Citrus Sinensis ID: 002335


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-----
MADSPASPATIDPNFKQPESNNPNRKPDTPSTSISQPEQQQQQHPSIINPNPSPNPNQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPVVQPPGVGGVAVTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHDRRGRDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLSDNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHcccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccEEEEcccHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHcccccccccccccHHHcccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccHHHHHcccccccccccccHHHHHHHHHHHcccccHHcccccHHcccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
madspaspatidpnfkqpesnnpnrkpdtpstsisqpeqqqqqhpsiinpnpspnpnqtpapaslppapvqsfvpptqpisyrpvpmstasqfspvqnyqspvvqppgvggvavtmappmmqypgvpgqppnpalrpyapipngygavpapasglprypapypsmvrpafpprppgpvgvlpsvarppvpgipgvrpimppvvrpvplptvtpaekpqtkvyvgkiaptadsDFVLSVLKVCGTvkswkraqypsngtpkgfgfcefESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKEtqdagagkedesvqsvekneptkspenlkdnetgnkeshdptnfgvvteeDRKADQEALEKLTCMVEerlktnplpppppqttadgsgisnselpakardgdsdvDMIRNDiaedklddettsdtkasdhdrpetsspdrsrvhdrrgrdkerDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEilydeeededdsRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLsdnavngslaeesaveskgmdvehdyhddsirenhmagdpssqngngdestnvpiaasdmrqsgnvparklgfglvgsgkrtavpsvfhveddddadkdkkmrplvpidysteelqaaqphvsganppnLAAAAEFAKRISnvnskeeksdAERERSRrlhdrssqrekdrsdednnrtrdeHKEKILdrdrdrehgldkvktpdnkklldAKQLIDMIPKTKEELFSYEINWAvydkhelhermrpwISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS
madspaspatidpnfkqpesnnpnRKPDTPSTSISQPEQQQQQHPSIINPNPSPNPNQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPVVQPPGVGGVAVTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPtvtpaekpqtkvYVGKiaptadsdfVLSVLKVCGTVKswkraqypsngtpkgFGFCEFESAEGVLRALRLLNKFnidgqelmlkVDQATREYLERyvdkktentkklketqdagagkedesvqsvekneptkspenlkdnetgnkeshdptnfgvvteEDRKADQEALEKLTCMVEErlktnplpppppqttadgsgisnselpakardgdsdVDMIRNDiaedklddettsdtkasdhdrpetsspdrsrvhdrrgrdkerdlkrekereidryereaerervrkereqrrkieeaereyerclkdweyrererekerqyekekekererkrkkeilydeeededdsrkrwrrsvleekrrkrirekeedladevreeEEIAVAKRRAEEEQLQQQQRDALKLLSDNAVNGSLAeesaveskgMDVEHDYHDDSIRENHMagdpssqngngdESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPsvfhveddddadkdkkMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRisnvnskeeksdaerersrrlhdrssqrekdrsdednnrtrdehkekildrdrdrehgldkvktpdnkklldakqlIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKkvetglalrsks
MADSPASPATIDPNFKQPESNNPNRKPDtpstsisqpeqqqqqhpsiinpnpspnpnQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSpvvqppgvggvavTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYpsmvrpafpprppgpvgvlpsvaRppvpgipgvrpimppvvrpvplptvtpAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDkktentkklketQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNplpppppQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHdrrgrdkerdlkrekereidryereaerervrkereqrrkieeaereYERCLKDWeyrererekerqyekekekererkrkkeILYdeeededdSRKRWRRSVLeekrrkrirekeedladevreeeeiavakrraeeeqlqqqqrdalklLSDNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEddddadkdkkMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS
*********************************************************************************************************************************************************************************************************VVR**************TKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYV*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************GFGLV***************************************************************************************************************************************AKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGL******
*****************************************************************************************************************************************************************************************************************************YVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYL**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQD*VK**QMLELLQTILDDEAEMFVLKMWRMLIFEIKKV***L******
*********TIDPNFKQP***************************SIINPNPSPNPNQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPVVQPPGVGGVAVTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKL*****************************LKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKL********************************************EIDRY************************EYERCLKDWEYR*********************RKKEILY************WRRSVLEEKRRKRIRE************EEIAVAK*************DALKLLSDNAVNGS*************VEHDYHDDSIRENHM************ESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISN*****************************************KEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS
*********************************************SIINPNPSPNPNQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPVVQPPGVGGVAVTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMP*************AEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTE**************************EPTKSPENLKDNETGNKESHDPTNFG*****************TCMVEERLK*******************************************************************************************************VRKEREQRRKIEEAEREYERCLKDWEYREREREKERQYEKEKEKERERKRKKEILYDEE***DDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEEEQLQQQQRDALKLLSDN****************************************************************************************************PLVP***S**ELQA**********************************************************************LDRDRDREHG*****TPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVET********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSPASPATIDPNFKQPESNNPNRKPDTPSTSISQPEQQQQQHPSIINPNPSPNPNQTPAPASLPPAPVQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPVVQPPGVGGVAVTMAPPMMQYPGVPGQPPNPALRPYAPIPNGYGAVPAPASGLPRYPAPYPSMVRPAFPPRPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPENLKDNETGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKASDHDRPETSSPDRSRVHDRRGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDSRKRWRRSVLEEKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNAVNGSLAEESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query935 2.2.26 [Sep-21-2011]
P49756843 RNA-binding protein 25 OS yes no 0.097 0.107 0.451 9e-24
B2RY56838 RNA-binding protein 25 OS yes no 0.086 0.096 0.451 1e-23
Q8IDX63130 Reticulocyte-binding prot no no 0.130 0.038 0.299 3e-06
>sp|P49756|RBM25_HUMAN RNA-binding protein 25 OS=Homo sapiens GN=RBM25 PE=1 SV=3 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 72/104 (69%)

Query: 827 KQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSST 886
           K LI+ IP  K ELF+Y ++W++ D   +  R+RPWI+KKI E++GEEE TLVD++ S  
Sbjct: 739 KSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKV 798

Query: 887 QDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLA 930
             H     +L+ +  +LD+EAE+F++KMWR+LI+E +  + GL 
Sbjct: 799 MAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLV 842




RNA-binding protein that acts as a regulator of alternative pre-mRNA splicing. Involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression. Modulates the ratio of proapoptotic BCL2L1 isoform S to antiapoptotic BCL2L1 isoform L mRNA expression. When overexpressed, stimulates proapoptotic BCL2L1 isoform S 5'-splice site (5'-ss) selection, whereas its depletion caused the accumulation of antiapoptotic BCL2L1 isoform L. Promotes BCL2L1 isoform S 5'-ss usage through the 5'-CGGGCA-3' RNA sequence. Its association with LUC7L3 promotes U1 snRNP binding to a weak 5' ss in a 5'-CGGGCA-3'-dependent manner. Binds to the exonic splicing enhancer 5'-CGGGCA-3' RNA sequence located within exon 2 of the BCL2L1 pre-mRNA.
Homo sapiens (taxid: 9606)
>sp|B2RY56|RBM25_MOUSE RNA-binding protein 25 OS=Mus musculus GN=Rbm25 PE=1 SV=2 Back     alignment and function description
>sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query935
255568764948 conserved hypothetical protein [Ricinus 0.897 0.885 0.705 0.0
225424679958 PREDICTED: uncharacterized protein LOC10 0.982 0.959 0.627 0.0
296086551828 unnamed protein product [Vitis vinifera] 0.847 0.956 0.675 0.0
224111298894 predicted protein [Populus trichocarpa] 0.911 0.953 0.661 0.0
449513686968 PREDICTED: uncharacterized LOC101214372 0.988 0.954 0.614 0.0
356497763927 PREDICTED: uncharacterized protein LOC10 0.974 0.982 0.633 0.0
357485911771 RNA-binding protein [Medicago truncatula 0.812 0.985 0.645 0.0
356501735765 PREDICTED: uncharacterized protein LOC10 0.807 0.986 0.667 0.0
449434915770 PREDICTED: uncharacterized protein LOC10 0.814 0.989 0.673 0.0
307135981770 RNA binding motif protein [Cucumis melo 0.801 0.972 0.676 0.0
>gi|255568764|ref|XP_002525353.1| conserved hypothetical protein [Ricinus communis] gi|223535316|gb|EEF36991.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/893 (70%), Positives = 718/893 (80%), Gaps = 54/893 (6%)

Query: 70  VQSFVPPTQPISYRPVPMSTASQFSPVQNYQSPV--VQPPGVG-----------GVAVT- 115
           +   VP  QP S+RP+P     QFSP+ NYQ+P   VQPPGV            GVAV  
Sbjct: 83  ISGGVPSVQP-SFRPLP-----QFSPLPNYQNPSIGVQPPGVSAATPVMASGAPGVAVAA 136

Query: 116 -MAPPMMQYPGVPGQPPNPALRPYAPIP-NGY-GAVPAPASGLPRYPAPYPSMVRPAFPP 172
            M  P+M Y  +PGQPP   +RPYAP+P NGY GA P   +G+ RYP+PYP+MVRP FPP
Sbjct: 137 PMPAPIMPYQALPGQPP---MRPYAPLPPNGYAGATPPGITGIQRYPSPYPAMVRPMFPP 193

Query: 173 RPPGPVGVLPSVARPPVPGIPGVRPIMPPVVRPVPLPTVTPAEKPQTKVYVGKIAPTADS 232
           RP G +G+LP+ +R  VPGIPGVRP+  P+VRP  +P+VTPAEKP T VYVGKIAPT D+
Sbjct: 194 RPLGALGILPAASRLLVPGIPGVRPV--PIVRP-GVPSVTPAEKPLTTVYVGKIAPTVDN 250

Query: 233 DFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELML 292
           DF+LS+L+ CG VKSWKR Q P++GTP+GFGFCEFESAEGVLRALRLL+KFNIDGQEL+L
Sbjct: 251 DFMLSLLRFCGPVKSWKRPQDPNDGTPRGFGFCEFESAEGVLRALRLLSKFNIDGQELVL 310

Query: 293 KVDQATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTK--SPENLKDNE 350
            V+QATREYLERYV+KKTEN K LKE Q  GA KED    + EK+EP K    ++ KD +
Sbjct: 311 NVNQATREYLERYVEKKTENLKNLKENQAPGAAKED---GTAEKSEPPKIIGEDSNKDGD 367

Query: 351 TGNKESHDPTNFGVVTEEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNS 410
             NKE++DP NFG+VT+ED++ D+EALEKLT M+EERLKTNPLPPPPPQT A GSG +NS
Sbjct: 368 KVNKENNDPANFGIVTDEDKEGDKEALEKLTSMIEERLKTNPLPPPPPQTPAHGSG-TNS 426

Query: 411 ELPAKARDGDSDVDMIRNDIAEDKLDDETTSD-TKASDHDRPETSSPDRSR---VHDRRG 466
           E PAK+RDGDSD D  R   AEDK DDET SD   A++ DRP T SPDRS        R 
Sbjct: 427 EFPAKSRDGDSDADTTRQ--AEDKNDDETISDHIPATEQDRPGTCSPDRSSRKYDRRSRE 484

Query: 467 RDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREK 526
           RD+ERDLKREKEREI+RYEREAERER+RKEREQRRKIEEAEREYE  LKDWEYRERE+EK
Sbjct: 485 RDRERDLKREKEREIERYEREAERERIRKEREQRRKIEEAEREYEERLKDWEYREREKEK 544

Query: 527 ERQYEKEKEKERERKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVR 586
           +RQY+KEK+KER+RKR+KEILYDEE D+DDSRK+WRRS L++KRRK+ REKE+D+AD ++
Sbjct: 545 QRQYDKEKDKERDRKRRKEILYDEEGDDDDSRKKWRRSALDDKRRKKQREKEDDMADRLK 604

Query: 587 EEEEIAVAKRRAEEEQLQQQQRDALKLLSDNAVNGS----LAEESAVESKGMDVEHDYHD 642
           EEEE+A AKRRAEEE++QQQQ DA KL  D  +NG+    L EE  VESK   VE D   
Sbjct: 605 EEEEMAEAKRRAEEERIQQQQTDAFKLSFDQVMNGTEMKVLVEEVYVESKDKVVEQDNEG 664

Query: 643 DSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVF 702
           D        GD   QNG  DEST   +  SD+RQSGN PARKLGFGLVGSGKR AVPSVF
Sbjct: 665 D-------LGDGVLQNGTVDESTVTSMTESDIRQSGNAPARKLGFGLVGSGKRAAVPSVF 717

Query: 703 HVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEE 762
           H EDDDDADKDKKMRPLVPIDYSTEELQA QP VSGA PP +AAAAEFAKRISNV  KEE
Sbjct: 718 HEEDDDDADKDKKMRPLVPIDYSTEELQAVQPTVSGAQPP-IAAAAEFAKRISNVTPKEE 776

Query: 763 KSDAERERSRRLHDRSSQREKDRSDEDNNRTRDEHKEKILDRDRDREHGLDKVKTPDNKK 822
           K D ERERSRR HDRSSQR++DR+DED  R RDE K+KIL+RDR+REHGLDKVKTPD +K
Sbjct: 777 KPDMERERSRRSHDRSSQRDRDRNDEDAIRMRDE-KDKILERDRNREHGLDKVKTPDKQK 835

Query: 823 LLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYI 882
           LLDAKQLIDMIPKTK+ELFSYEINWAVYD+HELHERMRPWISKKITEFLGEEETTLVDYI
Sbjct: 836 LLDAKQLIDMIPKTKDELFSYEINWAVYDRHELHERMRPWISKKITEFLGEEETTLVDYI 895

Query: 883 VSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS 935
           VSST+DHVKASQMLE+LQ+ILDDEAEMFVLKMWRMLIFEIKKVETGLALRS+S
Sbjct: 896 VSSTRDHVKASQMLEMLQSILDDEAEMFVLKMWRMLIFEIKKVETGLALRSRS 948




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225424679|ref|XP_002264457.1| PREDICTED: uncharacterized protein LOC100263874 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086551|emb|CBI32140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111298|ref|XP_002315807.1| predicted protein [Populus trichocarpa] gi|222864847|gb|EEF01978.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449513686|ref|XP_004164394.1| PREDICTED: uncharacterized LOC101214372 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497763|ref|XP_003517728.1| PREDICTED: uncharacterized protein LOC100809428 [Glycine max] Back     alignment and taxonomy information
>gi|357485911|ref|XP_003613243.1| RNA-binding protein [Medicago truncatula] gi|355514578|gb|AES96201.1| RNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356501735|ref|XP_003519679.1| PREDICTED: uncharacterized protein LOC100803051 [Glycine max] Back     alignment and taxonomy information
>gi|449434915|ref|XP_004135241.1| PREDICTED: uncharacterized protein LOC101214372 [Cucumis sativus] Back     alignment and taxonomy information
>gi|307135981|gb|ADN33840.1| RNA binding motif protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query935
TAIR|locus:2195568899 AT1G60200 [Arabidopsis thalian 0.304 0.317 0.591 2.7e-155
MGI|MGI:1914289838 Rbm25 "RNA binding motif prote 0.150 0.168 0.395 3.2e-40
UNIPROTKB|E1BHM5843 RBM25 "Uncharacterized protein 0.150 0.167 0.395 8.3e-40
UNIPROTKB|P49756843 RBM25 "RNA-binding protein 25" 0.150 0.167 0.395 8.3e-40
UNIPROTKB|E1BSR5782 RBM25 "Uncharacterized protein 0.150 0.180 0.402 1e-37
ZFIN|ZDB-GENE-030131-5547833 rbm25 "RNA binding motif prote 0.238 0.267 0.297 2.5e-35
WB|WBGene00012245707 W04D2.6 [Caenorhabditis elegan 0.140 0.185 0.364 4e-35
FB|FBgn0028474998 CG4119 [Drosophila melanogaste 0.179 0.168 0.352 3.6e-31
RGD|1308755354 Rbm25 "RNA binding motif prote 0.150 0.398 0.395 7.8e-29
DICTYBASE|DDB_G0269926724 DDB_G0269926 "splicing factor 0.177 0.229 0.335 2.4e-27
TAIR|locus:2195568 AT1G60200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 837 (299.7 bits), Expect = 2.7e-155, Sum P(5) = 2.7e-155
 Identities = 175/296 (59%), Positives = 216/296 (72%)

Query:   643 DSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQSGNVPARKLGFGLVGSGKRTAVPSVF 702
             +S  E+H A D   +NG+G+ES  +    ++     + P++KLGFGLVGSGKRT+VPSVF
Sbjct:   612 ESANEHH-AAD-FEENGSGNESMAID---NNSGSEAHAPSKKLGFGLVGSGKRTSVPSVF 666

Query:   703 HVEXXXXXXXXXXMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISNVNSKEE 762
             + E          M+PLVPIDYSTEE +A     SG  PP+LA AAEFAKRIS+ N KEE
Sbjct:   667 YEEDEDEARKAKKMKPLVPIDYSTEEQEAVAHGGSGNTPPHLALAAEFAKRISSTNPKEE 726

Query:   763 KSDAERERSRRLHDRSSQREKDRS---DEDNNRTRDEHKEKILDRDRDREHGLDKVKTPD 819
               + E++RSRR HD++S R+++R    D D +R RD            +E G  K K  D
Sbjct:   727 TIETEKQRSRRSHDKASHRDRERERERDRDRDRVRDRGDGHSGPTKDAKESG--KAKIID 784

Query:   820 NKKLLDAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLV 879
              K  LDAKQLID IPKTKE+LFSYEINWA+YDKH++HERMRPWISKKI EFLGEEE TLV
Sbjct:   785 TK-FLDAKQLIDTIPKTKEDLFSYEINWAMYDKHQVHERMRPWISKKIMEFLGEEEATLV 843

Query:   880 DYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGLALRSKS 935
             D+IVS+TQ HV+ASQMLELLQ+ILD+EAEMFVLKMWRMLIFEIK+VE G+ ++SK+
Sbjct:   844 DFIVSNTQQHVQASQMLELLQSILDEEAEMFVLKMWRMLIFEIKRVEAGVPVKSKA 899


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006397 "mRNA processing" evidence=IEA
MGI|MGI:1914289 Rbm25 "RNA binding motif protein 25" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHM5 RBM25 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P49756 RBM25 "RNA-binding protein 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSR5 RBM25 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5547 rbm25 "RNA binding motif protein 25" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00012245 W04D2.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0028474 CG4119 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1308755 Rbm25 "RNA binding motif protein 25" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269926 DDB_G0269926 "splicing factor PWI domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_X0863
hypothetical protein (894 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query935
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-36
smart0031174 smart00311, PWI, PWI, domain in splicing factors 2e-24
pfam0148074 pfam01480, PWI, PWI domain 2e-15
smart0036073 smart00360, RRM, RNA recognition motif 1e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-10
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-09
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-09
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-09
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 1e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-08
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-08
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 7e-08
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 8e-08
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-07
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-07
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-07
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-07
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 9e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 1e-06
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 1e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-06
pfam09756189 pfam09756, DDRGK, DDRGK domain 2e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-06
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 3e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-06
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 3e-06
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 5e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 6e-06
COG1390194 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su 6e-06
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 6e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 7e-06
PRK12678672 PRK12678, PRK12678, transcription termination fact 7e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 9e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-05
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-05
pfam07271279 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 2e-05
pfam09756189 pfam09756, DDRGK, DDRGK domain 3e-05
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-05
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 3e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 4e-05
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 4e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-05
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 5e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 6e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 6e-05
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 7e-05
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 7e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 7e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 8e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 1e-04
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 1e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 2e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 2e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-04
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 2e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-04
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 3e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 3e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-04
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 3e-04
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 3e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-04
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 4e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 5e-04
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 5e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 6e-04
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 6e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 6e-04
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 6e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 7e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 7e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 9e-04
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 9e-04
pfam09321241 pfam09321, DUF1978, Domain of unknown function (DU 9e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.001
PHA03379935 PHA03379, PHA03379, EBNA-3A; Provisional 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 0.001
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.001
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.002
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.002
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.002
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 0.002
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.002
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.002
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 0.002
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.002
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.002
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.003
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.003
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.003
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.003
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.003
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.003
TIGR00606 1311 TIGR00606, rad50, rad50 0.003
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.004
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.004
PHA03379935 PHA03379, PHA03379, EBNA-3A; Provisional 0.004
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.004
pfam11029136 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP 0.004
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 0.004
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
 Score =  131 bits (331), Expect = 3e-36
 Identities = 44/84 (52%), Positives = 55/84 (65%)

Query: 219 TKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALR 278
           T V+VG I      DF+  +L+ CG V SWKR + PS G  K FGFCEFE  EG LRALR
Sbjct: 1   TTVFVGNIPEGVSDDFIRKLLEKCGKVLSWKRVKDPSTGKLKAFGFCEFEDPEGALRALR 60

Query: 279 LLNKFNIDGQELMLKVDQATREYL 302
           LLN   + G++L++KVD  TR+ L
Sbjct: 61  LLNGLELGGKKLLVKVDAKTRKLL 84


This subfamily corresponds to the RRM of RBM25, also termed Arg/Glu/Asp-rich protein of 120 kDa (RED120), or protein S164, or RNA-binding region-containing protein 7, an evolutionary-conserved splicing coactivator SRm160 (SR-related nuclear matrix protein of 160 kDa, )-interacting protein. RBM25 belongs to a family of RNA-binding proteins containing a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), at the N-terminus, a RE/RD-rich (ER) central region, and a C-terminal proline-tryptophan-isoleucine (PWI) motif. It localizes to the nuclear speckles and associates with multiple splicing components, including splicing cofactors SRm160/300, U snRNAs, assembled splicing complexes, and spliced mRNAs. It may play an important role in pre-mRNA processing by coupling splicing with mRNA 3'-end formation. Additional research indicates that RBM25 is one of the RNA-binding regulators that direct the alternative splicing of apoptotic factors. It can activate proapoptotic Bcl-xS 5'ss by binding to the exonic splicing enhancer, CGGGCA, and stabilize the pre-mRNA-U1 snRNP through interaction with hLuc7A, a U1 snRNP-associated factor. . Length = 84

>gnl|CDD|214609 smart00311, PWI, PWI, domain in splicing factors Back     alignment and domain information
>gnl|CDD|216523 pfam01480, PWI, PWI domain Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|219358 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|220178 pfam09321, DUF1978, Domain of unknown function (DUF1978) Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 935
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 100.0
PF0148077 PWI: PWI domain; InterPro: IPR002483 The PWI domai 99.76
smart0031174 PWI PWI, domain in splicing factors. 99.73
KOG2146 354 consensus Splicing coactivator SRm160/300, subunit 99.7
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.68
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.52
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.47
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.47
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.45
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.39
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.37
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.37
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.36
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.36
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.33
KOG0122270 consensus Translation initiation factor 3, subunit 99.3
PLN03213759 repressor of silencing 3; Provisional 99.3
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.3
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.29
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.28
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.26
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.25
PLN03120260 nucleic acid binding protein; Provisional 99.23
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.21
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.21
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.2
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.2
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.18
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.18
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.18
KOG4207256 consensus Predicted splicing factor, SR protein su 99.17
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.15
smart0036272 RRM_2 RNA recognition motif. 99.14
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.13
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.11
PLN03121243 nucleic acid binding protein; Provisional 99.11
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.1
smart0036071 RRM RNA recognition motif. 99.08
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.08
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.08
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.08
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.08
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.07
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.06
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.05
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.03
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.97
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.97
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.95
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.95
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.92
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.91
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.89
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.89
KOG0226290 consensus RNA-binding proteins [General function p 98.86
smart0036170 RRM_1 RNA recognition motif. 98.86
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.86
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.84
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 98.82
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.81
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.79
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.77
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.75
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.75
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.72
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.65
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.61
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.58
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.58
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.54
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.52
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.51
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.44
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.42
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.41
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.41
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.39
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.39
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 98.35
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 98.33
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.32
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.27
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.25
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.23
KOG0151877 consensus Predicted splicing regulator, contains R 98.23
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.23
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.14
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.13
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.06
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.01
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.99
KOG4660549 consensus Protein Mei2, essential for commitment t 97.78
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.53
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 97.51
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 97.5
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.45
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.35
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 97.31
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 97.26
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.19
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.16
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.02
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 97.0
KOG3152278 consensus TBP-binding protein, activator of basal 96.99
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.96
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.94
KOG2314698 consensus Translation initiation factor 3, subunit 96.87
KOG4210285 consensus Nuclear localization sequence binding pr 96.77
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.74
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 96.69
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.67
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 96.58
KOG1855484 consensus Predicted RNA-binding protein [General f 96.54
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 96.53
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 96.52
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 96.52
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 96.25
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.22
KOG2891445 consensus Surface glycoprotein [General function p 95.73
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.46
KOG19841007 consensus Vesicle coat complex COPII, subunit SFB3 95.44
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 95.25
KOG1548382 consensus Transcription elongation factor TAT-SF1 95.18
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 95.17
PTZ002661021 NIMA-related protein kinase; Provisional 95.16
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 94.86
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 94.6
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 94.26
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 94.25
PHA03378991 EBNA-3B; Provisional 94.0
KOG1996378 consensus mRNA splicing factor [RNA processing and 93.97
KOG0112975 consensus Large RNA-binding protein (RRM superfami 93.92
KOG0129520 consensus Predicted RNA-binding protein (RRM super 93.9
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 93.58
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 93.43
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 93.4
KOG19841007 consensus Vesicle coat complex COPII, subunit SFB3 93.1
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 92.86
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 92.82
KOG0112975 consensus Large RNA-binding protein (RRM superfami 92.52
KOG2068327 consensus MOT2 transcription factor [Transcription 91.77
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 91.73
KOG4364 811 consensus Chromatin assembly factor-I [Chromatin s 91.55
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 89.73
KOG1923830 consensus Rac1 GTPase effector FRL [Signal transdu 88.66
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 88.56
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 86.22
PF15023166 DUF4523: Protein of unknown function (DUF4523) 85.5
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 85.09
KOG4210285 consensus Nuclear localization sequence binding pr 84.99
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 84.53
TIGR0368733 pupylate_cterm ubiquitin-like protein Pup. Members 83.85
KOG2888453 consensus Putative RNA binding protein [General fu 83.4
KOG2135526 consensus Proteins containing the RNA recognition 82.57
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 82.43
KOG4660549 consensus Protein Mei2, essential for commitment t 81.37
KOG2318650 consensus Uncharacterized conserved protein [Funct 80.95
KOG45741007 consensus RNA-binding protein (contains RRM and Pu 80.7
PF11517107 Nab2: Nuclear abundant poly(A) RNA-bind protein 2 80.24
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.1e-65  Score=581.35  Aligned_cols=611  Identities=32%  Similarity=0.483  Sum_probs=363.4

Q ss_pred             CCCcceeeccCCCCCCHHHHHHHHHhcCCcceeeeeccCCCCCCCceEEEEeCCHHHHHHHHHHhCCceeCCeEEEEEee
Q 002335          216 KPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPSNGTPKGFGFCEFESAEGVLRALRLLNKFNIDGQELMLKVD  295 (935)
Q Consensus       216 ~~~~tlfVgnLp~~vte~~L~~lFs~~G~V~~vki~~d~~tgk~kgfgFVeF~~~e~A~~Al~~Lng~~i~gr~L~V~~a  295 (935)
                      ++..++|||||.+.|....++.|+..||.|.+|+++.         ||||.|.......+|+..|+-..++|..|.++++
T Consensus        38 ~~~~~vfv~~~~~~~s~~~~~~il~~~g~v~s~kr~~---------fgf~~f~~~~~~~ra~r~~t~~~~~~~kl~~~~d  108 (668)
T KOG2253|consen   38 PPRDTVFVGNISYLVSQEFWKSILAKSGFVPSWKRDK---------FGFCEFLKHIGDLRASRLLTELNIDDQKLIENVD  108 (668)
T ss_pred             CCCceeEecchhhhhhHHHHHHHHhhCCcchhhhhhh---------hcccchhhHHHHHHHHHHhcccCCCcchhhccch
Confidence            3467899999999999999999999999999998764         9999999999999999999999999999999887


Q ss_pred             chhHHHHHHHHHHhhHhhhhhhhhhcccCCCCcccccccccCCCCCCCc---------ccccCCCCCCCCCCCCCCCccc
Q 002335          296 QATREYLERYVDKKTENTKKLKETQDAGAGKEDESVQSVEKNEPTKSPE---------NLKDNETGNKESHDPTNFGVVT  366 (935)
Q Consensus       296 ~~~~~~l~~~k~kk~e~~k~~~e~k~e~~~~~~~~~~~~~~~~~~~~~~---------~~~~~d~~~~e~~~~~~~~~~~  366 (935)
                      ..+-..           .++++...            ......|.+..+         ....++....+...+.....+.
T Consensus       109 ~q~~~n-----------~~k~~~~~------------~~~~~~f~p~~srr~e~i~~k~~~l~~~~~~~~~~is~s~~s~  165 (668)
T KOG2253|consen  109 EQTIEN-----------ADKEKSIA------------NKESHKFVPSSSRRQESIQNKPLSLDEQIHKKSLQISSSAASR  165 (668)
T ss_pred             hhhhcC-----------ccccccch------------hhhhcccCCchhHHHHHhhccccchhHHHHHHHHhccchhhhh
Confidence            332111           11110000            001111111100         0000000011111222222222


Q ss_pred             hhhhhhhHHHHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCCCccccCCCCccccccccccccccccccccccccC
Q 002335          367 EEDRKADQEALEKLTCMVEERLKTNPLPPPPPQTTADGSGISNSELPAKARDGDSDVDMIRNDIAEDKLDDETTSDTKAS  446 (935)
Q Consensus       367 ~ede~~D~~~~e~i~~~iee~~~~r~~~~p~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  446 (935)
                      .....+|...++.+.+.+++    +.+.+....+..+     ..+.....+.+.+..+     +       |..++.+  
T Consensus       166 ~~~~e~d~h~~e~~~~~~~s----~~~~~~~~~~~~~-----~~e~~~~s~~~~s~td-----s-------~~~~d~~--  222 (668)
T KOG2253|consen  166 RQIAEADDHCLELEKTETES----NSALSKEAESKKS-----PFEDTKDSKRSFSSTD-----S-------GSESDSA--  222 (668)
T ss_pred             hhhHHHHHHHHHHHHhhccc----ccccCcccccccC-----chhhhchhhhhhcccC-----c-------cccchhh--
Confidence            23334444444444444443    2222211111110     0000000110110000     0       0000000  


Q ss_pred             CCCCCCCCCCCCcccccccCcchhhhhHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHH
Q 002335          447 DHDRPETSSPDRSRVHDRRGRDKERDLKREKEREIDRYEREAERERVRKEREQRRKIEEAEREYERCLKDWEYREREREK  526 (935)
Q Consensus       447 ~~dr~~~~~~dR~r~~dRr~r~r~r~r~r~~~re~~r~~r~~erer~r~~r~~~~~~~e~e~~~~~r~r~~e~rer~r~~  526 (935)
                      ...   +++.++  .+|   +.+.+.|.|...|.+++.+.....+..+.+|..+++.+++|++|+.|++.|+.|||.+++
T Consensus       223 ~~~---s~~~n~--~rd---~sr~~~r~R~~~r~Re~~e~~ed~~~~re~r~~~~~~~~~E~Ayq~rl~~we~Rer~~~K  294 (668)
T KOG2253|consen  223 EVN---SSSLNY--CRD---RSRFDRRSRNDRRIRERLEKNEDSDEYREDRAATIKSVDPEKAYQTRLVFWEIREQTKEK  294 (668)
T ss_pred             hhc---cccccc--chh---hccchhhhHHHHHHHHHhhhccchHHHHHhhhhhhhccChhHHHHHHHHHHHHHHHHHHH
Confidence            000   011111  111   111111222222222222222333566777889999999999999999999999999966


Q ss_pred             HHHHHHHHHHHHH------HHHHHHhhhccchhhhhhHHhhhhhHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHH
Q 002335          527 ERQYEKEKEKERE------RKRKKEILYDEEEDEDDSRKRWRRSVLEEKRRKRIREKEEDLADEVREEEEIAVAKRRAEE  600 (935)
Q Consensus       527 ~re~ekerere~e------r~r~~e~~~~~d~e~~~~rk~~~~~~~~~R~r~r~re~~~d~~dr~~e~~E~~~~~~~~~e  600 (935)
                      .+++++.+++++.      .+++++|++||||++++ .+||++++|.+|++++.+|+++|.+||.+|++|++++||+..+
T Consensus       295 e~eke~~ke~~r~~~~~ke~kr~k~~~ed~DD~rdd-~~y~r~s~l~~r~r~~~re~Ead~~dR~qeqee~~E~Kr~~~~  373 (668)
T KOG2253|consen  295 EREKERLKEKSRQYKREKEAKRLKEFLEDYDDERDD-PKYYRGSALQERLRDREREAEADRRDRHQEQEELEEIKRRHSE  373 (668)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhhhcchhhhh-HHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHhh
Confidence            6555555555443      35678999999999888 4999999999999999999999999999999999999999888


Q ss_pred             HHHHHHHHHHHhhhhhhccCCCcc----chhhhhccCCcccccCCCCcccccCCCCCCCCCCCCCCCCCCCccccccccc
Q 002335          601 EQLQQQQRDALKLLSDNAVNGSLA----EESAVESKGMDVEHDYHDDSIRENHMAGDPSSQNGNGDESTNVPIAASDMRQ  676 (935)
Q Consensus       601 e~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~  676 (935)
                      +..++....+.+.+.+........    +...++..+......+.+.+++..|...  ...+..+    .....+-....
T Consensus       374 ~~~~~~~~e~~r~~~~~~~~~~~~~~~a~~ke~e~~~~~~~~q~~~e~a~~~~~~~--eee~~s~----r~~~~~d~~~~  447 (668)
T KOG2253|consen  374 EEAEDPSAEEERNMEEEEALDEEEDDEAVRKEPEERDLEESHQRLGESANQEHSND--EEEIKSQ----RDDYKPDENDH  447 (668)
T ss_pred             hcccccchHHHHHHhhhhhhcchhhHHHHhhCcccccCccccchHHhhhhhccccc--hhhcccc----hhhhhhhhhhh
Confidence            765444333333333332222111    1112222222222333333333333110  0000000    00000000112


Q ss_pred             CCCCccccccCCccCCCCccccCccCCCCCCcchhcccCCCCcccCCCChHHHhhhcCCCCCCCCCchHHHHHHHHHhhc
Q 002335          677 SGNVPARKLGFGLVGSGKRTAVPSVFHVEDDDDADKDKKMRPLVPIDYSTEELQAAQPHVSGANPPNLAAAAEFAKRISN  756 (935)
Q Consensus       677 ~~~~~~~~~~~~~~~~~~~~~~~~vf~~~dd~~~~~~~~~r~lvp~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  756 (935)
                      -..+|...+.+++++++.+.....+|-.-+...+++..++..++||.|+.....+     .|...+.+..++.   -+-.
T Consensus       448 i~~~ps~~~~s~~~~~n~~~~~~~~~~~~~e~~~~es~n~~~n~p~~~~~~~q~~-----~g~sa~~~~i~~k---k~~~  519 (668)
T KOG2253|consen  448 ISHAPSASLASGLVDANDRDSSPRGFKERHEREDDESLNKKINRPILASIQNQDE-----IGPSASPIPIAKK---KLPE  519 (668)
T ss_pred             hhcCchhhhhhhccCCCCCCcccccccccccCcchhhhccccccccccccccccc-----ccCCCCccccccc---cCCC
Confidence            3356677788899999988889888876554444556667789999987633222     1222211111110   0001


Q ss_pred             ccchhhhchHHHHhhhhhccccchhhcccccccccchhh-hhhhhhcccccccccccccccCchhhhhhHHHHhhhcCCC
Q 002335          757 VNSKEEKSDAERERSRRLHDRSSQREKDRSDEDNNRTRD-EHKEKILDRDRDREHGLDKVKTPDNKKLLDAKQLIDMIPK  835 (935)
Q Consensus       757 ~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ip~  835 (935)
                      ++.                    .+.+  .++|.+-..+ ++.+..-++.+++.|++...-  +|++  ++++||.+||+
T Consensus       520 ~~v--------------------~~~~--~d~Dk~v~~~kk~vp~dyd~n~~~~~~~~~nd--eK~~--~~ksLI~tIP~  573 (668)
T KOG2253|consen  520 TGV--------------------FRED--DDEDKNVHEKKKLVPLDYDRNQARAHSGESND--EKRK--RIKSLIETIPT  573 (668)
T ss_pred             ccc--------------------cccc--CCcccccchhhhcccccCChhhcccccCCcch--hHHH--HHHhhcccCCc
Confidence            100                    0000  1122111122 222222233234434333221  2444  79999999999


Q ss_pred             ChhhhhhhcccccccchhhHHhhhhhHHHHHHHhhcCcchhHHHHHHHHhhhccCCHHHHHHHHHHhhhHHHHHHHHHHH
Q 002335          836 TKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILDDEAEMFVLKMW  915 (935)
Q Consensus       836 ~k~~lf~~~i~w~~~~~~~~~~~~~pwi~kki~e~lG~ee~~lv~~i~~~l~~~~~~~~~~~~l~~~ld~~a~~fv~~lw  915 (935)
                      +|++||+|+|+|+.||..+|+++|+|||+|||+||||++|++||||||++|+.|..|+.||.+|.+|||++|++||+|||
T Consensus       574 ~keeLf~~pidw~~ld~~lm~~rirpwV~KKIiEflGeeE~tLVdFI~s~i~~h~~~q~iL~dl~~ilDEdAE~FV~KmW  653 (668)
T KOG2253|consen  574 EKEELFAYPIDWDELDSILMNERIRPWVNKKIIEFLGEEEDTLVDFICSNIRQHSSPQQILDDLAMILDEDAEVFVVKMW  653 (668)
T ss_pred             chHHHhhCcccHHHHhhHHHHHHHHHHHHHHHHHHhCCcchhHHHHHHHHHHhcCCHHHHHHHHHHHHhcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhccc
Q 002335          916 RMLIFEIKKVETGLA  930 (935)
Q Consensus       916 r~li~e~~~~~~g~~  930 (935)
                      ||||||+.+++.||.
T Consensus       654 RlLiyel~ar~~g~~  668 (668)
T KOG2253|consen  654 RLLIYELGARKLGLT  668 (668)
T ss_pred             HHHHHHhhhhhccCC
Confidence            999999999999985



>PF01480 PWI: PWI domain; InterPro: IPR002483 The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [] Back     alignment and domain information
>smart00311 PWI PWI, domain in splicing factors Back     alignment and domain information
>KOG2146 consensus Splicing coactivator SRm160/300, subunit SRm160 (contains PWI domain) [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PHA03378 EBNA-3B; Provisional Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR03687 pupylate_cterm ubiquitin-like protein Pup Back     alignment and domain information
>KOG2888 consensus Putative RNA binding protein [General function prediction only] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF11517 Nab2: Nuclear abundant poly(A) RNA-bind protein 2 (Nab2); InterPro: IPR021083 Nab2 is a yeast heterogeneous nuclear ribonucleoprotein that modulates poly(A) tail length and mRNA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query935
3v53_A119 Crystal Structure Of Human Rbm25 Length = 119 5e-24
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 3e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-04
>pdb|3V53|A Chain A, Crystal Structure Of Human Rbm25 Length = 119 Back     alignment and structure

Iteration: 1

Score = 110 bits (274), Expect = 5e-24, Method: Composition-based stats. Identities = 47/103 (45%), Positives = 72/103 (69%) Query: 827 KQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSST 886 K LI+ IP K ELF+Y ++W++ D + R+RPWI+KKI E++GEEE TLVD++ S Sbjct: 15 KSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKV 74 Query: 887 QDHVKASQMLELLQTILDDEAEMFVLKMWRMLIFEIKKVETGL 929 H +L+ + +LD+EAE+F++KMWR+LI+E + + GL Sbjct: 75 MAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGL 117
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query935
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-13
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-13
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-10
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-09
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-08
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-06
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-07
1mp1_A111 Ser/Arg-related nuclear matrix protein; four helix 1e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-11
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-11
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-11
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-05
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-11
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 9e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-11
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-11
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-10
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-08
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-10
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-10
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-10
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-10
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-10
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-10
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-10
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-05
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 7e-10
2zuo_A861 MVP, major vault protein; repeat domains, protein- 3e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 7e-10
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 7e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-09
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-05
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-09
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-09
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 3e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 9e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-09
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-09
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 3e-09
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-05
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-07
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 8e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 9e-09
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 9e-09
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-08
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-08
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-08
2div_A99 TRNA selenocysteine associated protein; structural 3e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-08
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-08
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-08
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-08
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 5e-08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-07
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-07
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-07
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-07
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 6e-07
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 7e-07
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 8e-07
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-07
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-06
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-06
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-06
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-06
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-06
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 5e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-06
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-06
1x5o_A114 RNA binding motif, single-stranded interacting pro 6e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-06
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 8e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-05
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-04
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-04
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 1e-04
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 2e-04
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 2e-04
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 2e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 2e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-04
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 3e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-04
2a6h_F423 RNA polymerase sigma factor RPOD; RNA polymerase h 3e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-04
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 4e-04
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 5e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-04
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score = 66.9 bits (164), Expect = 1e-13
 Identities = 17/94 (18%), Positives = 29/94 (30%), Gaps = 10/94 (10%)

Query: 213 PAEKPQTKVYVGKIAPTADSDFVLSVLKVCGTVKSWKRAQYPS--------NGTPKGFGF 264
            +      ++V  +      + V    K  G +K+ K+   P          G  KG   
Sbjct: 8   HSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEAT 67

Query: 265 CEFESAEGVLRALRLLNKFNIDGQELMLKVDQAT 298
             F+       A+   +     G    +KV  AT
Sbjct: 68  VSFDDPPSAKAAIDWFDGKEFSGNP--IKVSFAT 99


>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1mp1_A Ser/Arg-related nuclear matrix protein; four helix bundle, RNA binding protein; NMR {Homo sapiens} SCOP: a.188.1.1 Length = 111 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H Length = 423 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query935
3v53_A119 RNA-binding protein 25; PWI, RNA-binding domain; 2 100.0
1mp1_A111 Ser/Arg-related nuclear matrix protein; four helix 99.88
1x4q_A92 U4/U6 small nuclear ribonucleoprotein PRP3; PWI do 99.79
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.77
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.7
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.68
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.65
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.65
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.64
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.63
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.62
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.62
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.62
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.62
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.61
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.61
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.61
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.6
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.6
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.6
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.6
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.6
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.59
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.59
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.59
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.59
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.59
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.59
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.59
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.59
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.59
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.59
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.59
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.58
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.58
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.58
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.58
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.58
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.58
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.58
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.57
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.57
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.57
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.57
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.57
2div_A99 TRNA selenocysteine associated protein; structural 99.57
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.56
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.56
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.56
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.56
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.56
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.56
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.56
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.56
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.56
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.56
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.56
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.56
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.56
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.55
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.55
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.55
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.54
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.54
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.54
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.54
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.54
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.54
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.54
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.54
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.54
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.54
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.54
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.54
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.54
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.54
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.53
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.53
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.53
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.53
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.53
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.53
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.52
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.52
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.52
2dis_A109 Unnamed protein product; structural genomics, RRM 99.52
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.52
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.52
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.52
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.52
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.51
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.51
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.51
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.51
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.51
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.51
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.5
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.5
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.49
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.49
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.49
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.48
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.48
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.48
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.48
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.48
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.48
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.48
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.47
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.47
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.47
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.47
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.47
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.47
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.46
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.46
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.46
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.46
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.46
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.46
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.46
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.45
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.45
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.45
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.45
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.16
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.44
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.44
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.44
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.43
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.43
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.43
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.43
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.42
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.41
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.41
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.41
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.41
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.4
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.4
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.4
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.39
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.39
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.39
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.39
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.38
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.37
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.37
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.37
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.37
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.37
1x5p_A97 Negative elongation factor E; structure genomics, 99.37
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.36
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.36
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.36
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.36
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.36
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.35
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.34
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.34
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.33
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.33
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.33
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.33
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.32
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.32
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.32
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.31
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.31
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.3
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.3
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.29
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.29
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.29
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.28
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.27
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.26
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.25
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.22
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.21
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.21
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.2
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.2
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.2
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.17
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.16
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.16
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.15
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.14
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.13
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.12
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.1
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.08
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.06
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.03
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.94
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.88
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.85
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.79
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.7
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.57
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.36
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.86
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.34
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.07
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 94.74
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 94.1
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 92.99
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 92.98
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 92.35
2i2y_A150 Fusion protein consists of immunoglobin G- binding 91.6
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 88.9
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 87.97
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 86.25
>3v53_A RNA-binding protein 25; PWI, RNA-binding domain; 2.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4e-38  Score=292.48  Aligned_cols=106  Identities=44%  Similarity=0.889  Sum_probs=101.3

Q ss_pred             HHHHhhhcCCCChhhhhhhcccccccchhhHHhhhhhHHHHHHHhhcCcchhHHHHHHHHhhhccCCHHHHHHHHHHhhh
Q 002335          825 DAKQLIDMIPKTKEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLELLQTILD  904 (935)
Q Consensus       825 ~~~~l~~~ip~~k~~lf~~~i~w~~~~~~~~~~~~~pwi~kki~e~lG~ee~~lv~~i~~~l~~~~~~~~~~~~l~~~ld  904 (935)
                      ++++||++||++|++||+|+|+|++||.++|+++|||||+|||+||||++|++|||||+++|.+|.+|+.|+++|++|||
T Consensus        13 ~~k~li~~IP~~Ke~Lf~~~i~W~~vd~~~i~~~lkPWI~kKI~E~LG~eEd~LVdfI~~~L~~~~~pk~l~~~L~~~LD   92 (119)
T 3v53_A           13 HIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLD   92 (119)
T ss_dssp             SSHHHHHHSCSSHHHHHHSCCCTTTSCHHHHHHTHHHHHHHHHHHHTC---CHHHHHHHHHHHTTCCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCCHHHHhcccCChhhhhHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHcCCCHHHHHHHHHHHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhccc
Q 002335          905 DEAEMFVLKMWRMLIFEIKKVETGLA  930 (935)
Q Consensus       905 ~~a~~fv~~lwr~li~e~~~~~~g~~  930 (935)
                      ++|+.||.+||||||||+++++.||+
T Consensus        93 eeA~~FV~kLWrlLIfe~ea~~~Gl~  118 (119)
T 3v53_A           93 EEAEVFIVKMWRLLIYETEAKKIGLV  118 (119)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHCC-
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHcCcc
Confidence            99999999999999999999999997



>1mp1_A Ser/Arg-related nuclear matrix protein; four helix bundle, RNA binding protein; NMR {Homo sapiens} SCOP: a.188.1.1 Back     alignment and structure
>1x4q_A U4/U6 small nuclear ribonucleoprotein PRP3; PWI domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 935
d1mp1a_111 a.188.1.1 (A:) Ser/Arg-related nuclear matrix prot 1e-19
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-10
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-09
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-09
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 4e-09
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 4e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.002
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 8e-09
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-08
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-08
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 5e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 4e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-07
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 5e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-07
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-06
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 4e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-06
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-06
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-05
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-05
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 3e-05
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 4e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-05
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 5e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 5e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 0.001
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.002
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.004
>d1mp1a_ a.188.1.1 (A:) Ser/Arg-related nuclear matrix protein srm160 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: All alpha proteins
fold: PWI domain
superfamily: PWI domain
family: PWI domain
domain: Ser/Arg-related nuclear matrix protein srm160
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.9 bits (205), Expect = 1e-19
 Identities = 20/90 (22%), Positives = 50/90 (55%), Gaps = 6/90 (6%)

Query: 839 ELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQDHVKASQMLEL 898
           E    +++ +  +     E ++PWI+K++TE LG E+  ++++I +  +     S+M+++
Sbjct: 9   ECLEKKVDMSKVNL----EVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQI 64

Query: 899 -LQTILDDE-AEMFVLKMWRMLIFEIKKVE 926
            L   L+ + A  F+ ++W +L+   + + 
Sbjct: 65  NLTGFLNGKNAREFMGELWPLLLSAQENIA 94


>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query935
d1mp1a_111 Ser/Arg-related nuclear matrix protein srm160 {Hum 99.9
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.69
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.69
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.68
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.67
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.67
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.67
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.66
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.65
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.65
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.65
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.65
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.64
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.64
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.64
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.64
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.63
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.63
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.62
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.62
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.62
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.62
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.62
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.61
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.6
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.6
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.59
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.59
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.59
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.58
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.58
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.55
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.54
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.54
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.54
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.53
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.52
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.52
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.51
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.51
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.51
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.5
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.5
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.5
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.5
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.48
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.48
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.47
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.47
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.47
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.46
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.46
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.45
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.43
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.43
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.42
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.42
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.42
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.42
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.41
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.41
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.39
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.38
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.37
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.34
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.34
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.28
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.28
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.23
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.12
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.07
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.01
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.91
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.89
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.22
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.61
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.61
>d1mp1a_ a.188.1.1 (A:) Ser/Arg-related nuclear matrix protein srm160 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: PWI domain
superfamily: PWI domain
family: PWI domain
domain: Ser/Arg-related nuclear matrix protein srm160
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1e-24  Score=197.86  Aligned_cols=89  Identities=21%  Similarity=0.464  Sum_probs=80.2

Q ss_pred             hhhhhhhcccccccchhhHHhhhhhHHHHHHHhhcCcchhHHHHHHHHhhhc-cCCHHHHHHHHHHhhh-HHHHHHHHHH
Q 002335          837 KEELFSYEINWAVYDKHELHERMRPWISKKITEFLGEEETTLVDYIVSSTQD-HVKASQMLELLQTILD-DEAEMFVLKM  914 (935)
Q Consensus       837 k~~lf~~~i~w~~~~~~~~~~~~~pwi~kki~e~lG~ee~~lv~~i~~~l~~-~~~~~~~~~~l~~~ld-~~a~~fv~~l  914 (935)
                      ..++|+++|||..|+-.+    |||||++||+||||++|++|||||+++|.. |.+|+.|+++|++||| ++|+.||.+|
T Consensus         7 fp~~f~~kVD~~kV~l~~----ikpWI~kkI~e~LG~EDdvvvd~i~~~L~~~~~dpk~l~i~L~gfLd~k~a~~Fv~eL   82 (111)
T d1mp1a_           7 FAECLEKKVDMSKVNLEV----IKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGEL   82 (111)
T ss_dssp             CCSGGGGCCCTTTSCSGG----GHHHHHHHHHHHHSSCCSHHHHHHHHHTTSSSCCHHHHHHHHTTTSCSHHHHHHHHHH
T ss_pred             cCHHHccccCHHHcCHHH----HHHHHHHHHHHHhCcchHHHHHHHHHHHHccCCCHHHHHHHHHHHhCcccHHHHHHHH
Confidence            468999999999998655    899999999999999999999999999986 5799999999999998 7999999999


Q ss_pred             HHHHHHHHHhhhhccc
Q 002335          915 WRMLIFEIKKVETGLA  930 (935)
Q Consensus       915 wr~li~e~~~~~~g~~  930 (935)
                      |||||+.+.. ..||.
T Consensus        83 W~LLi~aq~s-~~GIP   97 (111)
T d1mp1a_          83 WPLLLSAQEN-IAGIP   97 (111)
T ss_dssp             HHHHHHHTTS-SSSCC
T ss_pred             HHHHHHhhcC-CcCCc
Confidence            9999976654 44764



>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure