRK11147635 ABC transporter ATPase component; Reviewed 99.24
PRK12402337 replication factor C small subunit 2; Reviewed 99.24
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.23
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.23
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.23
PLN03025319 replication factor C subunit; Provisional 99.21
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.19
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.18
PRK06893229 DNA replication initiation factor; Validated 99.18
PHA02544316 44 clamp loader, small subunit; Provisional 99.18
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.18
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.18
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.18
PRK14086617 dnaA chromosomal replication initiation protein; P 99.18
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.16
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.16
PRK12422445 chromosomal replication initiation protein; Provis 99.15
PRK13341 725 recombination factor protein RarA/unknown domain f 99.14
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.14
PRK14088440 dnaA chromosomal replication initiation protein; P 99.14
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.14
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.14
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.13
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.12
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.11
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.11
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.1
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.09
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.09
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.08
KOG2028 554 consensus ATPase related to the helicase subunit o 99.08
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.08
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.07
PRK10938490 putative molybdenum transport ATP-binding protein 99.05
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.05
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.05
PRK08084235 DNA replication initiation factor; Provisional 99.05
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.04
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.04
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.04
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.04
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.03
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.02
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.01
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.01
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.0
PRK00440319 rfc replication factor C small subunit; Reviewed 99.0
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.0
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK14087450 dnaA chromosomal replication initiation protein; P 98.99
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK00149450 dnaA chromosomal replication initiation protein; R 98.99
PRK04195482 replication factor C large subunit; Provisional 98.98
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.98
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.98
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.98
smart00382148 AAA ATPases associated with a variety of cellular 98.98
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.98
PRK08727233 hypothetical protein; Validated 98.98
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.98
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.98
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.98
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.98
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.97
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.97
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.97
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.97
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.96
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.96
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.96
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.95
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.95
PRK13342413 recombination factor protein RarA; Reviewed 98.95
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.94
PHA02544316 44 clamp loader, small subunit; Provisional 98.94
COG4172534 ABC-type uncharacterized transport system, duplica 98.94
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.93
PTZ001121164 origin recognition complex 1 protein; Provisional 98.93
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.92
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.92
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 98.92
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.91
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.91
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.9
PRK06893229 DNA replication initiation factor; Validated 98.9
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.9
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.9
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.9
PRK05642234 DNA replication initiation factor; Validated 98.89
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.89
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.89
COG0714329 MoxR-like ATPases [General function prediction onl 98.88
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.88
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.88
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.87
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.87
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.87
PRK06620214 hypothetical protein; Validated 98.86
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 98.86
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.86
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.86
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.86
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.86
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.85
PRK14088440 dnaA chromosomal replication initiation protein; P 98.85
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK12422445 chromosomal replication initiation protein; Provis 98.85
PHA02244383 ATPase-like protein 98.83
PRK13409590 putative ATPase RIL; Provisional 98.83
PRK07940394 DNA polymerase III subunit delta'; Validated 98.83
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.82
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.82
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.82
PLN03025319 replication factor C subunit; Provisional 98.81
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.81
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.8
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.8
PRK12402337 replication factor C small subunit 2; Reviewed 98.79
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.79
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.79
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.78
PRK14086617 dnaA chromosomal replication initiation protein; P 98.78
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.78
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.78
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.78
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.77
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.77
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.76
smart00382148 AAA ATPases associated with a variety of cellular 98.76
PRK08084235 DNA replication initiation factor; Provisional 98.76
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.75
KOG2028554 consensus ATPase related to the helicase subunit o 98.74
PRK13341 725 recombination factor protein RarA/unknown domain f 98.74
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 98.73
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.73
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.73
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.72
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.72
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.7
PRK08727233 hypothetical protein; Validated 98.69
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.68
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.68
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.68
PRK06620214 hypothetical protein; Validated 98.67
PHA02244383 ATPase-like protein 98.67
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.67
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.66
PRK09112351 DNA polymerase III subunit delta'; Validated 98.66
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.66
COG0714329 MoxR-like ATPases [General function prediction onl 98.66
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.66
PRK09087226 hypothetical protein; Validated 98.65
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.65
PRK05642234 DNA replication initiation factor; Validated 98.64
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.64
PRK13531 498 regulatory ATPase RavA; Provisional 98.64
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.63
COG0488530 Uup ATPase components of ABC transporters with dup 98.63
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.62
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.62
PRK05564313 DNA polymerase III subunit delta'; Validated 98.62
PRK04132846 replication factor C small subunit; Provisional 98.61
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.61
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.61
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 98.61
PRK05707328 DNA polymerase III subunit delta'; Validated 98.61
PF07726131 AAA_3: ATPase family associated with various cellu 98.6
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.59
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.58
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.58
COG0593408 DnaA ATPase involved in DNA replication initiation 98.58
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 98.58
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.57
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.56
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.56
PRK09087226 hypothetical protein; Validated 98.55
PRK00440319 rfc replication factor C small subunit; Reviewed 98.54
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.54
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 98.53
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 98.53
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 98.52
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.52
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.51
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.51
smart00350509 MCM minichromosome maintenance proteins. 98.51
PRK09862506 putative ATP-dependent protease; Provisional 98.49
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.49
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.49
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 98.49
PRK14087450 dnaA chromosomal replication initiation protein; P 98.49
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.49
PRK06964342 DNA polymerase III subunit delta'; Validated 98.49
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 98.48
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.48
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.48
PRK07471365 DNA polymerase III subunit delta'; Validated 98.47
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.47
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.46
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.45
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.45
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.45
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.44
PRK11608326 pspF phage shock protein operon transcriptional ac 98.44
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.43
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.41
PRK13765 637 ATP-dependent protease Lon; Provisional 98.41
PRK07399314 DNA polymerase III subunit delta'; Validated 98.39
COG4619223 ABC-type uncharacterized transport system, ATPase 98.39
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.38
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.38
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.37
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.36
PRK08058329 DNA polymerase III subunit delta'; Validated 98.35
COG4172534 ABC-type uncharacterized transport system, duplica 98.35
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.35
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.34
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 98.34
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.34
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.34
PRK08181269 transposase; Validated 98.34
PRK04132846 replication factor C small subunit; Provisional 98.33
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.32
PRK06871325 DNA polymerase III subunit delta'; Validated 98.32
COG0593408 DnaA ATPase involved in DNA replication initiation 98.31
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.31
COG2204464 AtoC Response regulator containing CheY-like recei 98.31
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.31
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 98.3
PRK05707328 DNA polymerase III subunit delta'; Validated 98.3
PRK09183259 transposase/IS protein; Provisional 98.3
COG1221403 PspF Transcriptional regulators containing an AAA- 98.29
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.29
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.29
PRK07993334 DNA polymerase III subunit delta'; Validated 98.29
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.29
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.28
PRK15424538 propionate catabolism operon regulatory protein Pr 98.28
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.28
PF07726131 AAA_3: ATPase family associated with various cellu 98.28
PRK08116268 hypothetical protein; Validated 98.28
COG1123539 ATPase components of various ABC-type transport sy 98.26
PRK06526254 transposase; Provisional 98.25
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.24
PRK13531498 regulatory ATPase RavA; Provisional 98.24
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.24
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.23
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.23
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.22
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.22
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.22
COG1129500 MglA ABC-type sugar transport system, ATPase compo 98.21
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.2
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 98.2
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.19
PRK07952244 DNA replication protein DnaC; Validated 98.18
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.18
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.16
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.16
PRK08769319 DNA polymerase III subunit delta'; Validated 98.15
PRK06090319 DNA polymerase III subunit delta'; Validated 98.15
PRK12377248 putative replication protein; Provisional 98.15
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.15
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.14
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.14
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.12
PRK11147635 ABC transporter ATPase component; Reviewed 98.12
PRK09112351 DNA polymerase III subunit delta'; Validated 98.11
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.11
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.11
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.1
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.1
PRK08699325 DNA polymerase III subunit delta'; Validated 98.1
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.1
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.1
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.1
COG4525259 TauB ABC-type taurine transport system, ATPase com 98.09
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.09
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.08
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.08
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 98.08
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.08
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 98.08
PRK08939306 primosomal protein DnaI; Reviewed 98.07
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.06
COG4559259 ABC-type hemin transport system, ATPase component 98.06
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.06
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.05
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.05
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.05
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.05
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 98.03
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.03
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.03
PRK06835329 DNA replication protein DnaC; Validated 98.03
COG3638258 ABC-type phosphate/phosphonate transport system, A 98.03
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.02
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.02
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.02
PF13173128 AAA_14: AAA domain 98.02
KOG2680 454 consensus DNA helicase TIP49, TBP-interacting prot 98.01
PRK06964342 DNA polymerase III subunit delta'; Validated 98.01
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.01
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.01
PF13173128 AAA_14: AAA domain 98.01
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.0
PRK07471365 DNA polymerase III subunit delta'; Validated 98.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.0
PRK06921266 hypothetical protein; Provisional 98.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.99
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.99
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.99
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.99
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.99
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.99
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 97.99
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.98
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 97.98
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.98
smart00350509 MCM minichromosome maintenance proteins. 97.98
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.97
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 97.97
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 97.97
PRK05564313 DNA polymerase III subunit delta'; Validated 97.97
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 97.96
COG4586325 ABC-type uncharacterized transport system, ATPase 97.96
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 97.96
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.96
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.95
COG1127263 Ttg2A ABC-type transport system involved in resist 97.95
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 97.95
PRK08058329 DNA polymerase III subunit delta'; Validated 97.95
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.95
KOG0927614 consensus Predicted transporter (ABC superfamily) 97.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.95
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.95
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.94
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.94
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.93
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.93
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 97.93
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.93
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 97.93
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.92
PRK06871325 DNA polymerase III subunit delta'; Validated 97.92
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 97.92
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 97.91
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 97.91
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.91
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.91
COG4148352 ModC ABC-type molybdate transport system, ATPase c 97.91
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.91
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.91
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.9
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.9
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 97.9
PRK10261623 glutathione transporter ATP-binding protein; Provi 97.9
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.89
PRK09473330 oppD oligopeptide transporter ATP-binding componen 97.89
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-122  Score=1048.11  Aligned_cols=887  Identities=43%  Similarity=0.599  Sum_probs=718.1

Q ss_pred             hhccccceEeechhHHhhhhccCCccccCCCCCCCCCCC-----CCCccccccccccCccccccccccCCCCceEEeecH
Q 002159           26 MVERRKPLVLSSTKLLINSVLSSSRRVTGENLVGDDVSP-----SLQLPAGILRFSKDKIDISDAKFASLDDSALLGLST  100 (958)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~v~l~~  100 (958)
                      |++|+.||.+.+++....++++.+-+....-.+|....+     .-.+..|++++.++..  -+++..+.|++++..+.+
T Consensus         1 ~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~~~~r~~~~~~~~~~~~i~~~~~~~~~~--~~~~~~tld~~~~~~~~~   78 (953)
T KOG0736|consen    1 MLRRLEPLPTETPPLAVRLPPGGSWPAAALGLVGALRPAGYSPGGTALLIAALEGPDAGT--EDALLRTLDLSSGAWLLA   78 (953)
T ss_pred             CccccccCCCCCCchhhhccCCCCcchhhhcccccccccccCCCCCCcceEEEecCCCCc--ccccccccccccccchhh
Confidence            778889999999999999999998876666556653333     5688899999998763  388899999999999999


Q ss_pred             hhhhhccccccceEEEe---------------------------------ecCCCcceEEEEEEecCCCCCccccCCCCc
Q 002159          101 CVLKQLSVTSGSLVLVK---------------------------------NAETTKQRIAQVVVLDPPTTRKQVCDGDVH  147 (958)
Q Consensus       101 ~~l~~l~~~~g~~v~v~---------------------------------~~~~~~~r~~~~~~l~~~~~~~~~~~~~~~  147 (958)
                      .+++++.+.+++..-..                                 |.-.... ++++++..++.....+-..+-.
T Consensus        79 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~i~el~~~~n~~~~e~~~~~~~il~~g~-l~~~v~~~~~k~~~~~~~~t~~  157 (953)
T KOG0736|consen   79 RAVRRLPINSVSLDGQSLGLGQDVGQDLVRIQELLPGYNIRVLETRPALQNILGPGT-LAQTVVRSEAKLCLERFDSTQP  157 (953)
T ss_pred             cceeeccccceEeecccccccCCchhHHHHHHHHhhcCCchhheecccccceeccce-EEEEEEccccccccccccccCC
Confidence            99999999888765321                                 1111222 7888887777655554332222


Q ss_pred             cCCCC---CcccccCCCCCCCCccccccCceEEeCHhhHhhccCCcccchhheecCccceeEEEEEecCCCCCCCCC-CC
Q 002159          148 SKHSS---PTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDG-KA  223 (958)
Q Consensus       148 ~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~lsp~~~~nL~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~-~~  223 (958)
                      ..+.+   +.|..++....-  +-...+.+|++-.+...+|..++..|+..++|.|+.-..-++.....+.-..... -.
T Consensus       158 p~~~~~~~~~l~~~~~~~~~--~lv~~s~~v~~~~~~~~~~c~~~~v~~~~lv~~g~~~~~~~~~~~~~e~~l~~~~~~g  235 (953)
T KOG0736|consen  158 PPPVSKFISSLLVNEEQELL--GLVGDSQEVARSILRGLGNCSLEWVLLAQLVHIGNTNQPDLGTVQVIEPRLDVSARLG  235 (953)
T ss_pred             CchhHHHHHHHhhcchhhhh--hccccchHHHHhhhcccccceeeeeehhhhhhcCCCCCcchhhhhhhHhhhccccccc
Confidence            21111   334444443322  2224456666767777788888878888899988876655554333322111111 11


Q ss_pred             ceeEEEEEecC--------CCCCcceeeEEE------eeecC--CCCccccccCCchhhhhhh----HHHHHHHHHhhcc
Q 002159          224 SLIKLGLQSVG--------QLPKYASHLRVS------FVKIP--ECGTLESLKGSSAIEAEDR----QEKIDLALHNYFE  283 (958)
Q Consensus       224 ~~~~~~~~~~~--------~~p~~~~~~rv~------~~~~p--~~~~~~~~~~~~~~~~~~~----~~~~~~~l~~~f~  283 (958)
                      ..+.+...||.        .+|-|+.+.||+      ++.++  .++++-+...++.+..+..    +++++..|++||+
T Consensus       236 s~~~~~~~~~s~~~~~~~~~~~~~~~~~ri~~~~~~~i~~~~k~~~~~ip~~~~~~~f~~~~~~h~~~~~~~~~l~~~f~  315 (953)
T KOG0736|consen  236 SGIGLDSEPLSPGLALVQETLPNYAGEDRIQRFLVCSIVPEDKASEGTIPGPPTASEFHIEIVSHYSAGNIDVVLKKHFK  315 (953)
T ss_pred             cccccCccccCcchhhhhhhcccccchHhHhhhcccccccccccccccCCCcccchheeeeccchhhhhHHHHHHHHHhC
Confidence            12223333443        245567766766      65566  5677777766666653333    4999999999999


Q ss_pred             CCCeeecCCEEEEecccCCCCccccccccccCCCCCceEEEEEEEEecCCCeEEEEcCCceEEEEcCCCCCCCC--CCcc
Q 002159          284 VDRYLARGDVFSVCINWNCSSMICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALP--PDLL  361 (958)
Q Consensus       284 ~~r~~~~gd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~v~~~~~~~~~~~~vd~~~T~l~~~~~~~~~~~--~~~~  361 (958)
                      ++|.++.||+|+|+++|+++.+.+.++ ..+....+..|||+|++++|..+..+++++++|++|+++.+++.+|  |..+
T Consensus       316 t~ril~~gdvf~i~~~~~~~~~~~~~~-l~l~~~~d~~v~~~v~~~ep~~~~~~~i~~~~T~lv~~~~~ss~~~~lps~~  394 (953)
T KOG0736|consen  316 TPRILQSGDVFCIPINSQMANLNGYPE-LPLWRETDFLVYKKVIEAEPGNESAYIIDTNHTSLVLVGATSSRVPLLPSSL  394 (953)
T ss_pred             cceeeecCCEEEEeehhhhcccccchh-hHhhhhccceeEEEEeecCCCccceEEEcCCCceEEEccccccCCcCCChhh
Confidence            999999999999999999888877666 3333346789999999999988889999999999999999998733  1222


Q ss_pred             cccCC-CCcCCchHHHHHHHHHHhhcCCCcccCCCCCceEEEEcCCCChHHHHHHHHHHHhCCcEEEEecCcccccchhc
Q 002159          362 ISGSN-DFVPLQGDTVKILASILAPTLCPSVLSLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERK  440 (958)
Q Consensus       362 ~~~~~-~~~~l~~~~~k~L~~ii~p~l~p~~~~~~~~~~VLL~GppGtGKTTLaraIA~~lg~~~~~I~~~~l~s~~~g~  440 (958)
                      ...++ ...+..+..+..+.++++|.+.|+...++....+||+|+|||||||+++++|.++|.|+++++|.++.+...+.
T Consensus       395 ~~l~n~~~~~~~~~~~~~l~~vl~p~~~~s~~~~~~~~~vLLhG~~g~GK~t~V~~vas~lg~h~~evdc~el~~~s~~~  474 (953)
T KOG0736|consen  395 STLWNSLSPPGLEAKVLELVAVLSPQKQPSGALLTLNPSVLLHGPPGSGKTTVVRAVASELGLHLLEVDCYELVAESASH  474 (953)
T ss_pred             HHHhccCCCccchHHHHHHHHHhCcccCcchhccccceEEEEeCCCCCChHHHHHHHHHHhCCceEeccHHHHhhcccch
Confidence            11222 23333344556788999999999988888899999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhhcCCCeEEeecchhhhhhcccCCCCCCccccchHHHHHHHHHhcCCCCCccccccCCCCchhhhhhhh
Q 002159          441 TSAALAQAFNTAQSYSPTILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKIC  520 (958)
Q Consensus       441 ~e~~l~~~f~~A~~~~P~IL~iDeid~L~~~~s~~~~~~~~~~~~~~v~~~L~~l~~~l~~~~~~~~~g~~~~~~~~~~~  520 (958)
                      ++.++.+.|+.|+.+.|+|||+.++|.+.-.  +++      +..-++.+.++..+.                .++....
T Consensus       475 ~etkl~~~f~~a~~~~pavifl~~~dvl~id--~dg------ged~rl~~~i~~~ls----------------~e~~~~~  530 (953)
T KOG0736|consen  475 TETKLQAIFSRARRCSPAVLFLRNLDVLGID--QDG------GEDARLLKVIRHLLS----------------NEDFKFS  530 (953)
T ss_pred             hHHHHHHHHHHHhhcCceEEEEeccceeeec--CCC------chhHHHHHHHHHHHh----------------cccccCC
Confidence            9999999999999999999999999999842  221      334456666666543                2233445


Q ss_pred             cCcEEEEEecCCCCCCChhhhccccEEEEcCCCCHHHHHHHHHHhccCCcccCCCCCcHHHHHHHhhhcCCCChhhHHHH
Q 002159          521 RQQVLLVAAADSSEGLPPTIRRCFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHAL  600 (958)
Q Consensus       521 ~~~ViVIaaTn~~~~Ld~alrrrf~~eIsig~Pde~qR~~Il~~ll~~~~~l~~D~~~~~~L~~la~~t~Gfv~~DL~~L  600 (958)
                      ..+++|||+|++.+.+|+.+++.|.++|.++.|+++||.+|+++++....     ...+..++.++.+|.||+.+|+..|
T Consensus       531 ~~~~ivv~t~~s~~~lp~~i~~~f~~ei~~~~lse~qRl~iLq~y~~~~~-----~n~~v~~k~~a~~t~gfs~~~L~~l  605 (953)
T KOG0736|consen  531 CPPVIVVATTSSIEDLPADIQSLFLHEIEVPALSEEQRLEILQWYLNHLP-----LNQDVNLKQLARKTSGFSFGDLEAL  605 (953)
T ss_pred             CCceEEEEeccccccCCHHHHHhhhhhccCCCCCHHHHHHHHHHHHhccc-----cchHHHHHHHHHhcCCCCHHHHHHH
Confidence            88999999999999999999999999999999999999999999997543     3456788999999999999999999


Q ss_pred             HHHHHHHHHHhhccccccCCCCcchhhHHhhhcCcchhhhhccccHHHHHHHHHhhcccccccCCCCCCCCccccccccc
Q 002159          601 VADAGANLIRKSNSEVDKNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGL  680 (958)
Q Consensus       601 v~eA~~~a~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ed~~~al~~~~~~~~s~l~~~~~p~v~~~di~Gl  680 (958)
                      .......+..+....--        ...-..+...........++++||.+++.+.++.++.++++|++|+|+|+||||+
T Consensus       606 ~~~~s~~~~~~i~~~~l--------~g~~~~~~~~~~~~~~~~l~~edf~kals~~~~~fs~aiGAPKIPnV~WdDVGGL  677 (953)
T KOG0736|consen  606 VAHSSLAAKTRIKNKGL--------AGGLQEEDEGELCAAGFLLTEEDFDKALSRLQKEFSDAIGAPKIPNVSWDDVGGL  677 (953)
T ss_pred             hcCchHHHHHHHHhhcc--------cccchhccccccccccceecHHHHHHHHHHHHHhhhhhcCCCCCCccchhcccCH
Confidence            98774444333211100        0000011122233456789999999999999999999999999999999999999


Q ss_pred             cccccccceeeeccccchhhhhcCCCCCCcEEEecCCCChhHHHHHHHHHHcCCceeeeccchhhhccccchhhhHHHHH
Q 002159          681 EDVKKSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIF  760 (958)
Q Consensus       681 ~~vk~~l~e~i~~~l~~~~~~~~~i~~~~~iLL~GppGtGKTtLakaiA~~~~~~~i~v~~~~l~~~~~Gese~~vr~lf  760 (958)
                      +++|.++.+.+++|++|+++|..|++++.|||||||||||||++|||+|+||..+|++|+||||++||+||+|+|+|++|
T Consensus       678 eevK~eIldTIqlPL~hpeLfssglrkRSGILLYGPPGTGKTLlAKAVATEcsL~FlSVKGPELLNMYVGqSE~NVR~VF  757 (953)
T KOG0736|consen  678 EEVKTEILDTIQLPLKHPELFSSGLRKRSGILLYGPPGTGKTLLAKAVATECSLNFLSVKGPELLNMYVGQSEENVREVF  757 (953)
T ss_pred             HHHHHHHHHHhcCcccChhhhhccccccceeEEECCCCCchHHHHHHHHhhceeeEEeecCHHHHHHHhcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCcEEEEcccccccCCCCCCCCCcchHHHHHHHHHHhhcCCCC-CCCcEEEEEecCCCCCCChhhcCcCCccce
Q 002159          761 QKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVVSQMLAEIDGLND-SSQDLFIIGASNRPDLIDPALLRPGRFDKL  839 (958)
Q Consensus       761 ~~A~~~~P~ILfiDEiD~l~~~r~~~~~~~~~~~rv~~~LL~~ldg~~~-~~~~v~VI~aTNrp~~ldpaLlrpgRfd~~  839 (958)
                      ++||.++||||||||+|+++|+||.+||++|+|+|+++|||+||||+.. +.+.|||||||||||+|||||+||||||+.
T Consensus       758 erAR~A~PCVIFFDELDSlAP~RG~sGDSGGVMDRVVSQLLAELDgls~~~s~~VFViGATNRPDLLDpALLRPGRFDKL  837 (953)
T KOG0736|consen  758 ERARSAAPCVIFFDELDSLAPNRGRSGDSGGVMDRVVSQLLAELDGLSDSSSQDVFVIGATNRPDLLDPALLRPGRFDKL  837 (953)
T ss_pred             HHhhccCCeEEEeccccccCccCCCCCCccccHHHHHHHHHHHhhcccCCCCCceEEEecCCCccccChhhcCCCcccee
Confidence            9999999999999999999999999999999999999999999999986 568899999999999999999999999999


Q ss_pred             eeccCCCCHHHHHHHHHHHHhhccCCCCcCHHHHHhhCCCCCCHHHHHHHHHHHHHHHHHHHhcccCCCCCccccccCCc
Q 002159          840 LYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSDSSRIDQADS  919 (958)
Q Consensus       840 I~v~~ppd~~~r~~Il~~~~~~~~~~~d~~l~~la~~~t~g~sGaDi~~l~~~A~~~A~~r~~~~~~~~~~~~~~~~~~~  919 (958)
                      +|++++.|.+.+..||++++|++.++++||+.++|++|...|||||++++|++|++.|++|.+...+.....+.+.+...
T Consensus       838 vyvG~~~d~esk~~vL~AlTrkFkLdedVdL~eiAk~cp~~~TGADlYsLCSdA~l~AikR~i~~ie~g~~~~~e~~~~~  917 (953)
T KOG0736|consen  838 VYVGPNEDAESKLRVLEALTRKFKLDEDVDLVEIAKKCPPNMTGADLYSLCSDAMLAAIKRTIHDIESGTISEEEQESSS  917 (953)
T ss_pred             EEecCCccHHHHHHHHHHHHHHccCCCCcCHHHHHhhCCcCCchhHHHHHHHHHHHHHHHHHHHHhhhccccccccCCce
Confidence            99999999999999999999999999999999999999999999999999999999999999987776544445556677


Q ss_pred             ccccHHHHHHHHHHhCCCCCHHHHHHHHHHHHHhhc
Q 002159          920 VVVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEG  955 (958)
Q Consensus       920 ~~i~~~df~~al~~~~ps~s~~~l~~y~~~~~~~~~  955 (958)
                      +.|+++||.+|+++++||+|++||.+||+++.+|++
T Consensus       918 v~V~~eDflks~~~l~PSvS~~EL~~ye~vr~~fs~  953 (953)
T KOG0736|consen  918 VRVTMEDFLKSAKRLQPSVSEQELLRYEMVRAQFSG  953 (953)
T ss_pred             EEEEHHHHHHHHHhcCCcccHHHHHHHHHHHHhhcC
Confidence            899999999999999999999999999999999974

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-74
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 4e-47
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-74
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 7e-47
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-63
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 6e-58
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-51
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 4e-47
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 5e-47
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 5e-47
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 4e-46
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 8e-44
2ce7_A 476 Edta Treated Length = 476 2e-43
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 1e-42
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-42
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 4e-42
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 2e-41
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 1e-40
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 6e-40
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 6e-38
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-38
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 7e-38
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 1e-37
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 3e-37
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 6e-37
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-37
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-37
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-36
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-36
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-36
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 6e-35
1xwi_A322 Crystal Structure Of Vps4b Length = 322 5e-33
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 6e-33
3b9p_A297 Spastin Length = 297 8e-32
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-30
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure 
Iteration: 1

 Score =  278 bits (711), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 201/580 (34%), Positives = 302/580 (52%), Gaps = 76/580 (13%)
Query: 399 AVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPT 458
            +LL+G PG GK  + R VA   G      +   +M+    ++ + L +AF  A+  +P 
Sbjct: 240 GILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA 299
Query: 459 ILLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEK 518
           I+ + + D                                    + E++HG    + + +
Sbjct: 300 IIFIDELDAI--------------------------------APKREKTHGEVERRIVSQ 327
Query: 519 IC--------RQQVLLVAAADSSEGLPPTIRRC--FSHEISMGPLTEQQRVEMLSQLLQP 568
           +         R  V+++AA +    + P +RR   F  E+ +G      R+E+L Q+   
Sbjct: 328 LLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEIL-QIHTK 386
Query: 569 VSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVDKNEPGESDLTA 628
             +L  D   E+    +  +T G +  DL AL ++A    IRK    +D  +     + A
Sbjct: 387 NMKLADDVDLEQ----VANETHGHVGADLAALCSEAALQAIRKKMDLIDLED---ETIDA 439
Query: 629 KVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAP--KVPNVKWEDVGGLEDVKKS 686
           +V +    S+A T     +D   A+ +S   N SAL     +VP V WED+GGLEDVK+ 
Sbjct: 440 EVMN----SLAVTM----DDFRWALSQS---NPSALRETVVEVPQVTWEDIGGLEDVKRE 488
Query: 687 ILDTVQLPLLHKDLF-SSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELI 745
           + + VQ P+ H D F   G+    GVL YGPPG GKTLLAKA+A EC  NF+S+KGPEL+
Sbjct: 489 LQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELL 548
Query: 746 NMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPAR-GASGDSGGVMDRVVSQMLAEI 804
            M+ GESE NVR+IF KAR A PCV+FFDELDS+A AR G  GD GG  DRV++Q+L E+
Sbjct: 549 TMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEM 608
Query: 805 DGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKL 864
           DG++ + +++FIIGA+NRPD+IDPA+LRPGR D+L+Y+ +  D   R  +LKA  RK  +
Sbjct: 609 DGMS-TKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPL-PDEKSRVAILKANLRKSPV 666
Query: 865 LEDVSLYSIAKKCPPNFTGADMYALCADAWFHA-------AKRKVLXXXXXXXXXRIDQA 917
            +DV L  +AK     F+GAD+  +C  A   A         R+            +++ 
Sbjct: 667 AKDVDLEFLAKMT-NGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEED 725
Query: 918 DSV-VVEYDDFVKVLRELSPSLSMAELKKYELLRDQFEGS 956
           D V  +  D F + +R    S+S  +++KYE+     + S
Sbjct: 726 DPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQS 765
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 0.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-13
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-149
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-136
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-96
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-93
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-92
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-21
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 3e-90
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-88
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-86
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 5e-05
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-86
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-04
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 9e-85
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 9e-85
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 3e-05
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-72
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-60
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-57
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-57
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-57
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-57
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-54
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 6e-05
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-51
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-51
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 4e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-10
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 5e-10
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 3e-04
3kw6_A78 26S protease regulatory subunit 8; structural geno 6e-08
2krk_A86 26S protease regulatory subunit 8; structural geno 1e-07
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 5e-07
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 1e-06
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 1e-06
3pvs_A 447 Replication-associated recombination protein A; ma 2e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 4e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 8e-05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 3e-04
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 1e-04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 2e-04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 2e-04
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 2e-04
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 2e-04
2qgz_A308 Helicase loader, putative primosome component; str 3e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 4e-04
2chg_A226 Replication factor C small subunit; DNA-binding pr 4e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 5e-04
2chq_A319 Replication factor C small subunit; DNA-binding pr 6e-04
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 7e-04
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query958
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 100.0
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 100.0
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 100.0
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.98
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.97
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.97
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.97
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.97
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.96
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.95
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.94
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.93
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.92
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.92
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.91
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.9
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.9
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.89
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.89
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.88
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.88
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.88
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.86
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.86
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.86
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.85
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.84
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.83
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 99.83
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.83
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.82
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 99.81
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.8
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.79
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.78
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.76
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.75
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.74
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.72
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.7
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.7
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.67
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.67
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.62
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.58
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.56
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.56
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.56
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.55
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.53
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.53
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.53
3pvs_A 447 Replication-associated recombination protein A; ma 99.52
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.51
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.5
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.5
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.5
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.49
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.49
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.49
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.48
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.46
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.46
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.45
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.45
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.45
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.44
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.43
2krk_A86 26S protease regulatory subunit 8; structural geno 99.43
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.42
3bos_A242 Putative DNA replication factor; P-loop containing 99.42
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.42
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.41
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.4
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 99.38
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.37
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.36
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.36
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.35
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.34
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.34
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.33
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.33
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.32
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.32
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 99.29
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.29
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.29
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.27
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.27
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.26
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.25
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.24
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.23
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.23
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.22
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.22
3bos_A242 Putative DNA replication factor; P-loop containing 99.21
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.21
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.21
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.2
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.2
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.19
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.18
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.15
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.13
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.13
3pvs_A447 Replication-associated recombination protein A; ma 99.11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.11
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.11
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.1
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.1
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.09
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.07
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.07
3co5_A143 Putative two-component system transcriptional RES 99.06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.04
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.03
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.02
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.02
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.0
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.98
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.96
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.93
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.93
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.88
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.87
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.87
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 98.87
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.86
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.86
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.86
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.84
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.83
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.81
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.8
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.79
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.77
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.74
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.73
3co5_A143 Putative two-component system transcriptional RES 98.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.71
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.7
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.69
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 98.62
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.61
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.58
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.56
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.52
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.52
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.48
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.48
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.47
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 98.4
2krk_A86 26S protease regulatory subunit 8; structural geno 98.36
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.35
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 98.33
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.31
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.31
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.3
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 98.28
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.28
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.28
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.26
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.26
2qgz_A308 Helicase loader, putative primosome component; str 98.25
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.24
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.23
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.21
2fna_A357 Conserved hypothetical protein; structural genomic 98.2
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.2
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.19
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.16
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.15
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 98.14
3f8t_A506 Predicted ATPase involved in replication control, 98.12
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.11
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.11
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.1
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.09
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.07
1b0u_A262 Histidine permease; ABC transporter, transport pro 98.06
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.04
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.01
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 97.97
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.96
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.95
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.95
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.95
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.94
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 97.91
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.91
2fna_A357 Conserved hypothetical protein; structural genomic 97.91
1g6h_A257 High-affinity branched-chain amino acid transport 97.88
1tue_A212 Replication protein E1; helicase, replication, E1E 97.85
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.83
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.78
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.77
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.74
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.74
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.74
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 97.73
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.72
2qgz_A308 Helicase loader, putative primosome component; str 97.71
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.7
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.69
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.69
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.66
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.66
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.64
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.55
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 97.54
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.53
2ghi_A260 Transport protein; multidrug resistance protein, M 97.5
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.49
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 97.49
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 97.48
3f8t_A506 Predicted ATPase involved in replication control, 97.47
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.43
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.42
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.38
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.38
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.37
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 97.32
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.28
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.27
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.27
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.27
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.26
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.25
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.21
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.21
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.19
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 97.18
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 97.18
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.17
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.16
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.16
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.15
3io5_A333 Recombination and repair protein; storage dimer, i 97.15
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.14
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.13
2z43_A324 DNA repair and recombination protein RADA; archaea 97.12
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.12
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.11
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.06
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.01
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.01
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.0
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.99
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.97
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.97
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.96
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.95
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.93
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.92
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.91
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.9
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.89
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.88
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.84
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.83
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.82
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.82
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.82
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.81
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.8
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.79
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.79
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.77
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 96.76
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 96.76
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.76
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.75
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.74
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.73
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.71
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.71
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.7
2jv2_A83 Putative uncharacterized protein PH1500; AAA ATPas 96.69
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.69
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.68
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.65
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.65
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.62
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 96.62
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.6
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.6
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.6
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.6
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.6
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.58
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.57
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.56
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.54
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.54
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.53
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.51
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.51
1via_A175 Shikimate kinase; structural genomics, transferase 96.51
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.5
1tue_A212 Replication protein E1; helicase, replication, E1E 96.49
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.48
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.48
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.48
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.47
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.47
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.45
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.45
1via_A175 Shikimate kinase; structural genomics, transferase 96.44
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.43
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.42
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.42
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.42
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.41
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.4
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.39
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.38
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.37
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.37
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.36
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.36
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.36
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.36
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.36
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.35
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.34
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.32
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.32
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.31
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.3
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.29
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.29
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.29
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.28
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.28
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.27
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.27
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.27
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.26
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.26
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.25
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.25
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.25
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.24
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.24
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.23
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.22
2og2_A359 Putative signal recognition particle receptor; nuc 96.22
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.21
2oap_1511 GSPE-2, type II secretion system protein; hexameri 96.2
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.2
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.19
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.18
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.16
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.16
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.15
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.14
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.14
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.14
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.13
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.13
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.13
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.11
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.11
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.11
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.1
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.1
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.09
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.09
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.08
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.07
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.07
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.07
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.07
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.06
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.06
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.05
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.05
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.05
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.04
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.04
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.04
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.04
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.03
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.03
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.03
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.01
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.0
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.0
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.0
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.99
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.98
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.98
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.98
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.98
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.97
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.97
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.97
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.96
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.95
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.95
1zc1_A208 Ubiquitin fusion degradation protein 1; UFD1, doub 95.95
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.94
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.93
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.93
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.92
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.92
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.89
3io5_A333 Recombination and repair protein; storage dimer, i 95.89
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.88
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.88
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.86
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.86
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.85
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.85
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.84
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 95.83
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.82
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.82
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.82
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.82
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.82
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.81
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.81
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.8
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.8
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.8
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.8
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.8
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.79
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.79
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.78
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.77
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.76
2z43_A324 DNA repair and recombination protein RADA; archaea 95.75
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 95.74
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.74
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.71
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.7
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 95.7
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.7
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.69
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.69
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.69
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.69
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.67
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.67
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 95.67
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.65
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 95.65
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.65
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 95.64
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.64
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.62
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 95.62
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.61
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.6
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.59
1p9r_A418 General secretion pathway protein E; bacterial typ 95.59
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.58
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.57
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.57
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.56
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.56
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-107  Score=994.79  Aligned_cols=738  Identities=32%  Similarity=0.515  Sum_probs=545.6

Q ss_pred             CCccccccccccCccccccccccCCCCceEEeecHhhhhhccccccceEEEeecCCCcceEEEEEEecCCCCCccccCCC
Q 002159           66 LQLPAGILRFSKDKIDISDAKFASLDDSALLGLSTCVLKQLSVTSGSLVLVKNAETTKQRIAQVVVLDPPTTRKQVCDGD  145 (958)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~v~l~~~~l~~l~~~~g~~v~v~~~~~~~~r~~~~~~l~~~~~~~~~~~~~  145 (958)
                      .+++|+||+.++.| +++.|+++..||++.|.|+..+|++|||+.||+|.|+|..   ++.++|++..+.          
T Consensus        10 ~~~~~~~~~~~~~~-~~~~v~~~~~~d~~~~~~~~~~~~~l~~~~gd~v~i~g~~---~~~~~~~~~~~~----------   75 (806)
T 3cf2_A           10 DDLSTAILKQKNRP-NRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK---RREAVCIVLSDD----------   75 (806)
T ss_dssp             -----------CCT-TEEECBCCSSCCTTEEEECHHHHHHTTCCSSCEEEEECGG---GCBCCEEEEECT----------
T ss_pred             CCchhhhhhccCCC-ceEEEccCCCCCCCEEEECHHHHHHcCCCCCCEEEEEcCC---CceEEEEEcCCC----------
Confidence            48999999999999 9999999999999999999999999999999999999766   777888876554          


Q ss_pred             CccCCCCCcccccCCCCCCCCccccccCceEEeCHhhHhhccCCcccchhheecCccceeEEEEEecCCCCCCCCCCCce
Q 002159          146 VHSKHSSPTMLTFPSIHLPQDDMELLDRQVAYLSPLLAFNLDLHISSLKFLVHQGKEVLESLFIAKVDDGTSGQDGKASL  225 (958)
Q Consensus       146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lsp~~~~nL~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  225 (958)
                                              .+..+++.|+..++.|+++..|+                                 
T Consensus        76 ------------------------~~~~~~i~~~~~~r~n~~v~~gd---------------------------------   98 (806)
T 3cf2_A           76 ------------------------TCSDEKIRMNRVVRNNLRVRLGD---------------------------------   98 (806)
T ss_dssp             ------------------------TSBTTBCEECHHHHHTTTCCTTC---------------------------------
T ss_pred             ------------------------CCCCCEEEeCHHHHHhcCCCCCC---------------------------------
Confidence                                    34567889999999999999975                                 


Q ss_pred             eEEEEEecCCCCCcceeeEEEeeecCCCCccccccCCchhhhhhhHHHHHHHHHhhcc-CCCeeecCCEEEEecccCCCC
Q 002159          226 IKLGLQSVGQLPKYASHLRVSFVKIPECGTLESLKGSSAIEAEDRQEKIDLALHNYFE-VDRYLARGDVFSVCINWNCSS  304 (958)
Q Consensus       226 ~~~~~~~~~~~p~~~~~~rv~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~f~-~~r~~~~gd~~~~~~~~~~~~  304 (958)
                       .|+|.|+.++ ++|+.+.+    .|..++++++.++          .++.+|++||. ..|+|.+||+|.|+.      
T Consensus        99 -~V~v~~~~~~-~~a~~v~l----~p~~~~~~~~~~~----------~~~~~l~~~~~~~~~~v~~gd~~~v~~------  156 (806)
T 3cf2_A           99 -VISIQPCPDV-KYGKRIHV----LPIDDTVEGITGN----------LFEVYLKPYFLEAYRPIRKGDIFLVRG------  156 (806)
T ss_dssp             -EEEEEECCCC-CBCSBEEE----EEBTTTSTTCCSC----------HHHHTHHHHHTTTCCEEETTCEEEECC------
T ss_pred             -EEEEEECCCC-CcCCEEEE----eccccchhccchh----------HHHHHHHHHHHhcCCcccCCCEEEEec------
Confidence             6888998876 68986544    7888888888777          89999999996 689999999999975      


Q ss_pred             ccccccccccCCCCCceEEEEEEEEecCCCeEEEEcCCceEEEEcCCCCCCCCC--CcccccCCCCcCCchHHHHHHHHH
Q 002159          305 MICIPCRQRLHRRSDNIIYFKVVAVEPSEETVLRVNCTKTALVLGGSIPSALPP--DLLISGSNDFVPLQGDTVKILASI  382 (958)
Q Consensus       305 ~~~~~~~~~~~~~~~~~~~f~v~~~~~~~~~~~~vd~~~T~l~~~~~~~~~~~~--~~~~~~~~~~~~l~~~~~k~L~~i  382 (958)
                                   .+..+.|+|++++|.+.  ++| ...|.+...+......+.  ...-..+++.++++....+....+
T Consensus       157 -------------~~~~~~f~V~~~~P~~~--~~v-~~~T~i~~~~~~~~~~~~~~~~~~v~~~dIgGl~~~~~~l~e~v  220 (806)
T 3cf2_A          157 -------------GMRAVEFKVVETDPSPY--CIV-APDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMV  220 (806)
T ss_dssp             -------------TTSCEEEEEEEESSSSE--EEC-CTTSBCCBCSCCBCCCTTSCCSSSCCGGGCCSCCTTHHHHHHHH
T ss_pred             -------------CCcEEEEEEEEEeCCCC--eEE-CCCcEEEEeccccCcccccccCCCCChhhhcCHHHHHHHHHHHH
Confidence                         35679999999999653  333 345666555432111110  001112456777776554555555


Q ss_pred             HhhcCCCccc---CCCCCceEEEEcCCCChHHHHHHHHHHHhCCcEEEEecCcccccchhchHHHHHHHHHHhhcCCCeE
Q 002159          383 LAPTLCPSVL---SLKFRVAVLLHGLPGCGKRTVVRYVARRLGIHVVEYSCHNLMASSERKTSAALAQAFNTAQSYSPTI  459 (958)
Q Consensus       383 i~p~l~p~~~---~~~~~~~VLL~GppGtGKTTLaraIA~~lg~~~~~I~~~~l~s~~~g~~e~~l~~~f~~A~~~~P~I  459 (958)
                      ..|+.+|..|   +.+++++||||||||||||+|||++|+++|.+++.++|+++++++.|+++..++.+|+.|+.++|||
T Consensus       221 ~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~PsI  300 (806)
T 3cf2_A          221 ELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI  300 (806)
T ss_dssp             HHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSCSEE
T ss_pred             HHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcCCeE
Confidence            6889999877   4688999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeecchhhhhhcccCCCCCCccccchHHHHHHHHHhcCCCCCccccccCCCCchhhhhhhhcCcEEEEEecCCCCCCChh
Q 002159          460 LLLRDFDVFRNLVSNESLPNDQVGLSSEVASVIREFTEPSAEDEDEESHGYFPVKEIEKICRQQVLLVAAADSSEGLPPT  539 (958)
Q Consensus       460 L~iDeid~L~~~~s~~~~~~~~~~~~~~v~~~L~~l~~~l~~~~~~~~~g~~~~~~~~~~~~~~ViVIaaTn~~~~Ld~a  539 (958)
                      |||||+|+|+++++..+     ......+   +.+++                ..+++...+.+|+||||||+++.||++
T Consensus       301 IfIDEiDal~~~r~~~~-----~~~~~ri---v~~LL----------------~~mdg~~~~~~V~VIaaTN~~d~LD~A  356 (806)
T 3cf2_A          301 IFIDELDAIAPKREKTH-----GEVERRI---VSQLL----------------TLMDGLKQRAHVIVMAATNRPNSIDPA  356 (806)
T ss_dssp             EEEESGGGTCCTTTTCC-----CTTHHHH---HHHHH----------------THHHHCCGGGCEEEEEECSSTTTSCTT
T ss_pred             EEEehhcccccccCCCC-----ChHHHHH---HHHHH----------------HHHhcccccCCEEEEEecCChhhcCHH
Confidence            99999999998653221     1111222   22322                233444446789999999999999999


Q ss_pred             hhc--cccEEEEcCCCCHHHHHHHHHHhccCCcccCCCCCcHHHHHHHhhhcCCCChhhHHHHHHHHHHHHHHhhccccc
Q 002159          540 IRR--CFSHEISMGPLTEQQRVEMLSQLLQPVSELTSDTGSEEFVKDIIGQTSGFMPRDLHALVADAGANLIRKSNSEVD  617 (958)
Q Consensus       540 lrr--rf~~eIsig~Pde~qR~~Il~~ll~~~~~l~~D~~~~~~L~~la~~t~Gfv~~DL~~Lv~eA~~~a~~r~~~~~~  617 (958)
                      ++|  ||+++|+++.||+.+|.+|++.++++... ..|++    +..+|.+|+||+++||..||++|++.++++.....+
T Consensus       357 LrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~-~~dvd----l~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~  431 (806)
T 3cf2_A          357 LRRFGRFDREVDIGIPDATGRLEILQIHTKNMKL-ADDVD----LEQVANETHGHVGADLAALCSEAALQAIRKKMDLID  431 (806)
T ss_dssp             TTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEE-CTTCC----HHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred             HhCCcccceEEecCCCCHHHHHHHHHHHhcCCCC-CcccC----HHHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccc
Confidence            999  99999999999999999999999987653 34444    688999999999999999999999999987654332


Q ss_pred             cCCCCcchhhHHhhhcCcchhhhhccccHHHHHHHHHhhcccccccCCCCCCCCccccccccccccccccceeeeccccc
Q 002159          618 KNEPGESDLTAKVAHNDNSSIAATQVMGKEDLVKAMERSKKRNASALGAPKVPNVKWEDVGGLEDVKKSILDTVQLPLLH  697 (958)
Q Consensus       618 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ed~~~al~~~~~~~~s~l~~~~~p~v~~~di~Gl~~vk~~l~e~i~~~l~~  697 (958)
                      .....           ..........++++||..|+...++... .....+.|+++|+++||++++|+.+.+.+.+|+.+
T Consensus       432 ~~~~~-----------~~~e~~~~~~v~~~Df~~Al~~~~ps~~-r~~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~  499 (806)
T 3cf2_A          432 LEDET-----------IDAEVMNSLAVTMDDFRWALSQSNPSAL-RETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEH  499 (806)
T ss_dssp             GTCCC-----------CSHHHHHHCEECTTHHHHHHSSSSCCCC-CCCCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTC
T ss_pred             ccccc-----------cchhhhccceeeHHHHHHHHHhCCCccc-ccccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhC
Confidence            22111           1111223567889999999987754221 22356789999999999999999999999999999


Q ss_pred             hhhhh-cCCCCCCcEEEecCCCChhHHHHHHHHHHcCCceeeeccchhhhccccchhhhHHHHHHHHHhcCCcEEEEccc
Q 002159          698 KDLFS-SGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDEL  776 (958)
Q Consensus       698 ~~~~~-~~i~~~~~iLL~GppGtGKTtLakaiA~~~~~~~i~v~~~~l~~~~~Gese~~vr~lf~~A~~~~P~ILfiDEi  776 (958)
                      ++.|. .++.+++|+|||||||||||++|+++|++++.+|+.+++++++++|+|++|++++++|+.|+..+||||||||+
T Consensus       500 p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~~Ar~~~P~IifiDEi  579 (806)
T 3cf2_A          500 PDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDEL  579 (806)
T ss_dssp             SGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHHHHHTTCSEEEECSCG
T ss_pred             HHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHHHHHHcCCceeechhh
Confidence            99997 68999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCC-CCCcchHHHHHHHHHHhhcCCCCCCCcEEEEEecCCCCCCChhhcCcCCccceeeccCCCCHHHHHHHH
Q 002159          777 DSLAPARGAS-GDSGGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNSDVSYRERVL  855 (958)
Q Consensus       777 D~l~~~r~~~-~~~~~~~~rv~~~LL~~ldg~~~~~~~v~VI~aTNrp~~ldpaLlrpgRfd~~I~v~~ppd~~~r~~Il  855 (958)
                      |+++++|+.. ++.++..+|++++||++|||+.. ..+|+||||||+|+.||||++||||||+.|||++ ||.++|.+||
T Consensus       580 Dsl~~~R~~~~~~~~~~~~rv~~~lL~~mdg~~~-~~~V~vi~aTN~p~~lD~AllRpgRfd~~i~v~l-Pd~~~R~~il  657 (806)
T 3cf2_A          580 DSIAKARGGNIGDGGGAADRVINQILTEMDGMST-KKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPL-PDEKSRVAIL  657 (806)
T ss_dssp             GGCC--------------CHHHHHHHHHHHSSCS-SSSEEEECC-CCSSSSCHHHHSTTTSCCEEEC------CHHHHTT
T ss_pred             hHHhhccCCCCCCCchHHHHHHHHHHHHHhCCCC-CCCEEEEEeCCCchhCCHhHcCCCcceEEEEECC-cCHHHHHHHH
Confidence            9999999753 44556788999999999999965 5789999999999999999999999999999998 8999999999


Q ss_pred             HHHHhhccCCCCcCHHHHHhhCCCCCCHHHHHHHHHHHHHHHHHHHhcccCCCCC--------ccccccCCcccccHHHH
Q 002159          856 KALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSDSNSD--------SSRIDQADSVVVEYDDF  927 (958)
Q Consensus       856 ~~~~~~~~~~~d~~l~~la~~~t~g~sGaDi~~l~~~A~~~A~~r~~~~~~~~~~--------~~~~~~~~~~~i~~~df  927 (958)
                      +.++++.++..++|++.||+. |+|||||||.++|++|++.|+++.+........        .........+.|+++||
T Consensus       658 ~~~l~~~~~~~~~dl~~la~~-t~g~SGadi~~l~~~A~~~a~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~df  736 (806)
T 3cf2_A          658 KANLRKSPVAKDVDLEFLAKM-TNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHF  736 (806)
T ss_dssp             TTTSSCC--CCC-----------------CHHHHHHHHHHHHHHHHHC-----------------------CCC----CC
T ss_pred             HHHhcCCCCCCCCCHHHHHHh-CCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhccCccccccccccccCccCHHHH
Confidence            999999999999999999999 599999999999999999999998764321100        01111222357999999


Q ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHHhhcC
Q 002159          928 VKVLRELSPSLSMAELKKYELLRDQFEGS  956 (958)
Q Consensus       928 ~~al~~~~ps~s~~~l~~y~~~~~~~~~~  956 (958)
                      ++|+++++||+|++++++|++|+++|+++
T Consensus       737 ~~al~~~~pSvs~~~l~~y~~~~~~f~~~  765 (806)
T 3cf2_A          737 EEAMRFARRSVSDNDIRKYEMFAQTLQQS  765 (806)
T ss_dssp             TTTC---------------CCCC------
T ss_pred             HHHHHhCCCCCCHHHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999753
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 958
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 6e-83
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-19
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-82
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-18
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 8e-70
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 3e-13
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-54
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-09
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-47
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 1e-31
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-28
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 8e-04
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 4e-27
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-17
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-16
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 4e-12
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 1e-04
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 3e-11
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 0.004
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 8e-07
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-06
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-05
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 3e-05
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 6e-05
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 7e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 7e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.001
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 8e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.001
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 0.001
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.002
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.002
d2iyva1165 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba 0.003
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 0.004
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 0.004
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

 Score =  265 bits (680), Expect = 6e-83
 Identities = 90/235 (38%), Positives = 139/235 (59%), Gaps = 6/235 (2%)

Query: 669 VPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFSS-GLRKRSGVLLYGPPGTGKTLLAKA 727
            P V ++DV G E+ K+ + + V+  L +   F   G R   GVLL GPPG GKT LA+A
Sbjct: 3   APKVTFKDVAGAEEAKEELKEIVEF-LKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARA 61

Query: 728 VATECSLNFLSVKGPELINMYIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASG 787
           VA E  + F++  G + + M++G     VRD+F+ A+   PC++F DE+D++   RG+  
Sbjct: 62  VAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSGV 121

Query: 788 DSG-GVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNS 846
             G    ++ ++Q+L E+DG  +    + ++ A+NRPD++DPALLRPGRFD+ + +    
Sbjct: 122 GGGNDEREQTLNQLLVEMDGF-EKDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDA-P 179

Query: 847 DVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRK 901
           DV  RE++L+   R   L EDV L  +AK+  P F GAD+  L  +A   AA+  
Sbjct: 180 DVKGREQILRIHARGKPLAEDVDLALLAKRT-PGFVGADLENLLNEAALLAAREG 233
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query958
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.97
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.97
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.97
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.95
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.94
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.9
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.85
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.77
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.7
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.67
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.66
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.59
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.49
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.49
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.47
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.42
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.4
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.4
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 99.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.36
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.36
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.35
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.34
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.3
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.25
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.23
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.23
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.23
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.22
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.2
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.19
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.14
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.1
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.07
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.06
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.05
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.04
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.03
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.03
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.01
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.0
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.99
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.99
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.95
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.94
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.91
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.86
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.81
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.8
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.8
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 98.78
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.76
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.68
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.61
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.58
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.58
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.55
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.51
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.49
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.46
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.43
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 98.4
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 98.38
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.36
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.3
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.27
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.23
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.23
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.16
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.06
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.06
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.97
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.95
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.95
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.94
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.93
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.91
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.9
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.89
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.86
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 97.78
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.74
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.65
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.59
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.57
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.53
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.52
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.46
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.46
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.45
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.41
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.34
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.34
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.34
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.33
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.33
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.32
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.3
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.29
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.29
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.23
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.2
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.17
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.17
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.16
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.15
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.15
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.14
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.12
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.1
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.07
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.05
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.04
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.03
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.03
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.02
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.02
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.99
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.99
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.98
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.98
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.98
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.97
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.97
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.92
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.92
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.91
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.89
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.89
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.88
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.87
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.87
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.84
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.84
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.79
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.78
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.77
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.76
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.74
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.74
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.69
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.69
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.67
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.67
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.64
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.64
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.64
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.63
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.61
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.6
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.6
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.59
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.58
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.55
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.55
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.54
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.54
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.53
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.53
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.52
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.51
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 96.5
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.43
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.4
d1okkd2207 GTPase domain of the signal recognition particle r 96.36
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.34
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.33
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.33
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.29
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.26
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.26
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.25
d2qy9a2211 GTPase domain of the signal recognition particle r 96.16
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.1
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.07
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.98
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.94
d2qy9a2211 GTPase domain of the signal recognition particle r 95.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.85
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.81
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.79
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.73
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.71
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.7
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.68
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.49
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.48
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.45
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.37
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.29
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.25
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.23
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.22
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.21
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.16
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.12
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.11
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.06
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.06
d1vmaa2213 GTPase domain of the signal recognition particle r 95.03
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.02
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.89
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.87
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.86
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.86
d1okkd2207 GTPase domain of the signal recognition particle r 94.85
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.85
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.84
d1vmaa2213 GTPase domain of the signal recognition particle r 94.84
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.84
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.83
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.77
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.72
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.72
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.69
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.66
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.55
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.52
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.5
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.5
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.49
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.48
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.45
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.23
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.21
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.16
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.11
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.03
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.98
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.88
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.78
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.56
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.56
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.52
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.46
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.35
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.29
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.29
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.28
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.21
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.2
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.2
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.17
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.13
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.07
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.02
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.9
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.88
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.83
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.81
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.72
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.71
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.7
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.61
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.55
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.49
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.46
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.43
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.37
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.23
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.15
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.14
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.09
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.04
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 91.92
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.91
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.88
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.83
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.72
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.71
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.7
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.58
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.58
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.54
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 91.49
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 91.47
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.47
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.37
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.31
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.28
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.23
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.2
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.16
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.15
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.13
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.09
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.05
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.04
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.97
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.94
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.93
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.9
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.9
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.82
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.82
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.81
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.78
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.76
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.61
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.49
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.45
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.38
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.35
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.33
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.3
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.29
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.26
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.12
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.12
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.02
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.96
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.75
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.68
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.59
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.39
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 89.35
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.35
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 89.32
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.3
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.29
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 89.27
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.21
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.18
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.12
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.08
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.95
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 88.95
d1xpua3289 Transcription termination factor Rho, ATPase domai 88.94
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 88.93
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.89
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.85
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.85
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.8
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 88.76
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 88.76
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.72
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.7
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.69
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.65
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.64
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.63
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.62
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.59
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.59
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.38
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.26
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 88.24
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.21
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.2
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.14
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.09
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.01
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.99
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 87.94
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.91
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 87.82
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 87.8
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.66
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.53
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.5
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.42
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.37
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.3
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 87.27
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.24
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 87.1
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 87.06
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 86.94
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.86
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.82
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 86.75
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 86.75
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.74
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.73
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.66
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 86.54
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.53
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.52
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.5
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.42
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.31
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.29
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.27
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.16
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.13
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.09
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.98
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.96
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 85.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.91
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.81
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 85.78
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.61
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 85.51
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.45
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.38
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 85.3
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.15
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.09
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 85.03
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 84.99
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 84.96
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 84.87
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.87
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.7
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.69
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.64
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 84.52
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.15
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.14
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.12
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 84.05
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.99
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.96
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 83.9
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.78
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.76
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.33
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 83.3
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 83.28
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 83.22
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.09
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 82.89
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.57
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 82.49
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 82.31
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.26
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 81.97
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.92
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 81.73
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.73
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 81.49
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 81.09
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 80.44
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 80.43
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 80.35
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 80.33
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9.1e-45  Score=388.80  Aligned_cols=246  Identities=39%  Similarity=0.699  Sum_probs=220.2

Q ss_pred             CCCccccccccccccccccceeeeccccchhhhh-cCCCCCCcEEEecCCCChhHHHHHHHHHHcCCceeeeccchhhhc
Q 002159          669 VPNVKWEDVGGLEDVKKSILDTVQLPLLHKDLFS-SGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINM  747 (958)
Q Consensus       669 ~p~v~~~di~Gl~~vk~~l~e~i~~~l~~~~~~~-~~i~~~~~iLL~GppGtGKTtLakaiA~~~~~~~i~v~~~~l~~~  747 (958)
                      .+.++|+|++|++++|+++.+.+.+ +.+++.|. .|.++++++|||||||||||++|+++|++++.+++.++++++.++
T Consensus         6 ~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~~   84 (256)
T d1lv7a_           6 QIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEM   84 (256)
T ss_dssp             SSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTTS
T ss_pred             CCCCCHHHHhchHHHHHHHHHHHHH-HHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhhc
Confidence            4779999999999999999987754 67777776 488889999999999999999999999999999999999999999


Q ss_pred             cccchhhhHHHHHHHHHhcCCcEEEEcccccccCCCCCCCCC-cchHHHHHHHHHHhhcCCCCCCCcEEEEEecCCCCCC
Q 002159          748 YIGESEKNVRDIFQKARSARPCVIFFDELDSLAPARGASGDS-GGVMDRVVSQMLAEIDGLNDSSQDLFIIGASNRPDLI  826 (958)
Q Consensus       748 ~~Gese~~vr~lf~~A~~~~P~ILfiDEiD~l~~~r~~~~~~-~~~~~rv~~~LL~~ldg~~~~~~~v~VI~aTNrp~~l  826 (958)
                      |+|+++++++++|+.|+..+||||||||+|.+++.|+....+ .....+++++||.+||++.. ..+|+||||||+|+.|
T Consensus        85 ~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~-~~~v~vIatTn~~~~l  163 (256)
T d1lv7a_          85 FVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG-NEGIIVIAATNRPDVL  163 (256)
T ss_dssp             CCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS-SSCEEEEEEESCTTTS
T ss_pred             chhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCC-CCCEEEEEeCCCcccC
Confidence            999999999999999999999999999999999888654332 24567899999999999864 5689999999999999


Q ss_pred             ChhhcCcCCccceeeccCCCCHHHHHHHHHHHHhhccCCCCcCHHHHHhhCCCCCCHHHHHHHHHHHHHHHHHHHhcccC
Q 002159          827 DPALLRPGRFDKLLYVGVNSDVSYRERVLKALTRKFKLLEDVSLYSIAKKCPPNFTGADMYALCADAWFHAAKRKVLSSD  906 (958)
Q Consensus       827 dpaLlrpgRfd~~I~v~~ppd~~~r~~Il~~~~~~~~~~~d~~l~~la~~~t~g~sGaDi~~l~~~A~~~A~~r~~~~~~  906 (958)
                      ||+++||||||+.|+|++ |+.++|..|++.++++.++..++++..+|+. |+||||+||.++|++|++.|+++.     
T Consensus       164 d~al~R~gRfd~~i~i~~-P~~~~R~~il~~~l~~~~~~~~~~~~~la~~-t~G~s~adi~~l~~~A~~~a~~~~-----  236 (256)
T d1lv7a_         164 DPALLRPGRFDRQVVVGL-PDVRGREQILKVHMRRVPLAPDIDAAIIARG-TPGFSGADLANLVNEAALFAARGN-----  236 (256)
T ss_dssp             CGGGGSTTSSCEEEECCC-CCHHHHHHHHHHHHTTSCBCTTCCHHHHHHT-CTTCCHHHHHHHHHHHHHHHHHTT-----
T ss_pred             CHhHcCCCCCCEEEECCC-cCHHHHHHHHHHhccCCCcCcccCHHHHHHh-CCCCCHHHHHHHHHHHHHHHHHcC-----
Confidence            999999999999999997 8999999999999999999999999999999 599999999999999999998652     


Q ss_pred             CCCCccccccCCcccccHHHHHHHHHHhC
Q 002159          907 SNSDSSRIDQADSVVVEYDDFVKVLRELS  935 (958)
Q Consensus       907 ~~~~~~~~~~~~~~~i~~~df~~al~~~~  935 (958)
                                  ...|+++||++|++++-
T Consensus       237 ------------~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         237 ------------KRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             ------------CSSBCHHHHHHHHHHHT
T ss_pred             ------------CCccCHHHHHHHHHHHh
Confidence                        12589999999998863
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure