Citrus Sinensis ID: 002218

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950--
MENGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWDGNGLSRSSL
cccccccccccccccccHHHHHHHHccccEEEEEEEEcccccccccccccccccccEEEEEEcccccEEEccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccEEEccccEEEEccccccHHHHHHHHHHcccccccEEEEEEEEcccccccEEEEEEEEccccccHHHHHHHccccccccEEEEEcccccccccEEEEEEcccccHHccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHccccccEEccccccccccccccHHHHHHcccccccccccccccccccccccEEEEEEEEEccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEccHHHHHHHHccEEHHcccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEEEEEEccccEEEEEcccccEEEEEccccccccHHHHEEEEcccccEEEcccccccccccccccccHHHHHHHHcccccHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccccccccEEEHHHHHHcccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEEEccccccccccccccccccEEEEEEEcccccccccc
cccccccEEEccccccccHEHEEHHcccccEEEEEEEEEccccccccccccccccEEEEEEEEcccEEEEcccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHEEEEEEccccccccEcEEEEEEEcHHHHcHHHcccccccccHHHHHHHHHHHHHHccccEEEcccccEEEccccccHHHHHHHHHHcccccccEEEEEEEEEcccccccEEEEEEEcccccHHHHHHHHcccccccEEEEEEcccccccccEEEEEcccHHHHHHHHHHHHHccccccccccccccEEEEccccEcccEEEEEEcccccccccccccccHHHHHHHHHcccccccEEEcHHHHHHHcccccEEcccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccHHcccEccccccccccccEEEEEEEEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccEEccHHHHHHccHHcHccccccccccccccEEEEccccEEcccccEEEEEccccccccccccccEEEEEEEEEEEEcccccEEEEEEcccEEEEEccccccccHHHHHHHHcccccHHHHccccHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHcHHHHHHHHHccccccccEEEEEEccEEcccHHHccccEEEEEEHHHHccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccEccHHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEEEcccccccccccccccccEEEEEEEccccccccccc
MENGGLSVVAVRKMKLTPKAIIVQKfgrnaqftvDEVQDVVqngcpglaipqkgpclyrcslqlpefsvVSETFKKKKDAEQSAAEKALEKlgidpspnvpsaeEAWDKLIASVKHLFsneflssqsplRGHFIAALRrdgdlygsvpaSVIAVCDSKLANLCklinpkvessHLLVLTYIMRAATRLsefvvtsegqlsiwrkdpyppeikessiiqqsespdsicieaihipsslemavhpvtlnvsstgyYLDVIARnldqtdgnkilVSSRTIGKASSEMRLYFAAPKSYLLdlssdlpnveevvdfegslnprasylygqdiygDAILASIGytrkseglfhediTLQSYYRMLIHLTPSGVYKLSREAILTAelpmafttrtnwrgsfprEMLFMFCRQhwlsepvfstcsnslkessessrfYEKSAALesaetgkectsgggtaasdnvrCEVKIfsksrdpilecspkefYKKQNESIENASLKVLSWLNayfkdpdiplekLNNLVgaldiqcypqnffkkfsSYRFIHNVQQRKMGEKLLQANSintlnaipehgiyclsiggpdsgiypsngclsFISYSVSLVIEGETMKELLESREEFEfemgtgavipQVEVVTAQMSvgqsacfckelppQELILAAADDSARTFSLLSSRACCLEYHITLLrvteppedrmeqalfspplskQRVEYALQHIKESCAttlvdfgcgsgslldslldYPTALEKIVGVDISQKSLSRAAKIIHSKLskkldaavpctdvksavlfdgsitvfdsrlhgfdiGTCLEVIEHMEedeasqfgnivlssfrprilivstpnyeynailqkssstiqeddpdektqlqsckfrnhdhkfewTRDQFNCWATELAARHNysvefsgvggsgdrepgfaSQIAVfrsrtppeeddllkdgdsahHYKVIWEwdgnglsrssl
MENGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQSAAEKAleklgidpspnvPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSefvvtsegqlsiwrkdpyppeIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARnldqtdgnkilvssrtigkassEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALesaetgkectsgggtaasdnvrCEVKIfsksrdpilecsPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHsklskkldaavPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKssstiqeddpdEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIwewdgnglsrssl
MENGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPpeikessiiqqsespdsiCIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFstcsnslkessessRFYEKSAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKellesreefefeMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVdfgcgsgslldslldYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWDGNGLSRSSL
******SVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVS**********************************AWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRK********************SICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTC****************************************VRCEVKIFSK***PILECS**EFYK****SIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVT*******************RVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAIL********************CKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGV**********************************AHHYKVIWEWDG********
****************TPKAIIVQKFGRNAQFTVDEVQDV*QNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK**********KALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTS***LSI**KDPY*PEIK*S*******SPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSD************SLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSN**************************************VRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFI************************PEHGIY**********IYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLL**********E*ALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSR****************HYKVIWEWD*********
MENGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSE**************KALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFST************************************AASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKS**************LQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWDGNGLSRSSL
*****LSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSR*YEKSAA*****TGKECT****TAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSS************QL*SCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWDG********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWDGNGLSRSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query952 2.2.26 [Sep-21-2011]
Q9C5Q8942 Small RNA 2'-O-methyltran yes no 0.945 0.955 0.511 0.0
Q32PY6 394 Small RNA 2'-O-methyltran yes no 0.236 0.571 0.334 1e-33
Q5T8I9 393 Small RNA 2'-O-methyltran yes no 0.237 0.575 0.332 1e-33
Q8CAE2 395 Small RNA 2'-O-methyltran yes no 0.210 0.506 0.353 5e-33
E1BVR9 376 Small RNA 2'-O-methyltran yes no 0.239 0.606 0.314 7e-33
C0IN03 369 Small RNA 2'-O-methyltran yes no 0.242 0.626 0.334 7e-33
Q4R3W5 393 Small RNA 2'-O-methyltran N/A no 0.237 0.575 0.32 1e-32
Q568P9 402 Small RNA 2'-O-methyltran yes no 0.219 0.519 0.354 4e-28
Q9UST9 378 Small RNA 2'-O-methyltran yes no 0.243 0.613 0.293 5e-19
P34283450 Uncharacterized protein C yes no 0.218 0.462 0.300 8e-16
>sp|Q9C5Q8|HEN1_ARATH Small RNA 2'-O-methyltransferase OS=Arabidopsis thaliana GN=HEN1 PE=1 SV=1 Back     alignment and function desciption
 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/947 (51%), Positives = 629/947 (66%), Gaps = 47/947 (4%)

Query: 17  TPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK 76
           TPKAII QKFG  A +TV+EV D  Q+GC GLAIPQKGPCLYRC LQLPEFSVVS  FKK
Sbjct: 10  TPKAIIHQKFGAKASYTVEEVHDSSQSGCLGLAIPQKGPCLYRCHLQLPEFSVVSNVFKK 69

Query: 77  KKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAA 136
           KKD+EQSAAE AL+KLGI P  +  + +EA D+++  +K++FS+EFLS++ PL  H  AA
Sbjct: 70  KKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAA 129

Query: 137 LRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSE 196
           LRRDG+  GSVP SVIA  D+K+ + CK+INP VES   L ++Y+M+AA +L++++V S 
Sbjct: 130 LRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASP 189

Query: 197 GQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLD 256
             L   RK+ YP EI E+     S+S  S  + A++IP   E  V   TL +SS  +YLD
Sbjct: 190 HGLR--RKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLD 247

Query: 257 VIARNLDQTDGNKILVSSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLPNV--EEVVDFE 312
            IA  L   DGN++++ SR  GKAS  SE RLY   PK Y LD SSD      E+     
Sbjct: 248 SIAERLGLKDGNQVMI-SRMFGKASCGSECRLYSEIPKKY-LDNSSDASGTSNEDSSHIV 305

Query: 313 GSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSR 372
            S N RASY+ GQDI+GDAILAS+GY  KS+ L ++D+T+ S+YR+   ++P+G+YK+SR
Sbjct: 306 KSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISR 365

Query: 373 EAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEK 432
           +A++ A+LP AFTT++NWRG  PRE+L +FC QH L+EP+ S+ +  +K  S+  R ++K
Sbjct: 366 QAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKK 425

Query: 433 ------SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNES 486
                   A E+    KE T G G       RCEVKIF+KS+D +LECSP++FY+K+N++
Sbjct: 426 LKVSGVDDANENLSRQKEDTPGLGHG----FRCEVKIFTKSQDLVLECSPRKFYEKENDA 481

Query: 487 IENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKM 546
           I+NASLK L W + +F D D+  E+  +     D +    N F      +  H+ + +  
Sbjct: 482 IQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNT 541

Query: 547 ----GEKLLQANSINTLNAIPEHGIYCLSIG-GPD---SGIYPSNGCLSFISYSVSLVIE 598
                EK +Q+ +  ++ +I     Y LS+   P+    G  P     S           
Sbjct: 542 NVLSAEKRVQSITNGSVVSI----CYSLSLAVDPEYSSDGESPREDNESNEEMESEYSAN 597

Query: 599 GETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPP---QELILAAAD 655
            E+  EL+ES EE EFE+GTG++ P +E    QM+VG+ A F +  PP   + LILA   
Sbjct: 598 CESSVELIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASF-RMTPPDAAEALILAVGS 656

Query: 656 DSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCAT 715
           D+ R  SLLS R  CL Y+I LL V  P E+RME A F PPLSKQRVEYAL+HI+ES A+
Sbjct: 657 DTVRIRSLLSERP-CLNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSAS 715

Query: 716 TLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDV 775
           TLVDFGCGSGSLLDSLLDYPT+L+ I+GVDIS K L+RAAK++H KL+K+        +V
Sbjct: 716 TLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNKE------ACNV 769

Query: 776 KSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNY 835
           KSA L+DGSI  FDSRLH  DIGTCLEVIEHMEED+A +FG  VLS F P++LIVSTPNY
Sbjct: 770 KSATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNY 829

Query: 836 EYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEF 895
           E+N ILQ+S+   QE++  E    Q  KFRNHDHKFEWTR+QFN WA++L  RHNYSVEF
Sbjct: 830 EFNTILQRSTPETQEENNSEP---QLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEF 886

Query: 896 SGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEW 942
           SGVGGSG+ EPGFASQIA+FR      E+       S   YKVIWEW
Sbjct: 887 SGVGGSGEVEPGFASQIAIFRREASSVEN---VAESSMQPYKVIWEW 930
Methyltransferase that adds a methyl group to the ribose of the last nucleotide of small RNAs (sRNAs). This protects the 3'-end of sRNAs from uridylation activity and subsequent degradation. Can methylates 3'-end of microRNAs (miRNAs), small interfering RNAs (siRNas) and trans-acting small interfering RNAs (ta-siRNAs). Involved in plant development through its role in small RNAs processing. Required for the specification of reproductive organ identities and the probable repression of A class genes. May control floral determinacy possibly by regulating the expression of the C class floral homeotic gene AGAMOUS (AG).
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 8
>sp|Q32PY6|HENMT_RAT Small RNA 2'-O-methyltransferase OS=Rattus norvegicus GN=Henmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q5T8I9|HENMT_HUMAN Small RNA 2'-O-methyltransferase OS=Homo sapiens GN=HENMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CAE2|HENMT_MOUSE Small RNA 2'-O-methyltransferase OS=Mus musculus GN=Henmt1 PE=1 SV=1 Back     alignment and function description
>sp|E1BVR9|HENMT_CHICK Small RNA 2'-O-methyltransferase OS=Gallus gallus GN=HENMT1 PE=3 SV=1 Back     alignment and function description
>sp|C0IN03|HENMT_XENTR Small RNA 2'-O-methyltransferase OS=Xenopus tropicalis GN=henmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R3W5|HENMT_MACFA Small RNA 2'-O-methyltransferase OS=Macaca fascicularis GN=HENMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q568P9|HENMT_DANRE Small RNA 2'-O-methyltransferase OS=Danio rerio GN=henmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UST9|HENMT_SCHPO Small RNA 2'-O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.05c PE=3 SV=1 Back     alignment and function description
>sp|P34283|YKK6_CAEEL Uncharacterized protein C02F5.6 OS=Caenorhabditis elegans GN=C02F5.6 PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query952
359483694948 PREDICTED: small RNA 2'-O-methyltransfer 0.980 0.984 0.638 0.0
297740849931 unnamed protein product [Vitis vinifera] 0.954 0.976 0.633 0.0
255564369970 conserved hypothetical protein [Ricinus 0.977 0.959 0.611 0.0
224122146916 hypothetical protein POPTRDRAFT_270173 [ 0.951 0.989 0.604 0.0
224061609926 hypothetical protein POPTRDRAFT_177484 [ 0.951 0.978 0.596 0.0
356510770945 PREDICTED: small RNA 2'-O-methyltransfer 0.970 0.977 0.571 0.0
449435894948 PREDICTED: small RNA 2'-O-methyltransfer 0.982 0.986 0.569 0.0
356528106945 PREDICTED: small RNA 2'-O-methyltransfer 0.973 0.980 0.569 0.0
449529457816 PREDICTED: LOW QUALITY PROTEIN: small RN 0.843 0.984 0.561 0.0
15638615942 HEN1 [Arabidopsis thaliana] 0.945 0.955 0.512 0.0
>gi|359483694|ref|XP_002264328.2| PREDICTED: small RNA 2'-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/950 (63%), Positives = 720/950 (75%), Gaps = 17/950 (1%)

Query: 4   GGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQ 63
           GG   V  +K   TPKAII QKFG  A + V+EVQ   QNGCPGLAIPQKGPCL+RCSLQ
Sbjct: 2   GGAPPVVAKKTTHTPKAIIHQKFGDKACYKVEEVQGDTQNGCPGLAIPQKGPCLFRCSLQ 61

Query: 64  LPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFL 123
           LPEFSVVSE FK+KKDAEQSAAEKAL KLG+DP+ +     E WD+LI+ + +LF++EFL
Sbjct: 62  LPEFSVVSEYFKRKKDAEQSAAEKALRKLGVDPAASNSIVREPWDELISRLSYLFADEFL 121

Query: 124 SSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMR 183
           SS  PL GHF AAL+RDGDLYG +P SV AVCD+KL N+CK INP VES+  LV+  +++
Sbjct: 122 SSLHPLSGHFRAALQRDGDLYGLIPVSVFAVCDTKLGNICKSINPGVESNPFLVIPLVLK 181

Query: 184 AATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHP 243
           AA   S    TSEGQL + R++PYPPEI +SSI  Q  SP+SI IEA++IP SLE  V  
Sbjct: 182 AAASGS--FATSEGQLWMRRQNPYPPEIIQSSISSQLSSPESIWIEAVYIPYSLEKNVES 239

Query: 244 VTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASSEMRLYFAAPKSYLLDLSSDLP 303
           +TLNVSSTGYYLD IAR L   D +KILVS RT+GKASSEMRLYF+AP+ YL+DL SDL 
Sbjct: 240 LTLNVSSTGYYLDAIARKLSLADTSKILVS-RTVGKASSEMRLYFSAPEWYLVDLLSDL- 297

Query: 304 NVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLT 363
           NVEEV   EGS N RASY  G  IYG+AILASIGYT +S  LFHED++LQSYYR+LI   
Sbjct: 298 NVEEVNSEEGSFNARASYFSGHAIYGNAILASIGYTWRSMDLFHEDVSLQSYYRLLISKI 357

Query: 364 PSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKES 423
           PSGVYKLSREAILTAELPMAFTTR NW+GSFPR++L  FCRQH LSEPVFS  S  LK+S
Sbjct: 358 PSGVYKLSREAILTAELPMAFTTRANWKGSFPRDLLCSFCRQHRLSEPVFSMLSTPLKQS 417

Query: 424 SESSRFYEKSAALESAETGKECTSGGGT--------AASDNVRCEVKIFSKSRDPILECS 475
           SE S   ++    ES+    E  +G G            D   CE+KI+SK +D I+E S
Sbjct: 418 SEVSGSCKRLKVAESSAEETEYRNGAGVVPHGNESVGLGDTFMCEIKIYSKLQDLIIEYS 477

Query: 476 PKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSY 535
           PK+ Y+K +++++N+SL+VL  LN YFK+ D+PLEKL     A DI  YP+ F K F+S 
Sbjct: 478 PKDSYRKHSDALQNSSLRVLLCLNTYFKELDMPLEKL---ASAADIHIYPEKFAKTFASC 534

Query: 536 RFIHNVQQRK--MGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSV 593
             IHN++QR     E+LL +NSIN    +P H +Y  +I GPDSG  PSNG L+ I+Y  
Sbjct: 535 PSIHNLRQRNETQRERLLDSNSINQPYIMPGHELYSFNIKGPDSGTSPSNGSLACINYVA 594

Query: 594 SLVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAA 653
            LV EGE MKE +ES +EFEFE+G GAVIP +EVV  QMSVGQSACF  +LPPQELILAA
Sbjct: 595 FLVAEGEHMKERVESNDEFEFEIGVGAVIPHLEVVVTQMSVGQSACFNMDLPPQELILAA 654

Query: 654 ADDSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESC 713
             D  +T SLLSS+ C LEY I LLRVTEP EDRMEQALFSPPLSKQRV +ALQHIKES 
Sbjct: 655 TGDPVKTISLLSSKVCFLEYSIVLLRVTEPLEDRMEQALFSPPLSKQRVGFALQHIKESS 714

Query: 714 ATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCT 773
           A TL+DFGCGSGSLLDSLLD+PT+LEKIVGVDIS+KSLSRAAK++HSKLS+  DA  P  
Sbjct: 715 AATLIDFGCGSGSLLDSLLDFPTSLEKIVGVDISKKSLSRAAKLLHSKLSRNSDAGEPSG 774

Query: 774 DVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTP 833
            +KSA+L++GSIT FD RL+GFDIGTCLEVIEHMEED+A  FG++VLS F P++LIVSTP
Sbjct: 775 GIKSAILYEGSITFFDPRLYGFDIGTCLEVIEHMEEDQACLFGDVVLSYFCPKVLIVSTP 834

Query: 834 NYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSV 893
           NYEYNAILQ+S+ + QE+DPDE +Q Q+C+FRNHDHKFEWTR QFN WA+ LA +HNYSV
Sbjct: 835 NYEYNAILQRSNPSNQEEDPDETSQSQACRFRNHDHKFEWTRKQFNHWASNLARKHNYSV 894

Query: 894 EFSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWD 943
           EFSGVGGS D EPGFAS +AVFR   P E D+     D    Y+V+WEWD
Sbjct: 895 EFSGVGGSADVEPGFASHMAVFRRSVPLETDNHPNPVDLIRQYEVVWEWD 944

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297740849|emb|CBI31031.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564369|ref|XP_002523181.1| conserved hypothetical protein [Ricinus communis] gi|223537588|gb|EEF39212.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224122146|ref|XP_002330552.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] gi|222872110|gb|EEF09241.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224061609|ref|XP_002300565.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] gi|222847823|gb|EEE85370.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510770|ref|XP_003524107.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449435894|ref|XP_004135729.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528106|ref|XP_003532646.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449529457|ref|XP_004171716.1| PREDICTED: LOW QUALITY PROTEIN: small RNA 2'-O-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15638615|gb|AAL05056.1|AF411383_1 HEN1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query952
TAIR|locus:2133114942 HEN1 "HUA ENHANCER 1" [Arabido 0.945 0.955 0.478 4.4e-210
TAIR|locus:2133124743 AT4G20920 [Arabidopsis thalian 0.488 0.625 0.426 3.1e-123
ZFIN|ZDB-GENE-050417-387 402 henmt1 "HEN1 methyltransferase 0.153 0.363 0.295 1.8e-23
RGD|1306230 394 Henmt1 "HEN1 methyltransferase 0.238 0.576 0.269 7.5e-16
MGI|MGI:1913965 395 Henmt1 "HEN1 methyltransferase 0.238 0.574 0.265 4.8e-15
POMBASE|SPBC336.05c 378 SPBC336.05c "small RNA 2'-O-me 0.196 0.494 0.312 1.5e-14
UNIPROTKB|C0IN03 369 henmt1 "Small RNA 2'-O-methylt 0.244 0.631 0.253 3.7e-14
UNIPROTKB|F1S579 382 F1S579 "Uncharacterized protei 0.233 0.581 0.259 1.6e-13
UNIPROTKB|I3LD15 385 LOC100153448 "Uncharacterized 0.233 0.576 0.259 1.6e-13
UNIPROTKB|E1BVR9 376 HENMT1 "Small RNA 2'-O-methylt 0.241 0.611 0.244 1.9e-13
TAIR|locus:2133114 HEN1 "HUA ENHANCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2031 (720.0 bits), Expect = 4.4e-210, P = 4.4e-210
 Identities = 453/947 (47%), Positives = 594/947 (62%)

Query:    17 TPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK 76
             TPKAII QKFG  A +TV+EV D  Q+GC GLAIPQKGPCLYRC LQLPEFSVVS  FKK
Sbjct:    10 TPKAIIHQKFGAKASYTVEEVHDSSQSGCLGLAIPQKGPCLYRCHLQLPEFSVVSNVFKK 69

Query:    77 KKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAA 136
             KKD+EQSAAE AL+KLGI P  +  + +EA D+++  +K++FS+EFLS++ PL  H  AA
Sbjct:    70 KKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAA 129

Query:   137 LRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSE 196
             LRRDG+  GSVP SVIA  D+K+ + CK+INP VES   L ++Y+M+AA +L++++V S 
Sbjct:   130 LRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASP 189

Query:   197 GQLSIWRKDPYPXXXXXXXXXXXXXXXXXXCIEAIHIPSSLEMAVHPVTLNVSSTGYYLD 256
               L   RK+ YP                   + A++IP   E  V   TL +SS  +YLD
Sbjct:   190 HGLR--RKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLD 247

Query:   257 VIARNLDQTDGNKILVSSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLPNV--EEVVDFE 312
              IA  L   DGN++++S R  GKAS  SE RLY   PK YL D SSD      E+     
Sbjct:   248 SIAERLGLKDGNQVMIS-RMFGKASCGSECRLYSEIPKKYL-DNSSDASGTSNEDSSHIV 305

Query:   313 GSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSR 372
              S N RASY+ GQDI+GDAILAS+GY  KS+ L ++D+T+ S+YR+   ++P+G+YK+SR
Sbjct:   306 KSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISR 365

Query:   373 EAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFXXXXXXXXXXXXXXRFYEK 432
             +A++ A+LP AFTT++NWRG  PRE+L +FC QH L+EP+               R ++K
Sbjct:   366 QAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKK 425

Query:   433 ------SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNES 486
                     A E+    KE T G G       RCEVKIF+KS+D +LECSP++FY+K+N++
Sbjct:   426 LKVSGVDDANENLSRQKEDTPGLG----HGFRCEVKIFTKSQDLVLECSPRKFYEKENDA 481

Query:   487 IENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKM 546
             I+NASLK L W + +F D D+  E+  +     D +    N F      +  H+ + +  
Sbjct:   482 IQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNT 541

Query:   547 G----EKLLQANSINTLNAIPEHGIYCLSIG-GPD---SGIYPSNGCLSFISYSVSLVIE 598
                  EK +Q+ +  ++ +I     Y LS+   P+    G  P     S           
Sbjct:   542 NVLSAEKRVQSITNGSVVSI----CYSLSLAVDPEYSSDGESPREDNESNEEMESEYSAN 597

Query:   599 GETMKXXXXXXXXXXXXMGTGAVIPQVEVVTAQMSVGQSACFCKELPP---QELILAAAD 655
              E+              +GTG++ P +E    QM+VG+ A F +  PP   + LILA   
Sbjct:   598 CESSVELIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASF-RMTPPDAAEALILAVGS 656

Query:   656 DSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCAT 715
             D+ R  SLLS R C L Y+I LL V  P E+RME A F PPLSKQRVEYAL+HI+ES A+
Sbjct:   657 DTVRIRSLLSERPC-LNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSAS 715

Query:   716 TLVXXXXXXXXXXXXXXXYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDV 775
             TLV               YPT+L+ I+GVDIS K L+RAAK++H KL+K+      C +V
Sbjct:   716 TLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNKEA-----C-NV 769

Query:   776 KSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNY 835
             KSA L+DGSI  FDSRLH  DIGTCLEVIEHMEED+A +FG  VLS F P++LIVSTPNY
Sbjct:   770 KSATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNY 829

Query:   836 EYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEF 895
             E+N ILQ+S+   QE++  E  QL   KFRNHDHKFEWTR+QFN WA++L  RHNYSVEF
Sbjct:   830 EFNTILQRSTPETQEENNSEP-QLP--KFRNHDHKFEWTREQFNQWASKLGKRHNYSVEF 886

Query:   896 SGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEW 942
             SGVGGSG+ EPGFASQIA+FR R     +++ +   S   YKVIWEW
Sbjct:   887 SGVGGSGEVEPGFASQIAIFR-REASSVENVAES--SMQPYKVIWEW 930
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA;IMP;NAS
GO:0010093 "specification of floral organ identity" evidence=IMP
GO:0009909 "regulation of flower development" evidence=RCA;IMP
GO:0008173 "RNA methyltransferase activity" evidence=IMP;IDA
GO:0035279 "mRNA cleavage involved in gene silencing by miRNA" evidence=IMP
GO:0009616 "virus induced gene silencing" evidence=RCA;IMP
GO:0005634 "nucleus" evidence=IDA
GO:0030422 "production of siRNA involved in RNA interference" evidence=IGI;IMP
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009886 "post-embryonic morphogenesis" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010051 "xylem and phloem pattern formation" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0016458 "gene silencing" evidence=RCA
GO:0016569 "covalent chromatin modification" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
GO:0048507 "meristem development" evidence=RCA
GO:0010305 "leaf vascular tissue pattern formation" evidence=IMP
GO:0010589 "leaf proximal/distal pattern formation" evidence=IMP
TAIR|locus:2133124 AT4G20920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-387 henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306230 Henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913965 Henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
POMBASE|SPBC336.05c SPBC336.05c "small RNA 2'-O-methyltransferase activity (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|C0IN03 henmt1 "Small RNA 2'-O-methyltransferase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1S579 F1S579 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LD15 LOC100153448 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVR9 HENMT1 "Small RNA 2'-O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C5Q8HEN1_ARATH2, ., 1, ., 1, ., n, 80.51100.94530.9554yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query952
TIGR04074462 TIGR04074, bacter_Hen1, 3' terminal RNA ribose 2'- 1e-47
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 1e-07
TIGR01983224 TIGR01983, UbiG, ubiquinone biosynthesis O-methylt 1e-06
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 3e-06
pfam0003566 pfam00035, dsrm, Double-stranded RNA binding motif 4e-05
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m 6e-05
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 6e-05
PRK05134233 PRK05134, PRK05134, bifunctional 3-demethylubiquin 8e-05
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 3e-04
cd0004868 cd00048, DSRM, Double-stranded RNA binding motif 4e-04
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 9e-04
smart0035867 smart00358, DSRM, Double-stranded RNA binding moti 0.001
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 0.002
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 0.002
>gnl|CDD|234456 TIGR04074, bacter_Hen1, 3' terminal RNA ribose 2'-O-methyltransferase Hen1 Back     alignment and domain information 
 Score =  176 bits (448), Expect = 1e-47
 Identities = 87/237 (36%), Positives = 122/237 (51%), Gaps = 27/237 (11%)

Query: 680 VTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALE 739
             E  E+  E+    P L++QR+E  +  ++ES A +++D GCG G LL  LL      E
Sbjct: 252 TEEAQEEAAEK---PPSLNRQRLEAVVAALRESGARSVLDLGCGEGKLLRLLLAEK-QFE 307

Query: 740 KIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGT 799
           +I GVD+S + L  AA+    +L  KLD   P    +   LF GS+T  D RL GFD   
Sbjct: 308 RIAGVDVSARELEIAAR----RL--KLDRM-PERQRERIQLFQGSLTYRDKRLKGFDAAV 360

Query: 800 CLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQL 859
            +EVIEH++         +V    RP  +IV+TPN EYN + +                L
Sbjct: 361 LVEVIEHLDPPRLPALERVVFEFARPGTVIVTTPNAEYNVLFE---------------SL 405

Query: 860 QSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFR 916
            +   R+ DH+FEWTR +F  WA  +A R  Y+VEF  + G  D E G  +Q+AVF 
Sbjct: 406 PAGGLRHRDHRFEWTRAEFAAWAEGVAERFGYTVEFLPI-GDEDPEVGAPTQMAVFT 461

Members of this protein family are bacterial Hen1, a 3' terminal RNA ribose 2'-O-methyltransferase that acts in bacterial RNA repair. All members of the seed alignment belong to a cassette with the RNA repair enzyme polynucleotide kinase-phosphatase (Pnkp). Chemically similar Hen1 in eukaryotes acts instead on small regulatory RNAs [Transcription, RNA processing, Protein synthesis, tRNA and rRNA base modification]. Length = 462
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|235350 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 952
KOG1045404 consensus Uncharacterized conserved protein HEN1/C 100.0
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.73
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.71
KOG1045 404 consensus Uncharacterized conserved protein HEN1/C 99.65
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.6
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.6
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.58
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.58
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.58
PLN02233261 ubiquinone biosynthesis methyltransferase 99.57
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.56
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.55
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.54
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.52
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.51
PLN02244340 tocopherol O-methyltransferase 99.51
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.49
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.49
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.48
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.48
PRK11207197 tellurite resistance protein TehB; Provisional 99.48
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.47
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.46
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.45
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.44
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.44
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.43
PRK06202232 hypothetical protein; Provisional 99.42
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.42
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.42
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.4
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.4
PRK12335287 tellurite resistance protein TehB; Provisional 99.4
TIGR00452314 methyltransferase, putative. Known examples to dat 99.39
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.39
PLN02336475 phosphoethanolamine N-methyltransferase 99.38
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.38
PRK05785226 hypothetical protein; Provisional 99.37
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.36
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.35
PRK08317241 hypothetical protein; Provisional 99.35
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.35
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.34
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.33
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.33
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.31
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.3
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.28
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.27
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.25
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.25
PLN02490340 MPBQ/MSBQ methyltransferase 99.25
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.23
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.23
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.22
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.21
PLN02336 475 phosphoethanolamine N-methyltransferase 99.2
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.19
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.19
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.19
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.17
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.17
KOG1271227 consensus Methyltransferases [General function pre 99.16
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.16
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.14
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.12
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.12
PRK06922677 hypothetical protein; Provisional 99.1
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.09
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.07
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.06
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.06
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.05
PLN03075296 nicotianamine synthase; Provisional 99.05
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.03
TIGR03438301 probable methyltransferase. This model represents 99.02
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.99
PRK07402196 precorrin-6B methylase; Provisional 98.97
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.96
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.94
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.93
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.91
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.91
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.91
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.9
KOG4300252 consensus Predicted methyltransferase [General fun 98.9
PRK14968188 putative methyltransferase; Provisional 98.89
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.89
PRK14967223 putative methyltransferase; Provisional 98.88
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.88
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.87
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.85
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.83
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.83
PRK04266226 fibrillarin; Provisional 98.83
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.83
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.8
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.8
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.78
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.77
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.76
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.75
KOG2899288 consensus Predicted methyltransferase [General fun 98.75
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.75
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.75
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.74
PRK14904445 16S rRNA methyltransferase B; Provisional 98.72
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.69
PRK14901434 16S rRNA methyltransferase B; Provisional 98.69
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.68
PRK14903431 16S rRNA methyltransferase B; Provisional 98.65
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.63
KOG3010261 consensus Methyltransferase [General function pred 98.63
PRK14902444 16S rRNA methyltransferase B; Provisional 98.61
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.6
PHA03411279 putative methyltransferase; Provisional 98.6
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.6
PRK00811283 spermidine synthase; Provisional 98.6
PRK10901427 16S rRNA methyltransferase B; Provisional 98.59
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.59
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.59
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.56
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.56
PTZ00146293 fibrillarin; Provisional 98.56
TIGR00438188 rrmJ cell division protein FtsJ. 98.55
PLN02232160 ubiquinone biosynthesis methyltransferase 98.54
COG4123248 Predicted O-methyltransferase [General function pr 98.53
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.51
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.5
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.5
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.48
PHA03412241 putative methyltransferase; Provisional 98.45
PRK04457262 spermidine synthase; Provisional 98.43
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.42
PLN02366308 spermidine synthase 98.41
KOG2361264 consensus Predicted methyltransferase [General fun 98.39
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.38
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.37
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.37
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.36
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.35
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.35
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.35
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.34
PLN02476278 O-methyltransferase 98.34
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.34
PRK01581374 speE spermidine synthase; Validated 98.32
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.32
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.28
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.25
PRK04148134 hypothetical protein; Provisional 98.25
COG2890280 HemK Methylase of polypeptide chain release factor 98.24
PRK03612521 spermidine synthase; Provisional 98.23
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.22
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.21
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.21
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.19
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.16
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.15
PLN02672 1082 methionine S-methyltransferase 98.12
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.1
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.06
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.03
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.01
PLN02589247 caffeoyl-CoA O-methyltransferase 98.0
COG1041347 Predicted DNA modification methylase [DNA replicat 97.99
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.98
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.98
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.97
COG4122219 Predicted O-methyltransferase [General function pr 97.97
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.97
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.95
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.91
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.88
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.84
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.82
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.81
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.79
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.79
KOG2940325 consensus Predicted methyltransferase [General fun 97.77
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.75
PLN02823336 spermine synthase 97.74
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.71
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.7
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.69
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.68
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.66
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.65
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.61
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 97.6
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.6
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.58
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.58
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.58
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.56
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.54
PF0003567 dsrm: Double-stranded RNA binding motif; InterPro: 97.51
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.51
KOG1331293 consensus Predicted methyltransferase [General fun 97.49
PF13679141 Methyltransf_32: Methyltransferase domain 97.47
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.47
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.47
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.38
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.37
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.35
PRK00536262 speE spermidine synthase; Provisional 97.34
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.31
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.28
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.27
KOG2904328 consensus Predicted methyltransferase [General fun 97.25
COG2520341 Predicted methyltransferase [General function pred 97.19
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.18
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.18
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.12
smart0035867 DSRM Double-stranded RNA binding motif. 97.1
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.09
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.04
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.9
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.87
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.84
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.83
COG4076252 Predicted RNA methylase [General function predicti 96.8
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.78
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.75
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.69
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.67
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.61
COG2521287 Predicted archaeal methyltransferase [General func 96.58
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.56
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 96.54
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.53
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 96.52
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 96.4
KOG3987288 consensus Uncharacterized conserved protein DREV/C 96.38
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.26
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 96.17
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.12
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 96.09
COG3897218 Predicted methyltransferase [General function pred 96.05
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.03
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.89
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 95.87
COG0742187 N6-adenine-specific methylase [DNA replication, re 95.82
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 95.51
COG2384226 Predicted SAM-dependent methyltransferase [General 95.41
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 95.37
PRK12371235 ribonuclease III; Reviewed 95.34
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 95.31
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 95.29
PHA03103183 double-strand RNA-binding protein; Provisional 95.28
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 95.18
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 95.11
COG4262508 Predicted spermidine synthase with an N-terminal m 95.03
PF03514374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 94.54
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 94.22
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 94.06
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 94.04
PRK10742250 putative methyltransferase; Provisional 93.87
KOG2730263 consensus Methylase [General function prediction o 93.7
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 93.64
KOG4058199 consensus Uncharacterized conserved protein [Funct 93.52
KOG3115249 consensus Methyltransferase-like protein [General 93.2
COG4301321 Uncharacterized conserved protein [Function unknow 93.04
PRK00102229 rnc ribonuclease III; Reviewed 93.03
PF1470980 DND1_DSRM: double strand RNA binding domain from D 92.61
TIGR02191220 RNaseIII ribonuclease III, bacterial. This family 92.33
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 92.3
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 92.23
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 92.18
cd0803175 LARP_4_5_like La RNA-binding domain of proteins si 91.93
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.78
cd0803090 LA_like_plant La-motif domain of plant proteins si 91.71
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 91.55
smart0035867 DSRM Double-stranded RNA binding motif. 91.37
PF0336890 Dicer_dimer: Dicer dimerisation domain; InterPro: 91.23
COG0571235 Rnc dsRNA-specific ribonuclease [Transcription] 90.98
KOG1709271 consensus Guanidinoacetate methyltransferase and r 90.7
PF1470980 DND1_DSRM: double strand RNA binding domain from D 90.35
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 90.12
smart0071580 LA Domain in the RNA-binding Lupus La protein; unk 89.03
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 88.98
PRK12372413 ribonuclease III; Reviewed 88.96
KOG3201201 consensus Uncharacterized conserved protein [Funct 88.66
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 88.4
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 87.99
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 87.56
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 87.14
cd0732375 LAM LA motif RNA-binding domain. This domain is fo 86.78
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 86.6
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 86.23
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 85.84
KOG1562337 consensus Spermidine synthase [Amino acid transpor 85.62
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 85.31
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 85.24
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 83.58
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 83.45
cd0803473 LARP_1_2 La RNA-binding domain proteins similar to 83.4
cd0802976 LA_like_fungal La-motif domain of fungal proteins 83.33
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 83.06
cd0803377 LARP_6 La RNA-binding domain of La-related protein 82.3
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 82.26
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 81.99
KOG1501 636 consensus Arginine N-methyltransferase [General fu 81.74
cd0803873 LARP_2 La RNA-binding domain of La-related protein 80.99
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 80.13
>KOG1045 consensus Uncharacterized conserved protein HEN1/CORYMBOSA2 [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-42  Score=374.28  Aligned_cols=382  Identities=28%  Similarity=0.321  Sum_probs=322.4

Q ss_pred             cceEEeeecCccccccccCC--CCCccccccccCCCCCccccccccccccceeeeeccceeecCCccccccchhhhhhhh
Q 002218          282 SEMRLYFAAPKSYLLDLSSD--LPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRML  359 (952)
Q Consensus       282 ~e~r~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~n~ras~~~~~~i~g~ai~a~~g~~~~~~~l~~~~~~~~~~~r~~  359 (952)
                      .||  |...|+    +.+..  +.....-.|+..++ +||+|.|||+|+||+|+|+|||+||                  
T Consensus         6 ~~c--~~~~~~----n~~e~~~~~~~~~~~~l~~~r-~r~~fk~~qd~~~~~~~a~~g~~w~------------------   60 (404)
T KOG1045|consen    6 DEC--YSDIPK----NSLEAALLTPIDFSPPLAKQR-ARASFKNLQDIHGDKILADVGCGWR------------------   60 (404)
T ss_pred             CcC--cccCCc----chhhhccccccccccHHHHHh-hhhhhhcccCCCcchhhhhcCCccc------------------
Confidence            367  888888    22222  23344447888899 9999999999999999999999996                  


Q ss_pred             hccCCCcccccchhhhhhhcCCcceeeccccCCCChhhHHHhhhhhcccCcceeccccCCccccccchhhhhhhhhcccc
Q 002218          360 IHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESA  439 (952)
Q Consensus       360 ~~~~p~g~yk~sr~~~~~a~lp~~~t~~~~w~g~~pr~~l~~fc~~~~l~ep~~~~~~~~~~~~~~~~~~~~~~~~~~~~  439 (952)
                       |.+|+|+||.||++++.|.||..+| +.+|||++||.+||+||||++|.+|++....++++.++++.|+.+++++....
T Consensus        61 -~~s~n~~~k~s~~~~~~agl~f~~~-k~~~r~~~~~~~l~dF~r~r~l~l~I~~~~G~~v~s~s~i~~~d~v~~~e~ie  138 (404)
T KOG1045|consen   61 -GSSYNGIYKESRTIEILAGLDFNET-KSVWRGPSVRPILGDFLRSRQLPLPILLLSGNVVDSLSKILRSDAVLAIELIE  138 (404)
T ss_pred             -ccccccccccchhhHHHcCCCchhh-hhhhcCcchhHHHHHHhhhhcCCcceeeecCCccccHHHHHhhhhhhhhhhhh
Confidence             9999999999999999999999998 99999999999999999999999999999999999999999999999776544


Q ss_pred             cccccccCCCcccCCCc---eeEEEEEeeccCCcccccCchhhhhhhhhhHhhhhhHHHHHHHhhhCCCCCCcccccccc
Q 002218          440 ETGKECTSGGGTAASDN---VRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLV  516 (952)
Q Consensus       440 ~~~~~~~~~~~~~~~~~---f~c~v~~~s~~~~~~~~~~~~~~~~~~~dai~~a~l~~l~~~~~~~~~~~~~~~~~~~~~  516 (952)
                      ..+++.    ...-.++   |+|+++|..+.+++.++|++.+||.+.++||||++++++.|..+-|++      +.+..+
T Consensus       139 h~ds~~----~~~ip~~vfG~~~p~~iv~stpn~~~N~~~~kf~~l~p~~~~~~s~h~feW~r~eFa~------w~~~vd  208 (404)
T KOG1045|consen  139 HVDSEP----LLSIPELVFGFLCPVKIVKSTPNLVFNCIFRKFNTLLPSAIRRHSDHKFEWPRKEFAD------WALYVD  208 (404)
T ss_pred             cccchh----hhccchhhcccccceEEEEeCCCccccchhhhhcccCchhhhccccccccccHHHHHH------HHhhhh
Confidence            444221    1111222   999999999999999999999999999999999999999999999999      666666


Q ss_pred             CcCCeeeccchhhhhcccccchhccccccccccccccccccccccCCCCceeeeccCCCCCCccCCCCceeEEEEEEEEe
Q 002218          517 GALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLV  596 (952)
Q Consensus       517 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~gs~~~i~y~~~l~  596 (952)
                      +..|......+-.-.....+.                   +.   .+..+++++.|         +||+.+-|+|+..+.
T Consensus       209 ~~y~~~~~~~~~vg~pp~~~e-------------------~v---~~~~qirIfs~---------t~g~~~qi~~~~~~~  257 (404)
T KOG1045|consen  209 DRYDMYVVEHTGVGNPPKLVE-------------------NV---GLMPQIRIFSI---------TNGSYTQICYSEQSK  257 (404)
T ss_pred             hcCcceEEeecccCCchhhhc-------------------cc---cccceeEEEEe---------cCCcEEEEeeccccc
Confidence            666655444332222211111                   11   15677888888         999999999999998


Q ss_pred             ec-ccc--hhhhhccccceEEEeccCccchhhhhhhhhccccccceecccCC-chhhhhhhccCcccchhcccccccccc
Q 002218          597 IE-GET--MKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELP-PQELILAAADDSARTFSLLSSRACCLE  672 (952)
Q Consensus       597 ~~-~~~--~~~~~e~~~~~~fe~g~~a~~~~l~~v~~q~sv~q~~~~~~~l~-~~~l~lAa~~~~~~DiSlLs~d~~~LE  672 (952)
                      +. ++|  .+-..||+++++|++|.+.+..+++..|+||++|+-++|-+..+ +.++++.+......+.+.|..-.+ ++
T Consensus       258 ~~~~~~~f~~s~~es~e~~e~~v~~~~~~q~~~~~v~q~~~g~k~~f~~s~~~~~~l~~~~~~~~~~~~s~l~~v~~-~~  336 (404)
T KOG1045|consen  258 VNADKHKFGKSRKESNEEIEKLVGRFEMNQHLEPEVQQMLVGYKAQFGASQPAAERLQVTLNTPTPCELSVLEEVGH-LK  336 (404)
T ss_pred             CCcchhccccCchHHhhhhhhhhccccccccccHHHHHHHHHHHHHhhcCcccccceeeeccCCcccccchhhhhcc-ch
Confidence            77 333  33455699999999999999999999999999999999999999 677799999999999998888888 99


Q ss_pred             eeeeecccCCChhhhhhhhcCCchhHHHHHHHHHHHhhcCCCCEEEEEcCccchHHHHHh
Q 002218          673 YHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLL  732 (952)
Q Consensus       673 yyI~LL~v~ep~EeRye~~~F~PPL~~QR~efVldlL~~~k~krVLDIGCGeG~ll~~LA  732 (952)
                      +.+.++.+.-+.+++++..++.|....+|..+...+.......++|+-|||.|.......
T Consensus       337 ~~i~ll~~~~~~~~~~el~~~~~~~~~~~~~~~~k~s~~ssa~~~l~~~~~s~v~~d~~~  396 (404)
T KOG1045|consen  337 ERIGLLLVAGNLEKEIELDFLKPSLKKQRLEYALKHSRSSSADTLLLFSCGSGVLFDLTL  396 (404)
T ss_pred             hccccceeccCcceeeehhhccchhhhhchhhHhhhhHHhhhhhhhhhccccceehhhcc
Confidence            999999999999999999999999999999999999888888999999999998875443

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG1045 consensus Uncharacterized conserved protein HEN1/CORYMBOSA2 [Function unknown] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK12371 ribonuclease III; Reviewed Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03103 double-strand RNA-binding protein; Provisional Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00102 rnc ribonuclease III; Reviewed Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>TIGR02191 RNaseIII ribonuclease III, bacterial Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases Back     alignment and domain information
>COG0571 Rnc dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>PRK12372 ribonuclease III; Reviewed Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>cd07323 LAM LA motif RNA-binding domain Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>cd08033 LARP_6 La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>cd08038 LARP_2 La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query952
3htx_A950 Crystal Structure Of Small Rna Methyltransferase He 0.0
3jwh_A217 Crystal Structure Analysis Of The Methyltransferase 9e-25
3jwj_A202 Crystal Structure Analysis Of The Methyltransferase 2e-24
3jwi_A207 Crystal Structure Analysis Of The Methyltransferase 9e-24
3jwg_A219 Crystal Structure Analysis Of The Methyltransferase 6e-23
>pdb|3HTX|A Chain A, Crystal Structure Of Small Rna Methyltransferase Hen1 Length = 950 Back     alignment and structure 
Iteration: 1

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/947 (47%), Positives = 590/947 (62%), Gaps = 47/947 (4%)
Query: 17  TPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK 76
           TPKAII QKFG  A +TV+EV D  Q+GCPGLAIPQKGPCLYRC LQLPEFSVVS  FKK
Sbjct: 18  TPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEFSVVSNVFKK 77
Query: 77  KKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAA 136
           KKD+EQSAAE AL+KLGI P  +  + +EA D+++  +K++FS+EFLS++ PL  H  AA
Sbjct: 78  KKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAA 137
Query: 137 LRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSE 196
           LRRDG+  GSVP SVIA  D+K+ + CK+INP VES   L ++Y+M+AA +L++++V S 
Sbjct: 138 LRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASP 197
Query: 197 GQLSIWRKDPYPXXXXXXXXXXXXXXXXXXCIEAIHIPSSLEMAVHPVTLNVSSTGYYLD 256
             L   RK+ YP                   + A++IP   E  V   TL +SS  +YLD
Sbjct: 198 HGLR--RKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLD 255
Query: 257 VIARNLDQTDGNKILVSSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLPNV--EEVVDFE 312
            IA  L   DGN++++ SR  GKAS  SE RLY   PK Y LD SSD      E+     
Sbjct: 256 SIAERLGLKDGNQVMI-SRMFGKASCGSECRLYSEIPKKY-LDNSSDASGTSNEDSSHIV 313
Query: 313 GSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSR 372
            S N RASY+ GQDI+GDAILAS+GY  KS+ L ++D+T+ S+YR+   ++P+G+YK+SR
Sbjct: 314 KSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISR 373
Query: 373 EAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFXXXXXXXXXXXXXXRFYEK 432
           +A++ A+LP AFTT++NWRG  PRE+L +FC QH L+EP+               R ++K
Sbjct: 374 QAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKK 433
Query: 433 ------SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNES 486
                   A E+    KE T G G       RCEVKIF+KS+D +LECSP++FY+K+N++
Sbjct: 434 LKVSGVDDANENLSRQKEDTPGLGHG----FRCEVKIFTKSQDLVLECSPRKFYEKENDA 489
Query: 487 IENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKM 546
           I+NASLK L W + +F D D+  E+  +     D +    N F      +  H+ + +  
Sbjct: 490 IQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNT 549
Query: 547 ----GEKLLQANSINTLNAIPEHGIYCLSIG-GPD---SGIYPSNGCLSFISYSVSLVIE 598
                EK +Q+ +  ++ +I     Y LS+   P+    G  P     S           
Sbjct: 550 NVLSAEKRVQSITNGSVVSI----CYSLSLAVDPEYSSDGESPREDNESNEEMESEYSAN 605
Query: 599 GETMKXXXXXXXXXXXXMGTGAVIPQVEVVTAQMSVGQSACFCKELPP---QELILAAAD 655
            E+              +GTG++ P +E    QM+VG+ A F K  PP   + LILA   
Sbjct: 606 CESSVEPIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASF-KMTPPDAAEALILAVGS 664
Query: 656 DSARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCAT 715
           D+ R  SLLS R  CL Y+I LL V  P E+RME A F PPLSKQRVEYAL+HI+ES A+
Sbjct: 665 DTVRIRSLLSERP-CLNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSAS 723
Query: 716 TLVXXXXXXXXXXXXXXXYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDV 775
           TLV               YPT+L+ I+GVDIS K L+RAAK++H KL+K+        +V
Sbjct: 724 TLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNKE------ACNV 777
Query: 776 KSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNY 835
           KSA L+DGSI  FDSRLH  DIGTCLEVIEHMEED+A +FG  VLS F P++LIVSTPNY
Sbjct: 778 KSATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNY 837
Query: 836 EYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEF 895
           E+N ILQ+S+   QE++  E    Q  KFRNHDHKFEWTR+QFN WA++L  RHNYSVEF
Sbjct: 838 EFNTILQRSTPETQEENNSEP---QLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEF 894
Query: 896 SGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEW 942
           SGVGGSG+ EPGFASQIA+FR      E+       S   YKVIWEW
Sbjct: 895 SGVGGSGEVEPGFASQIAIFRREASSVEN---VAESSMQPYKVIWEW 938
>pdb|3JWH|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Avhen1-C Length = 217 Back     alignment and structure
>pdb|3JWJ|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Avhen1-Cn Length = 202 Back     alignment and structure
>pdb|3JWI|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Cthen1-Cn Length = 207 Back     alignment and structure
>pdb|3JWG|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Cthen1-C Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query952
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 0.0
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-63
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 4e-63
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 1e-09
2p7i_A250 Hypothetical protein; putative methyltransferase, 2e-09
3cc8_A230 Putative methyltransferase; structural genomics, j 7e-09
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 1e-06
3dtn_A234 Putative methyltransferase MM_2633; structural gen 3e-06
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 1e-05
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 6e-05
3i9f_A170 Putative type 11 methyltransferase; structural gen 6e-05
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 8e-05
2b3t_A276 Protein methyltransferase HEMK; translation termin 9e-05
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 2e-04
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 2e-04
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 2e-04
2l33_A91 Interleukin enhancer-binding factor 3; structural 2e-04
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 3e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 5e-04
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 5e-04
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 5e-04
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 6e-04
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 6e-04
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 8e-04
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 8e-04
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 8e-04
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 9e-04
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 9e-04
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
 Score =  976 bits (2524), Expect = 0.0
 Identities = 467/947 (49%), Positives = 616/947 (65%), Gaps = 27/947 (2%)

Query: 8   VVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEF 67
           +    K   TPKAII QKFG  A +TV+EV D  Q+GCPGLAIPQKGPCLYRC LQLPEF
Sbjct: 9   MAGGGKHTPTPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEF 68

Query: 68  SVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQS 127
           SVVS  FKKKKD+EQSAAE AL+KLGI P  +  + +EA D+++  +K++FS+EFLS++ 
Sbjct: 69  SVVSNVFKKKKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEH 128

Query: 128 PLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATR 187
           PL  H  AALRRDG+  GSVP SVIA  D+K+ + CK+INP VES   L ++Y+M+AA +
Sbjct: 129 PLGAHLRAALRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAK 188

Query: 188 LSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLN 247
           L++++V S     + RK+ YP EI E+     S+S  S  + A++IP   E  V   TL 
Sbjct: 189 LADYIVAS--PHGLRRKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLY 246

Query: 248 VSSTGYYLDVIARNLDQTDGNKILVSSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLP-N 304
           +SS  +YLD IA  L   DGN++++ SR  GKAS  SE RLY   PK YL + S     +
Sbjct: 247 ISSNRHYLDSIAERLGLKDGNQVMI-SRMFGKASCGSECRLYSEIPKKYLDNSSDASGTS 305

Query: 305 VEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTP 364
            E+      S N RASY+ GQDI+GDAILAS+GY  KS+ L ++D+T+ S+YR+   ++P
Sbjct: 306 NEDSSHIVKSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSP 365

Query: 365 SGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESS 424
           +G+YK+SR+A++ A+LP AFTT++NWRG  PRE+L +FC QH L+EP+ S+ +  +K  S
Sbjct: 366 NGIYKISRQAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLS 425

Query: 425 ESSRFYEK--SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKK 482
           +  R ++K   + ++ A                  RCEVKIF+KS+D +LECSP++FY+K
Sbjct: 426 DIFRSHKKLKVSGVDDANENLSRQKEDTPGLGHGFRCEVKIFTKSQDLVLECSPRKFYEK 485

Query: 483 QNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQ 542
           +N++I+NASLK L W + +F D D+  E+  +     D +    N F      +  H+ +
Sbjct: 486 ENDAIQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSE 545

Query: 543 QRKMG----EKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIE 598
            +       EK +Q+ +  ++ +I       +       G  P     S           
Sbjct: 546 SKNTNVLSAEKRVQSITNGSVVSICYSLSLAVDPEYSSDGESPREDNESNEEMESEYSAN 605

Query: 599 GETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELP--PQELILAAADD 656
            E+  E +ES EE EFE+GTG++ P +E    QM+VG+ A F    P   + LILA   D
Sbjct: 606 CESSVEPIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASFKMTPPDAAEALILAVGSD 665

Query: 657 SARTFSLLSSRACCLEYHITLLRVTEPPEDRMEQALFSPPLSKQRVEYALQHIKESCATT 716
           + R  SLLS R  CL Y+I LL V  P E+RME A F PPLSKQRVEYAL+HI+ES A+T
Sbjct: 666 TVRIRSLLSERP-CLNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSAST 724

Query: 717 LVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVK 776
           LVDFGCGSGSLLDSLLDYPT+L+ I+GVDIS K L+RAAK++H KL+K         +VK
Sbjct: 725 LVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNK------EACNVK 778

Query: 777 SAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYE 836
           SA L+DGSI  FDSRLH  DIGTCLEVIEHMEED+A +FG  VLS F P++LIVSTPNYE
Sbjct: 779 SATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYE 838

Query: 837 YNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFS 896
           +N ILQ+S+    E   +  ++ Q  KFRNHDHKFEWTR+QFN WA++L  RHNYSVEFS
Sbjct: 839 FNTILQRSTP---ETQEENNSEPQLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFS 895

Query: 897 GVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWD 943
           GVGGSG+ EPGFASQIA+FR      E+           YKVIWEW 
Sbjct: 896 GVGGSGEVEPGFASQIAIFRREASSVENVAESSM---QPYKVIWEWK 939
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Length = 215 Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 Back     alignment and structure
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query952
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 100.0
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.96
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.95
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.7
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.69
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.66
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.66
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.66
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.65
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.65
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.64
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.64
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.64
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.64
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.63
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.63
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.63
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.63
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.63
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.62
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.6
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.6
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.59
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.59
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.59
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.59
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.58
3lcc_A235 Putative methyl chloride transferase; halide methy 99.58
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.58
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.58
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.57
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.57
3cc8_A230 Putative methyltransferase; structural genomics, j 99.57
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.56
3f4k_A257 Putative methyltransferase; structural genomics, P 99.56
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.56
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.56
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.56
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.56
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.55
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.55
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.55
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.55
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.55
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.54
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.53
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.53
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.53
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.53
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.52
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.52
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.52
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.52
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.51
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.51
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.51
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.51
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.5
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.48
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.47
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.47
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.47
3ocj_A305 Putative exported protein; structural genomics, PS 99.46
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.44
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.44
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.44
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.43
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.43
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.43
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.43
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.42
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.42
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.41
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.4
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.4
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.4
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.4
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.39
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.39
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.39
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.39
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.38
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.38
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.37
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.36
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.36
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.36
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.36
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.35
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.32
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.32
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.32
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.32
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.31
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.31
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.31
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.31
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.3
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.3
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.29
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.28
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.28
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.26
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.26
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.26
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.26
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.26
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.25
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.25
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.25
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.24
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.24
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.24
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.24
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.23
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.21
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.21
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.21
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.21
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.2
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.2
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.19
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.19
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.19
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.18
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.18
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.18
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.18
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.17
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.17
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.17
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.17
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.16
3lpm_A259 Putative methyltransferase; structural genomics, p 99.15
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.15
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.15
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.15
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.15
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.15
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.14
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.14
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.14
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.14
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.14
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.13
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.13
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.13
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.13
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.13
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.13
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.13
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.13
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.12
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.12
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.12
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.11
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.1
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.1
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.09
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.09
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.09
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.09
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.08
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.08
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.07
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.07
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.07
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.07
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.07
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.06
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.06
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.06
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.06
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.05
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.05
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.04
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.04
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.04
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.03
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.03
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.03
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.01
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.01
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.01
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.0
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.0
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.0
2b25_A336 Hypothetical protein; structural genomics, methyl 98.99
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.98
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.98
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.98
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.96
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.96
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.95
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.95
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.94
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.94
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.94
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.94
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.94
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.93
2h00_A254 Methyltransferase 10 domain containing protein; st 98.93
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.92
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.91
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.91
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.91
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.89
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.88
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.88
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.88
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.87
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.87
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.87
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.87
2i7c_A283 Spermidine synthase; transferase, structural genom 98.85
2o07_A304 Spermidine synthase; structural genomics, structur 98.85
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.84
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.83
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.83
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.82
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.82
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.81
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.81
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.81
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.8
2pt6_A321 Spermidine synthase; transferase, structural genom 98.8
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.79
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.79
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.78
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.78
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.77
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.76
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.71
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.7
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.69
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.69
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.69
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.68
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.66
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.66
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.65
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.64
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.64
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.63
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.63
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.62
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.61
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.61
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.6
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.6
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.58
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.58
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.58
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.57
3k6r_A278 Putative transferase PH0793; structural genomics, 98.57
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.52
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.47
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.44
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.42
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.42
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.38
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.32
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.29
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.26
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.22
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.21
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.19
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.09
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.07
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.98
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.93
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 97.85
3lkd_A542 Type I restriction-modification system methyltrans 97.81
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.68
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 97.63
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 97.6
3khk_A544 Type I restriction-modification system methylation 97.59
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.54
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.49
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.4
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 97.38
3p1x_A75 Interleukin enhancer-binding factor 3; structural 97.35
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.3
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.27
1x49_A97 Interferon-induced, double-stranded RNA- activated 97.24
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.17
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 97.06
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 97.05
2l33_A91 Interleukin enhancer-binding factor 3; structural 97.01
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 96.9
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.89
2dix_A84 Interferon-inducible double stranded RNA- dependen 96.88
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 96.87
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 96.85
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 96.82
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 96.81
2zig_A297 TTHA0409, putative modification methylase; methylt 96.78
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 96.77
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 96.76
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 96.73
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.73
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 96.7
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.67
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 96.66
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 96.65
1x48_A88 Interferon-induced, double-stranded RNA- activated 96.64
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 96.54
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 96.53
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 96.47
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 96.4
3ufb_A530 Type I restriction-modification system methyltran 96.29
1uil_A113 Double-stranded RNA-binding motif; structural geno 96.24
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 96.2
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 96.18
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 96.17
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.05
1whq_A99 RNA helicase A; double-stranded RNA binding domain 96.05
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 95.89
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 95.77
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 95.67
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 95.58
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 95.37
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 95.21
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 95.02
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.98
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 94.94
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 94.76
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 94.73
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 94.66
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 94.62
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 94.49
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 94.46
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 94.3
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 94.23
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 93.93
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 93.78
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 93.48
2cqk_A101 C-MPL binding protein; LA domain, structural genom 93.14
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 93.11
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 93.06
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 92.73
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 92.62
2ppn_A107 FK506-binding protein 1A; high resolution protein 92.38
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 92.06
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 92.05
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 91.99
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 91.47
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 91.4
2px2_A269 Genome polyprotein [contains: capsid protein C (co 91.09
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 90.85
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 90.81
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 90.81
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 90.33
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 90.02
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 89.78
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 89.48
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 88.22
1lss_A140 TRK system potassium uptake protein TRKA homolog; 88.08
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 88.07
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 87.74
2kou_A102 Dicer-like protein 4; ATP-binding, endonuclease, h 86.84
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 86.76
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 86.66
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 86.5
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 86.27
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 86.25
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 86.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 85.12
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 84.26
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 83.39
3ius_A286 Uncharacterized conserved protein; APC63810, silic 83.34
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 82.69
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 81.52
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 81.42
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 81.34
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 80.91
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 80.86
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=1.1e-279  Score=2429.25  Aligned_cols=895  Identities=52%  Similarity=0.838  Sum_probs=740.5

Q ss_pred             CCCCcccccccCCCChHhHHHHhccCceeEEEeeeeccccCCCCccccCCCCCceEEEeeecCCceeeeccccccchHHH
Q 002218            3 NGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQ   82 (952)
Q Consensus         3 ~~~~~~~~~~~~~~tpka~~~q~~g~~~~y~~~ev~~~~~~~~~~~~~~q~~~~~~~c~l~lp~~~v~~~~~~~kkdaeq   82 (952)
                      |+|+     +|+|+|||||||||||+|||||||||||++|+|||||||||||||||||+||||||+||||+|||||||||
T Consensus         9 ~~~~-----~~~~~~pk~~~~q~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~lp~~~~~~~~~~~kkd~eq   83 (950)
T 3htx_A            9 MAGG-----GKHTPTPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEFSVVSNVFKKKKDSEQ   83 (950)
T ss_dssp             -----------CCCCCHHHHHHTTGGGSEEEEEEECCSCSCCCTTCCSCCCCCCEEEEEEECSSCEEECCCBSCHHHHHH
T ss_pred             ccCC-----CCCCCCHHHHHHHHhCcceeeeehhhhcccCCCCCccccCCCCCeeEEEEeeCCCceEecchhhccccHHH
Confidence            5666     79999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCCCCCCChHHHHHHHHHHHhhhhcccccccCCCchhhhHHhhhhcCcccccccceEEEeeccccccc
Q 002218           83 SAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANL  162 (952)
Q Consensus        83 ~aa~~al~klg~~~~~~~~~~~e~~~~l~~~~~~~f~~e~~~~~~pl~~h~~~~~~r~g~~~g~~p~~~~~~~d~k~~~~  162 (952)
                      +||++||+||||+|+|++||++|+||+||+||+|+|+|||++++|||+|||||||||||||||+||+||||+||+||+|+
T Consensus        84 ~aa~~al~~~g~~~~~~~~~~~~~~~~~~~~~~~~f~~e~~~~~~pl~~h~~~~~~r~~~~~~~~p~~~~~~~d~k~~~~  163 (950)
T 3htx_A           84 SAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAALRRDGERCGSVPVSVIATVDAKINSR  163 (950)
T ss_dssp             HHHHHHHTTTTSTTTSCCCCHHHHHHHHHHHHHHHTSTGGGGCSSTHHHHHHHHHTSCGGGTTEECHHHHHHTCHHHHHH
T ss_pred             HHHHHHHHHhCCCccccCcchhhHHHHHHHHHHHHhhhhhhhccCchHHHHHHHHhhcCccccccchhhheehhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCcccccchHHHHHHHHHHhhccCCcEEeecCceeeeecCCCChhhhhhhhhhccCCCCcEEEEEEEecccccccee
Q 002218          163 CKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVH  242 (952)
Q Consensus       163 ck~~~~~~e~~p~~~~~~~~~a~~~~~~~~~~s~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~av~ip~~~~~~~~  242 (952)
                      ||+|||+||+|||||+|||||||++|||++ ||++| |||||+|||||||++++++||+++|+|+||||||||++|++|+
T Consensus       164 ck~~~~~~e~~p~~~~~~~~~a~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (950)
T 3htx_A          164 CKIINPSVESDPFLAISYVMKAAAKLADYI-VASPH-GLRRKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVE  241 (950)
T ss_dssp             HHHHCTHHHHCTHHHHHHHHHHHHHCCSSE-EEETT-EEEESSCCCHHHHHHHHHTCCCC---EEEEEEEECSSTTSCCE
T ss_pred             hhhcCcccccChHHHHHHHHHHhhcCCCcE-EeCCc-ccccCCCCCHHHHHHHHHHhcCCCcceEEEEEEeeccccccee
Confidence            999999999999999999999999999966 89999 9999999999999999999999999999999999999999999


Q ss_pred             eEEEEecCCcchHHHHHHhcCCCCCCeEEEEeeccccCCc--ceEEeeecCccccccccCC---CCCccccccccCCCCC
Q 002218          243 PVTLNVSSTGYYLDVIARNLDQTDGNKILVSSRTIGKASS--EMRLYFAAPKSYLLDLSSD---LPNVEEVVDFEGSLNP  317 (952)
Q Consensus       243 ~~~l~~~~~~~y~~~ia~~l~~~d~~~v~~~sr~~~k~~~--e~r~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~n~  317 (952)
                      +|||||||++||||+||++||++|+||||| |||||||||  ||||||+||| +++|++|+   ++|++| +|+||++|+
T Consensus       242 ~~~~~~~~~~~y~~~~a~~l~~~d~~~~~~-sr~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~~~~~n~  318 (950)
T 3htx_A          242 LDTLYISSNRHYLDSIAERLGLKDGNQVMI-SRMFGKASCGSECRLYSEIPK-KYLDNSSDASGTSNEDS-SHIVKSRNA  318 (950)
T ss_dssp             EEEEEECTTSCHHHHHHHHHTCSCSSSEEE-CCCBCHHHHSSCBEEEEECCH-HHHCCC-------------CCCCCBCH
T ss_pred             eeEEEecCCcchHHHHHHHhCCCccceEEE-EeeccCCCCCcceeEEEecch-hhhhhhhcccccccccc-ccccccccc
Confidence            999999999999999999999999999999 999999999  9999999999 66677776   999999 999999999


Q ss_pred             ccccccccccccceeeeeccceeecCCccccccchhhhhhhhhccCCCcccccchhhhhhhcCCcceeeccccCCCChhh
Q 002218          318 RASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPRE  397 (952)
Q Consensus       318 ras~~~~~~i~g~ai~a~~g~~~~~~~l~~~~~~~~~~~r~~~~~~p~g~yk~sr~~~~~a~lp~~~t~~~~w~g~~pr~  397 (952)
                      ||||||||+||||||||+|||||||++||||||||+|||||||||+|||||||||+||||||||++||||+||||+||||
T Consensus       319 ra~~~~~~~i~~~~~~a~~~~~~~~~~~~~~~~~~~~~~r~~~~~~p~g~~k~sr~~~~~a~lp~~~t~~~~w~g~~pr~  398 (950)
T 3htx_A          319 RASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISRQAVIAAQLPFAFTTKSNWRGPLPRE  398 (950)
T ss_dssp             HHHHHHTSCCBSCEEEEEEEECSSCSSEEEECCCHHHHHHHHHTTSHHHHHHHHHTCTTTBCCCSCCCCTTTCCSSCHHH
T ss_pred             cceeeecccccchhhhhhcCccccccccccccchhhhhHHHHhccCCCcceecchhhhhhhcCCcceecccccCCCChHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhhhcccCcceeccccCCccccccchhhhhhhhhcccccccccccCCCcccCCCc------eeEEEEEeeccCCcc
Q 002218          398 MLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESAETGKECTSGGGTAASDN------VRCEVKIFSKSRDPI  471 (952)
Q Consensus       398 ~l~~fc~~~~l~ep~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------f~c~v~~~s~~~~~~  471 (952)
                      |||+|||||||+||+|+++++|+|++|+++||++++   ++++++++| ||+|+++++|      |||||||+||+||||
T Consensus       399 ~l~~fc~~~~l~~~~~~~~~~~~k~~~~~~~~~~~~---~~~~~~~~~-~~~~~~~~~~~~~~~~f~c~~~~~~~~~~~~  474 (950)
T 3htx_A          399 ILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKKL---KVSGVDDAN-ENLSRQKEDTPGLGHGFRCEVKIFTKSQDLV  474 (950)
T ss_dssp             HHHHHHHTTTCCCCEEECCC------------------------------------------------CEEEEEETTEEE
T ss_pred             HHHHHHHHhhcCcceeeeccCccccccccccccccc---cccccchhh-hcCCcccCCCCCcccceEEEEEEEecccchh
Confidence            999999999999999999999999999999999999   778888888 9999999988      999999999999999


Q ss_pred             cccCchhhhhhhhhhHhhhhhHHHHHHHhhhCCCCCCccccccccCcCCeeeccchhhhhcccccchhcccccccccccc
Q 002218          472 LECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLL  551 (952)
Q Consensus       472 ~~~~~~~~~~~~~dai~~a~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  551 (952)
                      |||||+++|+||||||||||||||+|||+|||+||||+||||+++|++||+|+|+||+|||+||||              
T Consensus       475 ~~~~~~~~~~~~~~a~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------  540 (950)
T 3htx_A          475 LECSPRKFYEKENDAIQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQK--------------  540 (950)
T ss_dssp             EEECCSCCCSSHHHHHHHHHHHHHHHHHTSSCCC----------------------------------------------
T ss_pred             hccChhhhhhhccHHHHHHHHHHHHHHHHHHhccCCchhhcccccccccccccchhhhhhhhcccc--------------
Confidence            999999999999999999999999999999999999999999999999999999999999999999              


Q ss_pred             ccccccccccCCCCceeeeccCCCCCCccCCCCceeEEEEEEEEeecccchhh---------------------------
Q 002218          552 QANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKE---------------------------  604 (952)
Q Consensus       552 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~gs~~~i~y~~~l~~~~~~~~~---------------------------  604 (952)
                      +++|++++|+++|+++++++|         |||||+||||+||||+||+++||                           
T Consensus       541 ~~~~~~~~~~~~~~~~~~~~i---------~~gs~~~~~y~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  611 (950)
T 3htx_A          541 EHSSESKNTNVLSAEKRVQSI---------TNGSVVSICYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANCESSVE  611 (950)
T ss_dssp             --CCCEECC----------CC---------CTTEEEEEEEEEEEEECC----------------------------CCCE
T ss_pred             ccccccccccccccceeeecc---------CCCcEEEEEEEEEEEecCcccccccccccccccccccccccccchhhhhh
Confidence            999999999999999999999         99999999999999999999999                           


Q ss_pred             hhccccceEEEeccCccchhhhhhhhhccccccceecccCC--chhhhhhhccCcccchhcccccccccceeeeecccCC
Q 002218          605 LLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELP--PQELILAAADDSARTFSLLSSRACCLEYHITLLRVTE  682 (952)
Q Consensus       605 ~~e~~~~~~fe~g~~a~~~~l~~v~~q~sv~q~~~~~~~l~--~~~l~lAa~~~~~~DiSlLs~d~~~LEyyI~LL~v~e  682 (952)
                      +||||+||+||||.|+++++|+.+|+|||+||+++|.+.+|  |++|+++|........+.|+...+| +|....+...+
T Consensus       612 ~ies~~e~~fe~g~g~~~~~le~vV~qms~gqT~~F~~~~Pd~p~eLLLaAa~ep~R~~slLsre~~f-Eyals~lay~d  690 (950)
T 3htx_A          612 PIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASFKMTPPDAAEALILAVGSDTVRIRSLLSERPCL-NYNILLLGVKG  690 (950)
T ss_dssp             EEEEEEEEEEEETTTCBCHHHHHHHTTCCTTCEEEEEESSCCSCHHHHHHHCSCHHHHHHHTTSCEEE-EEEEEEEEEEC
T ss_pred             cccccHHHHHHHhcCCccchhhheeeeccccceeEEeccCcchHHHHHHHHhhcchhhhhhcchhhhh-hHHhhhhcccc
Confidence            99999999999999999999999999999999999999999  9999999999999999999999997 99999998888


Q ss_pred             ChhhhhhhhcCCchhHHHHHHHHHHHhhcCCCCEEEEEcCccchHHHHHhcCCCCCceEEEEeCChHHHHHHHHHHhhhh
Q 002218          683 PPEDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKL  762 (952)
Q Consensus       683 p~EeRye~~~F~PPL~~QR~efVldlL~~~k~krVLDIGCGeG~ll~~LAr~g~~~~qVVGVDISeemLe~ArkrLsa~l  762 (952)
                      ..+++++...|.||++.+|++++.+.+...++.+|||||||+|.++..|++.+++..+|+|||+|+.|++.|++++....
T Consensus       691 ea~p~me~gtFsPPL~eqRle~LLelL~~~~g~rVLDVGCGTG~lai~LAr~g~p~a~VtGVDIS~emLe~AReRLa~~l  770 (950)
T 3htx_A          691 PSEERMEAAFFKPPLSKQRVEYALKHIRESSASTLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKL  770 (950)
T ss_dssp             SCCCCCCCCCSSSCHHHHHHHHHHHHHHHSCCSEEEEETCSSSHHHHHHTSSCCCCCEEEEEESCHHHHHHHHHHHHHHT
T ss_pred             chhhHHhhCcCCchHHHHHHHHHHHHhcccCCCEEEEECCCCCHHHHHHHHhCCCCCeEEEEECCHHHHHHHHHHhhhcc
Confidence            88899999999999999999999999988889999999999999999999987445799999999999999998776432


Q ss_pred             hcccccCCCCCCCccEEEEEcCccccCCCCCCccEEEEccccccCChhHHHHHHHHHHHccCCCEEEEEecCCchhHHHH
Q 002218          763 SKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQ  842 (952)
Q Consensus       763 a~~~~~l~Pr~~~~nVtf~qGDa~dLpf~d~sFDVVVcieVIEHL~dD~l~~L~eeI~RvLKPG~LIISTPN~efN~lf~  842 (952)
                      ..      .+.+..+++++++|+.++++.++.||+|++.++|||++++....+.++++++||||.++|+|||.++|..+.
T Consensus       771 nA------kr~gl~nVefiqGDa~dLp~~d~sFDlVV~~eVLeHL~dp~l~~~L~eI~RvLKPG~LIISTPN~eyN~lF~  844 (950)
T 3htx_A          771 NK------EACNVKSATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYEFNTILQ  844 (950)
T ss_dssp             TT------TCSSCSEEEEEESCTTSCCTTSCSCCEEEEESCGGGSCHHHHHHHHHHHHHTTCCSEEEEEECBGGGHHHHT
T ss_pred             ch------hhcCCCceEEEECchHhCCcccCCeeEEEEeCchhhCChHHHHHHHHHHHHHcCCCEEEEEecCchhhhhhh
Confidence            11      023456899999999999998899999999999999998777777888999999999999999999999988


Q ss_pred             hhccCccCCCCcchhhhccccccCCCCccccCHHHHHHHHHHHHHHcCcEEEEEeecCCCCCCCCccceeeeeecCCCCC
Q 002218          843 KSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPE  922 (952)
Q Consensus       843 ~L~~~ta~eYPde~~g~~~~~fRh~DHkFEWTReEFqsWae~La~q~GYsVefsGVG~~p~ge~G~aTQIAVFrRk~~~~  922 (952)
                      .+...+...+|+..   ....+|+.+|+|+|++++|+.|+++++.++||.|++.|+|+.+.++.|++||||||+| ..+.
T Consensus       845 ~Lnp~tr~~dPd~~---~~~~fRh~DHrFEWTReEFr~Wae~LAer~GYsVefvGVGDg~ep~vG~~TQiAVFtR-~~~g  920 (950)
T 3htx_A          845 RSTPETQEENNSEP---QLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFSGVGGSGEVEPGFASQIAIFRR-EASS  920 (950)
T ss_dssp             CC---------------CCSSCSCSSCSCCBCHHHHHHHHHHHHHHTTEEEEEEEESSCSSSTTCCSEEEEEEEE-SCC-
T ss_pred             hccccccccccccc---ccccccccCcceeecHHHHHHHHHHHHHhcCcEEEEEccCCCCCCCCCCccEEEEEEE-CCCc
Confidence            65333332333321   3456899999999999999999999999999999999999988778999999999999 6666


Q ss_pred             CcccccCCCCccceeEEEEecCCCC
Q 002218          923 EDDLLKDGDSAHHYKVIWEWDGNGL  947 (952)
Q Consensus       923 ~~~~~~~~~~~~~Yk~v~~w~~~~~  947 (952)
                      .+.+.+..  ..|||++|||.++..
T Consensus       921 ~d~l~e~~--~~~~~~~W~w~~~~~  943 (950)
T 3htx_A          921 VENVAESS--MQPYKVIWEWKKEDV  943 (950)
T ss_dssp             ----CCCC--CCCSCEEEEEECC--
T ss_pred             hhhcchhh--cchHHHhcccCCccc
Confidence            66666654  489999999988764
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 952
d1s29a_92 a.4.5.46 (A:) Lupus La autoantigen N-terminal doma 3e-04
d2dmya184 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin 5e-04
d1uhza_89 d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul 6e-04
d1x47a185 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie 7e-04
d1qu6a289 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase 7e-04
d1o0wa269 d.50.1.1 (A:168-236) RNase III, C-terminal domain 0.001
d1whna_128 d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, 0.002
d2nuga268 d.50.1.1 (A:151-218) RNase III, C-terminal domain 0.003
d1di2a_69 d.50.1.1 (A:) Double-stranded RNA-binding protein 0.004
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

 Score = 38.2 bits (89), Expect = 3e-04
 Identities = 23/110 (20%), Positives = 43/110 (39%), Gaps = 20/110 (18%)

Query: 99  NVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSK 158
           ++P + E   KL   V+  FS+  +     L+G     +  + +  G V    +     +
Sbjct: 3   HMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGK----MAENAE--GFVSLETLLTFK-R 55

Query: 159 LANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYP 208
           + ++   +               +  A R SE +V SE  L + R+DP P
Sbjct: 56  VNSVTTDVK-------------EVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query952
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.81
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.8
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.74
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.73
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.71
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.7
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.7
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.69
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.66
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.65
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.65
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.65
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.64
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.6
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.59
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.59
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.58
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.54
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.54
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.54
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.53
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.49
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.47
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.46
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.46
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.44
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.43
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.42
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.36
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.34
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.32
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.27
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.21
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.21
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.17
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.17
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.17
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.17
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.15
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.14
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.13
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.09
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.08
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.08
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.07
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.04
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.04
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.99
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.94
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.87
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.83
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.81
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.8
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.73
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.71
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.7
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.62
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.58
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.57
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.56
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.53
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.5
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.46
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.4
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.31
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.28
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.19
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.17
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.17
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.17
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.15
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.13
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.12
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.1
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.02
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.01
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.01
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.86
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.83
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.7
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.68
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.59
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.55
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.54
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.53
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 97.51
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.48
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.45
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.44
d2cpna176 TAR RNA-binding protein 2 {Human (Homo sapiens) [T 97.36
d2dmya184 Spermatid perinuclear RNA-binding protein {Human ( 97.31
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.29
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 97.28
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.18
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.16
d2dixa173 Interferon-inducible double stranded RNA-dependent 97.14
d2b7va171 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 97.13
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.91
d1qu6a190 dsRNA-dependent protein kinase pkr {Human (Homo sa 96.87
d1x48a176 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 96.87
d1x49a185 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 96.84
d1o0wa269 RNase III, C-terminal domain {Thermotoga maritima 96.73
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 96.72
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.71
d2b7ta173 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 96.67
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1t4oa_81 RNase III, C-terminal domain {Baker's yeast (Sacch 96.6
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.58
d1uhza_89 staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 96.57
d1di2a_69 Double-stranded RNA-binding protein A, second dsRB 96.57
d1ekza_76 Staufen, domain III {Fruit fly (Drosophila melanog 96.55
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 96.54
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.52
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.41
d1uila_113 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 96.31
d1s29a_92 Lupus La autoantigen N-terminal domain {Trypanosom 96.2
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.04
d2nuga268 RNase III, C-terminal domain {Aquifex aeolicus [Ta 95.9
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.47
d2cqka188 La-related protein 4 LARP4 {Human (Homo sapiens) [ 94.62
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 94.09
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 93.13
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 92.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.92
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 91.95
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 91.76
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.72
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 90.98
d1zh5a199 Lupus La autoantigen N-terminal domain {Human (Hom 90.6
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 90.46
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.82
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 88.45
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 88.26
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 88.24
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 87.82
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 87.72
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 87.55
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 86.54
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 86.27
d2dixa173 Interferon-inducible double stranded RNA-dependent 86.17
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 86.05
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 85.94
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 85.2
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 84.19
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 84.17
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 83.36
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 81.32
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 81.07
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 80.98
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 80.32
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]

Probab=99.81  E-value=8.8e-20  Score=181.16  Aligned_cols=157  Identities=16%  Similarity=0.234  Sum_probs=118.6

Q ss_pred             HHHHHhhcCCCCEEEEEcCccchHHHHHhcCCCCCceEEEEeCChHHHHHHHHHHhhhhhcccccCCCCCCCccEEEEEc
Q 002218          704 YALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFDG  783 (952)
Q Consensus       704 fVldlL~~~k~krVLDIGCGeG~ll~~LAr~g~~~~qVVGVDISeemLe~ArkrLsa~la~~~~~l~Pr~~~~nVtf~qG  783 (952)
                      .+++.+...++.+|||||||+|.++..+++.+   .+|+|+|+|+.|++.|++++..            .+.+++++.++
T Consensus         6 ~ll~~~~l~~~~rVLDiGcG~G~~~~~l~~~~---~~v~gvD~s~~~i~~A~~~~~~------------~~~~~i~~~~~   70 (231)
T d1vl5a_           6 KLMQIAALKGNEEVLDVATGGGHVANAFAPFV---KKVVAFDLTEDILKVARAFIEG------------NGHQQVEYVQG   70 (231)
T ss_dssp             HHHHHHTCCSCCEEEEETCTTCHHHHHHGGGS---SEEEEEESCHHHHHHHHHHHHH------------TTCCSEEEEEC
T ss_pred             HHHHhcCCCCcCEEEEecccCcHHHHHHHHhC---CEEEEEECCHHHHhhhhhcccc------------ccccccccccc
Confidence            45666677788999999999999999999988   7999999999999999887653            24568999999


Q ss_pred             CccccCCCCCCccEEEEccccccCChhHHHHHHHHHHHccCCC-EEEEEecCCchhHHHHhhccCccCCCCcchhhhccc
Q 002218          784 SITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPR-ILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSC  862 (952)
Q Consensus       784 Da~dLpf~d~sFDVVVcieVIEHL~dD~l~~L~eeI~RvLKPG-~LIISTPN~efN~lf~~L~~~ta~eYPde~~g~~~~  862 (952)
                      |++++++++++||+|+|.+++||++ ++...+ +++.++|||| .+++.+++..-+..+..+..             ...
T Consensus        71 d~~~l~~~~~~fD~v~~~~~l~~~~-d~~~~l-~~~~r~LkpgG~l~i~~~~~~~~~~~~~~~~-------------~~~  135 (231)
T d1vl5a_          71 DAEQMPFTDERFHIVTCRIAAHHFP-NPASFV-SEAYRVLKKGGQLLLVDNSAPENDAFDVFYN-------------YVE  135 (231)
T ss_dssp             CC-CCCSCTTCEEEEEEESCGGGCS-CHHHHH-HHHHHHEEEEEEEEEEEEEBCSSHHHHHHHH-------------HHH
T ss_pred             ccccccccccccccccccccccccC-CHHHHH-HHHHHhcCCCcEEEEEeCCCCCCHHHHHHHH-------------HHH
Confidence            9999999999999999999999998 443444 5799999999 77776665432333332210             011


Q ss_pred             cccCCCCccccCHHHHHHHHHHHHHHcCcEEE
Q 002218          863 KFRNHDHKFEWTRDQFNCWATELAARHNYSVE  894 (952)
Q Consensus       863 ~fRh~DHkFEWTReEFqsWae~La~q~GYsVe  894 (952)
                      ......|...|+.+++.+    +++++||.++
T Consensus       136 ~~~~~~~~~~~~~~~~~~----~l~~aGf~~~  163 (231)
T d1vl5a_         136 KERDYSHHRAWKKSDWLK----MLEEAGFELE  163 (231)
T ss_dssp             HHHCTTCCCCCBHHHHHH----HHHHHTCEEE
T ss_pred             hhcccCcccCCCHHHHHH----HHHHCCCEEE
Confidence            123345666788888874    5667799764
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure