Citrus Sinensis ID: 002521

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910---

MHRSYKLAGFLLRSIRSVSSKHSLRPSDTHRARNDPVFSLQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDRRDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLDDRRPQREVVIPLSLQRRVEGLLQEHLDRTQLSSGKISEKSEESKPIDLAENVNMKENTDSFLDGSVMEKVLQRRSLQMRNMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVSVQVIVSNQK

cccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccEEEEEcHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHcccccEEEEccccccccEEEHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHccccccccccEEEEEEEcccccccccccEEEEEEccccccEEcccccccccccccccHHHHHHHHcccccccccccEEEcccHHHHHHccccccccEEEcccHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccEEEEEccccccEEEcccccEEEccccccccccccc

ccccHHHHHHHHHHEEEcccccccccccccHHccccccccccccccccccccccccccHHccHHHHccccccccccccEEccccHEEEEEEEEEcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEccHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEcHHHHHHHHHccccccccEEEEEEcHHHcccHHHHHHHHHHHHHHHccccEEEEEEcEccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccEcccccccccccccEEEccccEccccHHccccHHHccHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHcccccccEEEEEEEcccEEEEEcccEEEEEccccEEEcccccccccccccHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHccccHHHcccHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccEEEEEEccccEEEEEccccEEEEccccccccccccc

MHRSYKLAGFLLRSIRsvsskhslrpsdthrarndpvfslqvllplapkrrgfcgyaaeqfsddeyecdfeghkasSTVANINEWKWKLGMLlrsetdqevtswdkrdrrDYEQISFLAKRMGLYSQVYGKAvvvskfplpnyrpdlddrrpqrevviplSLQRRVEGLLQEHLdrtqlssgkisekseeskpidlaenvnmkentdsfldgSVMEKVLQRRSLQMRNMQRAwqespegnkmldfrkslpsfKEKERLLQAIARNQVIVIsgetgcgkttqlpQYILESeiesgrgafcniictqprriSAMAVServsaergeplgetVGYKVRLegmkgknthllFCTSGILLRRLLsdhnlngvTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELfsnyfggaptihipgftypvqaHFLEDVLEMTGYKltslnqvddygQEKLWKTQRQLLPRKRKNQITALVEDALhksnfenyssRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRdqlkshpllgdpnrVLLLtchgsmptseqkfifekappniRKIVLATnmaeasitiNDIVFVVDCGKakettydalnntpcllpswISQASARQRrgragrvqpgqcyhlyprcvyEAFAEyqlpellrtpLNSLCLQIKSLQVGSIGeflsaalqppeplaVQNAVDFLKRIgaldekenLTNLGkflsmlpvdpklgkMLVMGAifrcfdpvltivsglsvrdpfllpqEKKNLAEIAKSRfsakdysdHMALVRAYEGwkdaeregsgyeYCWRNFLSAQTLQAIHSLRKQFTFILRdaglldedggnnklshnQSLVRAVICsglfpgitSVVHRetsmsfktmddGQVFLYAVSVQVIVSNQK

MHRSYKLAGFLLRSIrsvsskhslrpsdthrarndpvfslQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSEtdqevtswdkrdrrDYEQISFLAKRMGLYSQVYGKAVVVSKFPLpnyrpdlddrrpqREVVIPLSLQRRVEGLlqehldrtqlssgkisekseeskpidlaenvnmkentdsfldgsvMEKVLQRRSLQMRNMQRawqespegnkmlDFRKSLPSFKEKERLLQAIARNQVIVIsgetgcgktTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVservsaergeplgetvgYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSlnqvddygqeKLWKTqrqllprkrKNQITALVEdalhksnfeNYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDAlnntpcllpSWISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSrfsakdysdhMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVSVQVIVSNQK

MHRSYKLAGFLLRSIRSVSSKHSLRPSDTHRARNDPVFSLQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDRRDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLDDRRPQREVVIPLSLQRRVEGLLQEHLDRTQLssgkisekseeskPIDLAENVNMKENTDSFLDGSVMEKVLQRRSLQMRNMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVlkdllprrrdlrlilMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWIsqasarqrrgragrVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVSVQVIVSNQK

*******AGFLL************************VFSLQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDRRDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYR***********VVIPLSLQ*********************************************************************************************RLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAV***********LGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYS*RARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQA*********GRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVSVQVIV****

*****KL*GFLLRSIRS***************RNDPVFSLQVL****PK*RGFCGYAAE************************EWKWKLGMLLRS****************YEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLD*************************************************************************************************RKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQE***********RKRKNQITALVEDALHKSNFEN********LASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKS****GDPNRVLLLTCHGSMPTS*****FEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPF******************AKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGG*NKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVS*********

MHRSYKLAGFLLRSIRSV***********HRARNDPVFSLQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRS**********KRDRRDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLDDRRPQREVVIPLSLQRRVEGLLQEHLDRTQL*************PIDLAENVNMKENTDSFLDGSVMEKVLQRRSLQMRNMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQ************VQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAVSVQVIVSNQK

***SYKLAGFLLRSIRSVSSKHSL********RNDPVFSLQVLLPLAPKRRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDRRDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLDDRRPQREVVIPLSLQRRVEGLLQEHLDRTQ*************************ENTDSFLDGSVMEKVLQRRSLQMRNMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVVHRETSMSFKTMDDGQVFLYAV*V********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		913	2.2.26 [Sep-21-2011]
Q8VHK9		1001	Probable ATP-dependent RN	yes	no	0.740	0.675	0.445	1e-168
Q9H2U1		1008	Probable ATP-dependent RN	yes	no	0.757	0.686	0.432	1e-166
Q6P158		1386	Putative ATP-dependent RN	no	no	0.734	0.484	0.390	1e-142
Q6P5D3		1388	Putative ATP-dependent RN	no	no	0.737	0.484	0.382	1e-139
A3KMI0		1362	ATP-dependent RNA helicas	N/A	no	0.715	0.479	0.392	1e-133
Q7Z478		1369	ATP-dependent RNA helicas	no	no	0.714	0.476	0.383	1e-133
Q7L2E3		1194	Putative ATP-dependent RN	no	no	0.753	0.576	0.379	1e-132
Q5BJS0		1194	Putative ATP-dependent RN	no	no	0.753	0.576	0.380	1e-131
Q2NKY8		1220	Putative ATP-dependent RN	no	no	0.753	0.563	0.381	1e-131
Q99PU8		1217	Putative ATP-dependent RN	no	no	0.753	0.565	0.380	1e-131

>sp\|Q8VHK9\|DHX36_MOUSE Probable ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=2 SV=2	Back alignment and function desciption

 Score =  592 bits (1527), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/698 (44%), Positives = 445/698 (63%), Gaps = 22/698 (3%)

Query: 226 MRNMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQY 285
           + ++QR  +  P   +M  FRK LPS+  ++ L+  I  +QV VISGETGCGKTTQ+ Q+
Sbjct: 178 LEDLQRK-KTDPRYIEMQRFRKKLPSYGMQKELVNLINNHQVTVISGETGCGKTTQVTQF 236

Query: 286 ILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGE--TVGYKVRLEG-MKGK 342
           IL++ IE G+G+ C I+CTQPRRISA++V+ERV+ ER E  G   + GY++RL+  +  K
Sbjct: 237 ILDNYIERGKGSACRIVCTQPRRISAISVAERVATERAESCGNGNSTGYQIRLQSRLPRK 296

Query: 343 NTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLI 402
              +L+CT+GI+L+ L SD  L+ V+H+ +DEIHER +  D L+ V+KDLL  R DL++I
Sbjct: 297 QGSILYCTTGIILQWLQSDSRLSSVSHIVLDEIHERNLQSDVLMTVIKDLLHFRSDLKVI 356

Query: 403 LMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKL 462
           LMSATLNAE FS YFG  P IHIPGFT+PV  + LED++E   Y     +Q +   Q K 
Sbjct: 357 LMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDIIEKIRY---VPDQKEHRSQFKR 413

Query: 463 WKTQRQLLPRKRKNQITALVED---ALHKSNFENYSSRARDSLASWTADCIGFNLIEAVL 519
              Q  +  R+ K +  A+ ++   A  K     YS+   D L     D +  NLI A++
Sbjct: 414 GFMQGHV-NRQEKEEKEAIYKERWPAYIKELRTRYSASTVDVLQMMDDDKVDLNLIAALI 472

Query: 520 CHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFE 579
            +I  +E  GA+LVF+ GW++IS L D L S  +    ++ L++  H  MPT  Q  +F+
Sbjct: 473 RYIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKS-DKFLIIPLHSLMPTVNQTQVFK 531

Query: 580 KAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQASARQ 639
           K PP +RKIV+ATN+AE SITI+D+V+V+D GK KET +D  NN   +   W+S+A+A+Q
Sbjct: 532 KTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQ 591

Query: 640 RRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAA 699
           R+GRAGRVQPG CYHLY         +YQLPE+LRTPL  LCLQIK L++G I  FLS  
Sbjct: 592 RKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRL 651

Query: 700 LQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPV 759
           + PP   AV  ++  L  + ALD++E LT LG  L+ LPV+P +GKM++ GA+F C DPV
Sbjct: 652 MDPPSNEAVVLSIKHLMELSALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPV 711

Query: 760 LTIVSGLSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYE- 818
           LTI + LS +DPF++P  K+ +A+  +   + +  SDH+ +V A+EGW++A+R G  YE 
Sbjct: 712 LTIAASLSFKDPFVIPLGKEKIADARRKELAKETRSDHLTVVNAFEGWEEAKRRGFRYEK 771

Query: 819 -YCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLD----EDGGNNKLSHNQSLVRAVICSG 873
            YCW  FLS+ TLQ +H+++ QF   L  AG +     +D   N  S N+ +++AVIC+G
Sbjct: 772 DYCWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRSPKDPKANINSDNEKIIKAVICAG 831

Query: 874 LFPGITSVV----HRETSMSFKTMDDGQVFLYAVSVQV 907
           L+P +  +      +   +   T  DG V ++  SV V
Sbjct: 832 LYPKVAKIRLNLGKKRKMVKVHTKSDGLVSIHPKSVNV 869

Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q9H2U1\|DHX36_HUMAN Probable ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2	Back alignment and function description

>sp\|Q6P158\|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2	Back alignment and function description

>sp\|Q6P5D3\|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=2 SV=2	Back alignment and function description

>sp\|A3KMI0\|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1	Back alignment and function description

>sp\|Q7Z478\|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2	Back alignment and function description

>sp\|Q7L2E3\|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1	Back alignment and function description

>sp\|Q5BJS0\|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1	Back alignment and function description

>sp\|Q2NKY8\|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1	Back alignment and function description

>sp\|Q99PU8\|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		913
255546785		1129	ATP-dependent RNA helicase, putative [Ri	0.933	0.754	0.857	0.0
296081073		1162	unnamed protein product [Vitis vinifera]	0.960	0.754	0.858	0.0
225470788		1136	PREDICTED: probable ATP-dependent RNA he	0.960	0.772	0.858	0.0
145361138		1161	DEA(D/H)-box RNA helicase family protein	0.938	0.738	0.846	0.0
224113343		1077	predicted protein [Populus trichocarpa]	0.912	0.773	0.853	0.0
297806475		1160	predicted protein [Arabidopsis lyrata su	0.938	0.738	0.847	0.0
356523499		1161	PREDICTED: probable ATP-dependent RNA he	0.930	0.732	0.857	0.0
449506389		1144	PREDICTED: probable ATP-dependent RNA he	0.930	0.743	0.846	0.0
449435188		1144	PREDICTED: probable ATP-dependent RNA he	0.930	0.743	0.846	0.0
357115628		1121	PREDICTED: probable ATP-dependent RNA he	0.945	0.769	0.815	0.0

>gi\|255546785\|ref\|XP_002514451.1\| ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223546447\|gb\|EEF47947.1\| ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1546 bits (4003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/859 (85%), Positives = 797/859 (92%), Gaps = 7/859 (0%)

Query: 50  RRGFCGYAAEQFSDDEYECDFEGHKASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDR 109
           RR F  YAAEQFSDD+YECDF  HKASS+V+NI+EWKWKL +LLRSETDQE+ S D++DR
Sbjct: 35  RRPFSSYAAEQFSDDDYECDFGTHKASSSVSNIDEWKWKLSLLLRSETDQEIVSRDRKDR 94

Query: 110 RDYEQISFLAKRMGLYSQVYGKAVVVSKFPLPNYRPDLDDRR--PQREVVIPLSLQRRVE 167
           RDYEQIS LAKRMGLYS++YG+ VV SK PLPNYRPDLDD+    +R VVIPLSLQRRVE
Sbjct: 95  RDYEQISNLAKRMGLYSEMYGRVVVASKVPLPNYRPDLDDKHFFSRRNVVIPLSLQRRVE 154

Query: 168 GLLQEHLDRTQLSSGKISEKSEESKPIDLAENVNMKENTDSFLDGSVMEKVLQRRSLQMR 227
            LLQEHLDRTQLSS ++S+ + ++  ++  E+    EN +SFLDGSVMEK+LQRRSL+MR
Sbjct: 155 SLLQEHLDRTQLSSQEVSDCAADTTSLNQVED----ENPESFLDGSVMEKILQRRSLRMR 210

Query: 228 NMQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYIL 287
           NMQRAWQESPEG K++DFRKSLP+FKEKE+LLQAIARNQVIV+SGETGCGKTTQLP YIL
Sbjct: 211 NMQRAWQESPEGRKIMDFRKSLPAFKEKEKLLQAIARNQVIVVSGETGCGKTTQLPHYIL 270

Query: 288 ESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLL 347
           ESEIESGRGAFC+IICTQPRRISAMAV++RVSAERGEPLGETVGYKVRLEGMKGK+THLL
Sbjct: 271 ESEIESGRGAFCSIICTQPRRISAMAVADRVSAERGEPLGETVGYKVRLEGMKGKDTHLL 330

Query: 348 FCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSAT 407
           FCTSGILLRRLLSD NL G+THVFVDEIHERGMNEDFLLIVLKDLLPRR+DLRLILMSAT
Sbjct: 331 FCTSGILLRRLLSDRNLTGITHVFVDEIHERGMNEDFLLIVLKDLLPRRQDLRLILMSAT 390

Query: 408 LNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQR 467
           LNAELFSNYFGGAP IHIPGFTYPV+AHFLEDVLEMTGYKLTS NQ+DDYGQ+K+WKTQR
Sbjct: 391 LNAELFSNYFGGAPKIHIPGFTYPVRAHFLEDVLEMTGYKLTSFNQIDDYGQDKMWKTQR 450

Query: 468 QLLPRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKEC 527
           QL PRKRKNQI  LVEDAL+KS+FE+YSSRARDSLA W  DCIGFNLIEAVLCHICRKE 
Sbjct: 451 QLAPRKRKNQIATLVEDALNKSSFESYSSRARDSLACWMPDCIGFNLIEAVLCHICRKER 510

Query: 528 PGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRK 587
           PG VLVFMTGWEDISCLRDQLK+HPLLGDPNRVLLLTCHGSM TSEQK IFE+ P N+RK
Sbjct: 511 PGGVLVFMTGWEDISCLRDQLKAHPLLGDPNRVLLLTCHGSMATSEQKLIFERPPSNVRK 570

Query: 588 IVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWISQASARQRRGRAGRV 647
           IVLATNMAEASITIND+VFVVDCGKAKETTYDALNNTPCLLPSWISQASA QRRGRAGRV
Sbjct: 571 IVLATNMAEASITINDMVFVVDCGKAKETTYDALNNTPCLLPSWISQASACQRRGRAGRV 630

Query: 648 QPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLA 707
           QPG+CYHLYP+CVYEAFAEYQLPELLRTPLNSLCLQIKSLQV SI EFLSAALQPPEPLA
Sbjct: 631 QPGECYHLYPKCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVESIAEFLSAALQPPEPLA 690

Query: 708 VQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLS 767
           VQNA+ FLK IGALDEKENLTNLGKFLS+LPVDPKLGKML+MGAIFRCFDPVLTIVSGLS
Sbjct: 691 VQNAIGFLKMIGALDEKENLTNLGKFLSILPVDPKLGKMLIMGAIFRCFDPVLTIVSGLS 750

Query: 768 VRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFLSA 827
           VRDPFLLPQEKK+LA  AKSRFSAKDYSDHMALVRAYEGWKDAEREGS YEYCWRNFLSA
Sbjct: 751 VRDPFLLPQEKKDLAGTAKSRFSAKDYSDHMALVRAYEGWKDAEREGSAYEYCWRNFLSA 810

Query: 828 QTLQAIHSLRKQFTFILRDAGLLDED-GGNNKLSHNQSLVRAVICSGLFPGITSVVHRET 886
           QTLQAIHSLRKQF+FIL++AGL+D D G NN+LSHNQSLVRA+ICSGL+PGI SVVHRET
Sbjct: 811 QTLQAIHSLRKQFSFILKEAGLVDADAGANNRLSHNQSLVRAIICSGLYPGIASVVHRET 870

Query: 887 SMSFKTMDDGQVFLYAVSV 905
           SMSFKTMDDGQV LYA SV
Sbjct: 871 SMSFKTMDDGQVLLYANSV 889

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296081073\|emb\|CBI18267.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225470788\|ref\|XP_002269787.1\| PREDICTED: probable ATP-dependent RNA helicase DHX36 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|145361138\|ref\|NP_680142.2\| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] gi\|10178028\|dbj\|BAB11511.1\| ATP-dependent RNA helicase A-like protein [Arabidopsis thaliana] gi\|332003418\|gb\|AED90801.1\| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224113343\|ref\|XP_002316463.1\| predicted protein [Populus trichocarpa] gi\|222865503\|gb\|EEF02634.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297806475\|ref\|XP_002871121.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297316958\|gb\|EFH47380.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356523499\|ref\|XP_003530375.1\| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max]	Back alignment and taxonomy information

>gi\|449506389\|ref\|XP_004162736.1\| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449435188\|ref\|XP_004135377.1\| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357115628\|ref\|XP_003559590.1\| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	LOW CONFIDENCE prediction!
3rd Layer	3.6.4	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		913
COG1643		845	COG1643, HrpA, HrpA-like helicases [DNA replicatio	3e-81
COG1643		845	COG1643, HrpA, HrpA-like helicases [DNA replicatio	6e-76
TIGR01967		1283	TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H	1e-53
TIGR01967		1283	TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H	8e-50
PRK11131		1294	PRK11131, PRK11131, ATP-dependent RNA helicase Hrp	4e-49
PRK11131		1294	PRK11131, PRK11131, ATP-dependent RNA helicase Hrp	1e-44
TIGR01970		819	TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H	1e-35
PRK11664		812	PRK11664, PRK11664, ATP-dependent RNA helicase Hrp	3e-35
pfam04408		91	pfam04408, HA2, Helicase associated domain (HA2)	2e-32
TIGR01970		819	TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H	4e-32
PRK11664		812	PRK11664, PRK11664, ATP-dependent RNA helicase Hrp	4e-29
smart00847		82	smart00847, HA2, Helicase associated domain (HA2)	2e-24
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	4e-24
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	8e-24
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	4e-11
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	1e-09
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	8e-09
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	2e-08
pfam07717		109	pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch	8e-08
PHA02653		675	PHA02653, PHA02653, RNA helicase NPH-II; Provision	3e-04
PHA02653		675	PHA02653, PHA02653, RNA helicase NPH-II; Provision	4e-04
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	0.002
pfam13191		154	pfam13191, AAA_16, AAA ATPase domain	0.002

>gnl\|CDD\|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

 Score =  280 bits (718), Expect = 3e-81
 Identities = 124/340 (36%), Positives = 175/340 (51%), Gaps = 18/340 (5%)

Query: 514 LIEAVLC--HICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPT 571
           L++A++    I  +E  G++LVF+ G  +I    + L+   L GD   +L L  +G++  
Sbjct: 243 LLDAIVAAVDIHLREGSGSILVFLPGQREIERTAEWLEKAEL-GDDLEILPL--YGALSA 299

Query: 572 SEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSW 631
            EQ  +FE AP   RK+VLATN+AE S+TI  I +V+D G AKE  YD       L    
Sbjct: 300 EEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEP 359

Query: 632 ISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGS 691
           IS+ASA QR GRAGR  PG CY LY    + AF E+ LPE+LRT L+ L LQ+KSL +G 
Sbjct: 360 ISKASADQRAGRAGRTGPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQLKSLGIGQ 419

Query: 692 IGEFLSAALQPPEPLAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGA 751
                   L PP   A+Q A+  L+ +GALD+   LT LGK +S+LP+DP+L +ML+   
Sbjct: 420 D-IAPFPFLDPPPEAAIQAALTLLQELGALDDSGKLTPLGKQMSLLPLDPRLARMLLTAP 478

Query: 752 IFRCFDPVLTIVSGLSVRD---PFLLPQEKK------NLAEIAKSRFSAKDYSDHMALVR 802
              C     TI S LS +D    F    + +      +L +  K R +A    DH+ L+ 
Sbjct: 479 EGGCLGEAATIASMLSEQDRESDFSRDVKLRKQRTAQDLLKRLKRRNAADPRGDHLLLLE 538

Query: 803 AYEGWKDAEREGSGY---EYCWRNFLSAQTLQAIHSLRKQ 839
           A+      +R    Y     C       + L     +   
Sbjct: 539 AFPDRIARKRAKGEYLRANGCRAMLFPTKALSRAPWIIAA 578

Length = 845

>gnl\|CDD\|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA	Back alignment and domain information

>gnl\|CDD\|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA	Back alignment and domain information

>gnl\|CDD\|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>gnl\|CDD\|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>gnl\|CDD\|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB	Back alignment and domain information

>gnl\|CDD\|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>gnl\|CDD\|218070 pfam04408, HA2, Helicase associated domain (HA2)	Back alignment and domain information

>gnl\|CDD\|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB	Back alignment and domain information

>gnl\|CDD\|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>gnl\|CDD\|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold	Back alignment and domain information

>gnl\|CDD\|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional	Back alignment and domain information

>gnl\|CDD\|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|221970 pfam13191, AAA_16, AAA ATPase domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		913
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	100.0
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	100.0
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	100.0
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	100.0
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	100.0
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	100.0
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	100.0
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	100.0
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PTZ00110		545	helicase; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.98
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	99.98
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.98
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	99.97
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.97
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	99.97
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.97
KOG0346		569	consensus RNA helicase [RNA processing and modific	99.97
KOG0354		746	consensus DEAD-box like helicase [General function	99.97
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.97
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	99.97
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.97
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.96
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.96
PHA02558		501	uvsW UvsW helicase; Provisional	99.96
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.96
KOG0327		397	consensus Translation initiation factor 4F, helica	99.95
KOG4284		980	consensus DEAD box protein [Transcription]	99.95
PRK13766		773	Hef nuclease; Provisional	99.95
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.95
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.95
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.95
COG1205		851	Distinct helicase family with a unique C-terminal	99.95
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.95
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.95
PRK09401		1176	reverse gyrase; Reviewed	99.95
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	99.94
PRK14701		1638	reverse gyrase; Provisional	99.94
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.94
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.93
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.93
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.93
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.92
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.92
PRK05580		679	primosome assembly protein PriA; Validated	99.92
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.91
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.91
PRK09694		878	helicase Cas3; Provisional	99.91
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.91
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.91
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.91
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.91
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.91
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.9
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.9
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.9
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.87
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.85
PRK04914		956	ATP-dependent helicase HepA; Validated	99.85
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.83
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.8
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.79
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.79
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.77
COG4096		875	HsdR Type I site-specific restriction-modification	99.77
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.75
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.74
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.74
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.72
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.72
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.71
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.71
PF04408		102	HA2: Helicase associated domain (HA2); InterPro: I	99.69
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.68
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.66
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	99.64
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.62
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.57
smart00847		92	HA2 Helicase associated domain (HA2) Add an annota	99.57
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.5
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.46
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.45
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.45
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.44
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.43
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.4
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.38
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	99.37
KOG1123		776	consensus RNA polymerase II transcription initiati	99.37
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.37
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.36
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.35
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.34
PRK05298		652	excinuclease ABC subunit B; Provisional	99.34
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.29
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.23
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.2
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.2
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.18
PRK14873		665	primosome assembly protein PriA; Provisional	99.18
KOG0387		923	consensus Transcription-coupled repair protein CSB	99.14
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	99.13
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.12
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.08
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.99
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.99
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.94
COG4889		1518	Predicted helicase [General function prediction on	98.92
PF07717		114	OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi	98.88
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.82
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	98.78
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	98.64
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	98.62
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	98.53
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.41
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	98.37
COG0610		962	Type I site-specific restriction-modification syst	98.35
KOG1002		791	consensus Nucleotide excision repair protein RAD16	98.12
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	98.04
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	98.01
PF13245		76	AAA_19: Part of AAA domain	97.93
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.88
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.85
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	97.83
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	97.82
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	97.79
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.76
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.73
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.72
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.7
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	97.67
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.58
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.57
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.56
KOG1803		649	consensus DNA helicase [Replication, recombination	97.56
PRK10536		262	hypothetical protein; Provisional	97.54
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.53
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	97.49
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	97.49
KOG4439		901	consensus RNA polymerase II transcription terminat	97.45
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.37
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	97.36
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.27
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.22
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.2
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	97.18
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	97.17
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.17
PRK15483		986	type III restriction-modification system StyLTI en	97.17
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	97.13
PRK06526		254	transposase; Provisional	97.11
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.0
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	96.98
PF05729		166	NACHT: NACHT domain	96.94
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	96.94
PRK14974		336	cell division protein FtsY; Provisional	96.94
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	96.91
PRK04296		190	thymidine kinase; Provisional	96.86
KOG2340		698	consensus Uncharacterized conserved protein [Funct	96.85
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.83
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	96.81
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.79
PRK08181		269	transposase; Validated	96.78
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.74
PRK13889		988	conjugal transfer relaxase TraA; Provisional	96.73
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	96.68
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	96.65
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	96.64
PRK09183		259	transposase/IS protein; Provisional	96.5
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	96.5
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	96.41
smart00382		148	AAA ATPases associated with a variety of cellular	96.38
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.28
PHA03333		752	putative ATPase subunit of terminase; Provisional	96.26
TIGR00376		637	DNA helicase, putative. The gene product may repre	96.22
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.15
PRK06835		329	DNA replication protein DnaC; Validated	96.15
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	96.12
PRK07952		244	DNA replication protein DnaC; Validated	96.06
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.03
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.01
PRK10416		318	signal recognition particle-docking protein FtsY;	95.94
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.89
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	95.88
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	95.86
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	95.85
TIGR00064		272	ftsY signal recognition particle-docking protein F	95.83
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.8
PF13173		128	AAA_14: AAA domain	95.77
PRK11054		684	helD DNA helicase IV; Provisional	95.76
PRK13826		1102	Dtr system oriT relaxase; Provisional	95.72
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	95.72
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	95.7
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.66
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	95.63
PRK10867		433	signal recognition particle protein; Provisional	95.62
PRK08727		233	hypothetical protein; Validated	95.54
PRK08116		268	hypothetical protein; Validated	95.54
PRK06893		229	DNA replication initiation factor; Validated	95.46
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.46
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	95.43
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	95.41
PRK05642		234	DNA replication initiation factor; Validated	95.38
COG3587		985	Restriction endonuclease [Defense mechanisms]	95.35
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	95.35
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	95.32
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	95.31
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	95.25
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	95.24
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.22
PRK00411		394	cdc6 cell division control protein 6; Reviewed	95.21
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	95.2
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	95.19
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.15
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	95.13
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	95.12
PRK08939		306	primosomal protein DnaI; Reviewed	95.11
PRK08084		235	DNA replication initiation factor; Provisional	95.08
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	95.05
PTZ00112		1164	origin recognition complex 1 protein; Provisional	95.05
PHA02533		534	17 large terminase protein; Provisional	95.04
cd03115		173	SRP The signal recognition particle (SRP) mediates	95.04
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	95.02
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	95.01
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	94.99
TIGR00959		428	ffh signal recognition particle protein. This mode	94.96
PRK12377		248	putative replication protein; Provisional	94.95
PRK08903		227	DnaA regulatory inactivator Hda; Validated	94.89
PRK12402		337	replication factor C small subunit 2; Reviewed	94.88
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	94.85
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	94.82
KOG1805		1100	consensus DNA replication helicase [Replication, r	94.81
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	94.8
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	94.78
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.77
PF00004		132	AAA: ATPase family associated with various cellula	94.74
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	94.72
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	94.71
PRK06921		266	hypothetical protein; Provisional	94.71
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	94.7
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.63
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.61
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	94.58
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	94.57
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	94.57
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.56
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	94.54
PRK07940		394	DNA polymerase III subunit delta'; Validated	94.41
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	94.37
PRK07471		365	DNA polymerase III subunit delta'; Validated	94.35
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.35
PRK13833		323	conjugal transfer protein TrbB; Provisional	94.32
PLN03025		319	replication factor C subunit; Provisional	94.32
COG2256		436	MGS1 ATPase related to the helicase subunit of the	94.3
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	94.28
CHL00181		287	cbbX CbbX; Provisional	94.24
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	94.23
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	94.22
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	94.19
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	94.11
KOG2373		514	consensus Predicted mitochondrial DNA helicase twi	94.1
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	94.1
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	94.07
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	94.02
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	94.02
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	93.97
COG3973		747	Superfamily I DNA and RNA helicases [General funct	93.92
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	93.89
PRK05707		328	DNA polymerase III subunit delta'; Validated	93.85
PRK08533		230	flagellar accessory protein FlaH; Reviewed	93.83
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	93.81
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	93.8
KOG2028		554	consensus ATPase related to the helicase subunit o	93.72
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	93.7
PRK14088		440	dnaA chromosomal replication initiation protein; P	93.63
PRK13851		344	type IV secretion system protein VirB11; Provision	93.61
PRK12422		445	chromosomal replication initiation protein; Provis	93.47
PHA02544		316	44 clamp loader, small subunit; Provisional	93.4
PRK00440		319	rfc replication factor C small subunit; Reviewed	93.31
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	93.3
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	93.25
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	93.23
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	93.2
PRK09087		226	hypothetical protein; Validated	93.14
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	93.12
PTZ00293		211	thymidine kinase; Provisional	93.1
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	93.04
PHA03368		738	DNA packaging terminase subunit 1; Provisional	93.02
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	93.02
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	93.0
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	92.95
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	92.94
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	92.93
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	92.83
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	92.82
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	92.79
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	92.72
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.72
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	92.66
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	92.63
cd02641		60	R3H_Smubp-2_like R3H domain of Smubp-2_like protei	92.58
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	92.43
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	92.41
PRK04195		482	replication factor C large subunit; Provisional	92.41
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	92.36
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	92.31
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	92.3
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	92.25
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	92.2
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	92.18
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	92.16
PHA00729		226	NTP-binding motif containing protein	92.11
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	91.97
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	91.93
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	91.93
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	91.86
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	91.73
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	91.65
COG4626		546	Phage terminase-like protein, large subunit [Gener	91.53
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	91.41
cd02640		60	R3H_NRF R3H domain of the NF-kappaB-repression fac	91.25
PRK11823		446	DNA repair protein RadA; Provisional	91.22
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	91.22
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	91.2
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	91.08
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	91.05
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	91.04
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	91.04
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	91.03
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	90.88
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	90.85
COG0593		408	DnaA ATPase involved in DNA replication initiation	90.85
TIGR00767		415	rho transcription termination factor Rho. Members	90.78
PF13555		62	AAA_29: P-loop containing region of AAA domain	90.77
PRK13342		413	recombination factor protein RarA; Reviewed	90.74
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	90.47
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	90.33
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	90.26
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	90.15
PRK08058		329	DNA polymerase III subunit delta'; Validated	90.11
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	90.1
PRK08769		319	DNA polymerase III subunit delta'; Validated	90.07
PRK07399		314	DNA polymerase III subunit delta'; Validated	90.04
PRK10865		857	protein disaggregation chaperone; Provisional	89.93
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	89.91
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	89.87
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	89.77
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	89.75
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	89.69
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	89.57
PRK06871		325	DNA polymerase III subunit delta'; Validated	89.42
PRK04328		249	hypothetical protein; Provisional	89.32
PF12846		304	AAA_10: AAA-like domain	89.31
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	89.3
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	89.23
PRK05973		237	replicative DNA helicase; Provisional	89.2
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	89.18
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	89.13
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	89.08
PF05894		333	Podovirus_Gp16: Podovirus DNA encapsidation protei	89.05
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	88.92
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	88.84
PRK04301		317	radA DNA repair and recombination protein RadA; Va	88.77
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	88.68
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	88.66
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	88.63
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	88.59
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	88.55
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	88.54
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	88.49
PRK06964		342	DNA polymerase III subunit delta'; Validated	88.4
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	88.19
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	88.16
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	88.14
cd01128		249	rho_factor Transcription termination factor rho is	88.04
PRK05564		313	DNA polymerase III subunit delta'; Validated	87.99
PRK05580		679	primosome assembly protein PriA; Validated	87.98
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	87.9
PRK10436		462	hypothetical protein; Provisional	87.74
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	87.67
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	87.62
PRK13341		725	recombination factor protein RarA/unknown domain f	87.49
PHA00149		331	DNA encapsidation protein	87.41
TIGR00595		505	priA primosomal protein N'. All proteins in this f	87.32
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	87.3
PHA02244		383	ATPase-like protein	87.29
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	87.27
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	87.25
PRK08699		325	DNA polymerase III subunit delta'; Validated	87.23
PRK03992		389	proteasome-activating nucleotidase; Provisional	87.23
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	87.2
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	87.18
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	87.14
PRK13764		602	ATPase; Provisional	87.11
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	87.05
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	87.01
KOG2036		1011	consensus Predicted P-loop ATPase fused to an acet	86.85
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	86.84
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	86.82
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	86.81
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	86.76
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	86.71
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	86.63
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	86.53
COG2204		464	AtoC Response regulator containing CheY-like recei	86.53
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	86.45
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	86.43
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	86.33
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	86.27
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	86.17
PRK06067		234	flagellar accessory protein FlaH; Validated	86.1
PRK06090		319	DNA polymerase III subunit delta'; Validated	85.93
PRK13695		174	putative NTPase; Provisional	85.91
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	85.62
PRK07993		334	DNA polymerase III subunit delta'; Validated	85.61
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	85.52
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	85.33
PRK08760		476	replicative DNA helicase; Provisional	85.31
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	85.29
PRK09376		416	rho transcription termination factor Rho; Provisio	85.13
PRK04841		903	transcriptional regulator MalT; Provisional	85.06
cd02034		116	CooC The accessory protein CooC, which contains a	85.04
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	85.03
TIGR02533		486	type_II_gspE general secretory pathway protein E.	85.02
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	85.01
TIGR02237		209	recomb_radB DNA repair and recombination protein R	84.97
PRK14873		665	primosome assembly protein PriA; Provisional	84.93
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	84.83
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	84.74
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	84.7
PRK00300		205	gmk guanylate kinase; Provisional	84.67
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	84.55
cd01394		218	radB RadB. The archaeal protein radB shares simila	84.51
KOG0780		483	consensus Signal recognition particle, subunit Srp	84.38
PLN02165		334	adenylate isopentenyltransferase	84.19
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	84.14
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	84.04
CHL00176		638	ftsH cell division protein; Validated	83.89
COG3598		402	RepA RecA-family ATPase [DNA replication, recombin	83.83
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	83.78
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	83.65
cd06007		59	R3H_DEXH_helicase R3H domain of a group of protein	83.65
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	83.64
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	83.56
PRK14729		300	miaA tRNA delta(2)-isopentenylpyrophosphate transf	83.53
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	83.49
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	83.23
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	83.15
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	83.12
PRK05022		509	anaerobic nitric oxide reductase transcription reg	83.02
PRK14530		215	adenylate kinase; Provisional	83.02
PF13871		278	Helicase_C_4: Helicase_C-like	82.96
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	82.94
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	82.69
PRK08233		182	hypothetical protein; Provisional	82.68
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	82.5
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	82.29
CHL00095		821	clpC Clp protease ATP binding subunit	82.28

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=9.2e-130  Score=1150.61  Aligned_cols=775  Identities=47%  Similarity=0.749  Sum_probs=694.0

Q ss_pred             cccccccHHHHHHHHhhhhccCCCceEEeccccCcccHHHHHHHHHHcccceeecc--cEEEEecCCCCCCCCCCCCCC-
Q 002521           75 ASSTVANINEWKWKLGMLLRSETDQEVTSWDKRDRRDYEQISFLAKRMGLYSQVYG--KAVVVSKFPLPNYRPDLDDRR-  151 (913)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~-  151 (913)
                      ++....++..|.|+.++.......+|++....++|++++.++.+...++.+.+.|.  +..++++.+.|+|..+++.+. 
T Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   96 (924)
T KOG0920|consen   17 GEFLSMDSHAWLRDSSSSKEMTDDDEVIRALTQSRLPKNLLEKLIQIARSSSTAKNLMKFHTVSKITEPSRLLDLSPKPM   96 (924)
T ss_pred             cccccccccccccCccccccccCcceeehhccccCcccccchHHHHHHHhhhhhhhcccceeeeccCCCCceeeeccccc
Confidence            55555599999999997777788899999999999999999999999999988775  578999999999999999988 


Q ss_pred             -CccccccchhhhHHHHHHHHHHHhhccCCCCCCcccccCCCCccccccccccCCCCCCCchHHHHHHHHHHHHHHHHHH
Q 002521          152 -PQREVVIPLSLQRRVEGLLQEHLDRTQLSSGKISEKSEESKPIDLAENVNMKENTDSFLDGSVMEKVLQRRSLQMRNMQ  230 (913)
Q Consensus       152 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  230 (913)
                       ++.+..+..+...+...++..+..... ..+.....-+.+  .  ..  ..+......   ...             .+
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~--~--~~--~~d~~~~~~---s~~-------------~~  153 (924)
T KOG0920|consen   97 TLQAKLKLKAEAENKAAALVCKLLESLK-LVDRNNENLLLP--T--TG--QKDEPLLKK---SIS-------------RQ  153 (924)
T ss_pred             chhhhheecccccchhHHHHHHHHHHhc-cCCCcccccccc--c--cc--ccccccCcc---hhh-------------hh
Confidence             788888999999998888888776655 322211111111  0  00  111111111   000             45


Q ss_pred             HHhhcCchhhhHHhhhcCCCcHHHHHHHHHHHHcCCeEEEEcCCCchHHhHHHHHHHHHHHHhCCCCceEEEEcchhHHH
Q 002521          231 RAWQESPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRIS  310 (913)
Q Consensus       231 ~~~~~~~~~~~l~~~r~~lP~~~~q~~il~~i~~~~~vII~apTGSGKTt~~~~~ile~~~~~~~~~~~~Ilv~qPrr~L  310 (913)
                      ..+..+..+++++++|.+||+++++++|++++.++++++|+|+||||||||+||+|++..+.++  +.|+|+||||||+.
T Consensus       154 ~~~~~s~~~~~~~~~R~~LPa~~~r~~Il~~i~~~qVvvIsGeTGcGKTTQvpQfiLd~~~~~~--~~~~IicTQPRRIs  231 (924)
T KOG0920|consen  154 SEPKKSESYKEMLRFRESLPAYKMRDTILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESG--AACNIICTQPRRIS  231 (924)
T ss_pred             chhhhhhHHHHHHHHHHhCccHHHHHHHHHHHHhCceEEEeCCCCCCchhhhhHHHHHHHHhcC--CCCeEEecCCchHH
Confidence            5567789999999999999999999999999999999999999999999999999999988766  78999999999999


Q ss_pred             HHHHHHHHHHHhCCCcccEeeeEEeccccCCCCceEEEEecHHHHHHHhcCCCCCCceEEEeccccccCcchHHHHHHHH
Q 002521          311 AMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLK  390 (913)
Q Consensus       311 a~qva~rv~~~~~~~~g~~vGy~v~~e~~~~~~~~Ivv~T~g~Ll~~l~~~~~L~~~s~IIIDEaHer~~~~d~ll~llk  390 (913)
                      |+++|+||+.|+++..|..|||++|.++..+..+.++|||+|+|++.|..++.+.+++|||+||+|||++++|+++.++|
T Consensus       232 AIsvAeRVa~ER~~~~g~~VGYqvrl~~~~s~~t~L~fcTtGvLLr~L~~~~~l~~vthiivDEVHER~i~~DflLi~lk  311 (924)
T KOG0920|consen  232 AISVAERVAKERGESLGEEVGYQVRLESKRSRETRLLFCTTGVLLRRLQSDPTLSGVTHIIVDEVHERSINTDFLLILLK  311 (924)
T ss_pred             HHHHHHHHHHHhccccCCeeeEEEeeecccCCceeEEEecHHHHHHHhccCcccccCceeeeeeEEEccCCcccHHHHHH
Confidence            99999999999999999999999999999998999999999999999999999999999999999999999999999999


Q ss_pred             HhCccCccceEEEeccccCHHHHHhhhCCCCeeccCCccccceeeehhhHHhhhcccccccccccchhhhhHHHHhhhhc
Q 002521          391 DLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLL  470 (913)
Q Consensus       391 ~ll~~~~~~kiIlmSATl~~~~~~~yf~~~~~i~i~g~~~pv~~~yl~di~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  470 (913)
                      .++..+|++|+|+||||++++.|+.||+++|+++|+|++|||..+|++|++..++|........  .+.+.         
T Consensus       312 ~lL~~~p~LkvILMSAT~dae~fs~YF~~~pvi~i~grtfpV~~~fLEDil~~~~~~~~~~~~~--~~~~~---------  380 (924)
T KOG0920|consen  312 DLLPRNPDLKVILMSATLDAELFSDYFGGCPVITIPGRTFPVKEYFLEDILSKTGYVSEDDSAR--SGPER---------  380 (924)
T ss_pred             HHhhhCCCceEEEeeeecchHHHHHHhCCCceEeecCCCcchHHHHHHHHHHHhcccccccccc--ccccc---------
Confidence            9999999999999999999999999999999999999999999999999999998876644322  00000         


Q ss_pred             hhhhhhhHHHHHHHHHhhccccccchhhhhhhccccccccchhhHHHHHHHHhhhcCCCcEEEEcCChHHHHHHHHHHHc
Q 002521          471 PRKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKS  550 (913)
Q Consensus       471 ~~~~~~~i~~~v~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~li~~ll~~i~~~~~~g~iLVF~~~~~~i~~l~~~L~~  550 (913)
                           .        .+..           ..+..|.++ ++++++..++++|+.....|.||||+||+++|..+.+.|..
T Consensus       381 -----~--------~~~~-----------~~~~~~~~~-id~~Li~~li~~I~~~~~~GaILVFLPG~~eI~~~~~~L~~  435 (924)
T KOG0920|consen  381 -----S--------QLRL-----------ARLKLWEPE-IDYDLIEDLIEYIDEREFEGAILVFLPGWEEILQLKELLEV  435 (924)
T ss_pred             -----C--------cccc-----------ccchhcccc-ccHHHHHHHHHhcccCCCCceEEEEcCCHHHHHHHHHHhhh
Confidence                 0        0000           002223333 89999999999999998899999999999999999999998


Q ss_pred             CCCCCCCCCeEEEEecCCCChHHHHHHhccCCCCccEEEEecchhhhcCCCCCeEEEEeCCCCcceeecCCCCCCcCCcc
Q 002521          551 HPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRKIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPS  630 (913)
Q Consensus       551 ~~~~~~~~~~~v~~lHs~l~~~er~~v~~~f~~g~~kVLVATniae~GIdIp~v~~VId~g~~k~~~yd~~~~~~~l~~~  630 (913)
                      +..+.+..++.+.++||.|+..+|+.||...+.|.+|||+||||||+|||||||.||||+|+.|++.||+..++.++...
T Consensus       436 ~~~f~~~~~~~ilplHs~~~s~eQ~~VF~~pp~g~RKIIlaTNIAETSITIdDVvyVIDsG~~Ke~~yD~~~~~s~l~~~  515 (924)
T KOG0920|consen  436 NLPFADSLKFAILPLHSSIPSEEQQAVFKRPPKGTRKIILATNIAETSITIDDVVYVIDSGLVKEKSYDPERKVSCLLLS  515 (924)
T ss_pred             ccccccccceEEEeccccCChHHHHHhcCCCCCCcchhhhhhhhHhhcccccCeEEEEecCeeeeeeecccCCcchhhee
Confidence            77676667899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCHhhHHHHhcccCCCCCcEEEEecChhhHHhhhh-CCCCcccccChhhHHHHHhhcCCCCHHHHHHhccCCCchHHHH
Q 002521          631 WISQASARQRRGRAGRVQPGQCYHLYPRCVYEAFAE-YQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEPLAVQ  709 (913)
Q Consensus       631 ~iSka~~~QR~GRAGR~~~G~c~~L~t~~~~~~l~~-~~~pEi~r~~L~~~~L~lk~l~~~~~~~fl~~~l~pP~~~~i~  709 (913)
                      |+|++++.||+|||||+++|.||+||++..|+.+.. +++|||+|.+|+++||++|.++.+++..||+.+++||+..++.
T Consensus       516 wvSkAna~QR~GRAGRv~~G~cy~L~~~~~~~~~~~~~q~PEilR~pL~~l~L~iK~l~~~~~~~fLskaldpP~~~~v~  595 (924)
T KOG0920|consen  516 WVSKANAKQRRGRAGRVRPGICYHLYTRSRYEKLMLAYQLPEILRTPLEELCLHIKVLEQGSIKAFLSKALDPPPADAVD  595 (924)
T ss_pred             eccccchHHhcccccCccCCeeEEeechhhhhhcccccCChHHHhChHHHhhheeeeccCCCHHHHHHHhcCCCChHHHH
Confidence            999999999999999999999999999999999887 9999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCCCCCcccccccccccCCChHHHHHHHHhhhccChHHHHHHHhhccCCCCCcCChhhHHHHHHHhccc
Q 002521          710 NAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSGLSVRDPFLLPQEKKNLAEIAKSRF  789 (913)
Q Consensus       710 ~al~~L~~~gald~~~~lT~lG~~ls~lpl~p~~~k~ll~~~~~~cl~~~l~i~a~ls~~~~f~~p~~~~~~~~~~~~~~  789 (913)
                      .|++.|..+|||+.+++||+||++++.||+||++|||+++|++|+|+||+++|||+|++++||+.|.++++.+++++..|
T Consensus       596 ~a~~~L~~igaL~~~e~LT~LG~~la~lPvd~~igK~ll~g~if~cLdp~l~iaa~Ls~k~PF~~~~~~~~~~~~~~~~~  675 (924)
T KOG0920|consen  596 LAIERLKQIGALDESEELTPLGLHLASLPVDVRIGKLLLFGAIFGCLDPALTIAAALSFKSPFVSPLGKREEADKAKKLL  675 (924)
T ss_pred             HHHHHHHHhccccCcccchHHHHHHHhCCCccccchhheehhhccccchhhhHHHHhccCCCcccCCCchhHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCChhhHHHHHHHHHHHHHHhhc--CCcHHHHHHhccChhhHHHHHHHHHHHHHHHHHcCCCCCC-------CCCCCCC
Q 002521          790 SAKDYSDHMALVRAYEGWKDAERE--GSGYEYCWRNFLSAQTLQAIHSLRKQFTFILRDAGLLDED-------GGNNKLS  860 (913)
Q Consensus       790 ~~~~~sDhl~ll~af~~w~~~~~~--~~~~~~c~~~~l~~~~l~~~~~~r~ql~~~l~~~~l~~~~-------~~~~~~s  860 (913)
                      +.+..|||||+++||++|++....  ...++||++||||..+|+++..+|.|+...|.+.|++..+       ..+|.++
T Consensus       676 ~~~~~SD~la~~~ay~~w~~~~~~~~~~~~~fc~~~fLs~~~l~~i~~l~~q~~~~l~~~g~~~~~~~~~~~~~~~n~~s  755 (924)
T KOG0920|consen  676 ALDSISDHLAVVRAYAGWREILRSGPSAEKDFCEENFLSSNTLQEISSLRVQFLELLSDIGLIPISSTAALTDSECNHNS  755 (924)
T ss_pred             ccCCcchHHHHHHHHHHHHHHHhccchHHHHHHHHhhccHHHHHHHHHHHHHHHHHhhhcccccCCcccccCchhhhhcC
Confidence            877789999999999999998876  4678999999999999999999999999999999998753       5678889


Q ss_pred             CCHHHHHHHHHHhcccccccccc---cCCcccEEeecCCeEEEcCCCccCcCC
Q 002521          861 HNQSLVRAVICSGLFPGITSVVH---RETSMSFKTMDDGQVFLYAVSVQVIVS  910 (913)
Q Consensus       861 ~~~~li~~~l~aGl~pnva~~~~---~~~~~~y~t~~~~~v~iHPsSv~~~~~  910 (913)
                      .++++++++||||||||++.+..   ..+...|.|..+++|+|||+|||.+..
T Consensus       756 ~~~~~iravl~a~lyP~i~~~~~~~~~~~~~~~~~~~~~~v~i~~~sv~~~~~  808 (924)
T KOG0920|consen  756 QNPELVRAVLCAGLYPNIAFVRRMEPKSKSVTFVTKADGRVIIHPSSVNEQST  808 (924)
T ss_pred             CCHHHHHHHHhccCCCceeeeecccCCcCcceeecCCceeEEEecchhhcccc
Confidence            99999999999999999999875   555667888888999999999998654

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>smart00847 HA2 Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO)	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF)	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PF05894 Podovirus_Gp16: Podovirus DNA encapsidation protein (Gp16); InterPro: IPR008784 This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PHA00149 DNA encapsidation protein	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		913
3kx2_B		767	Crystal Structure Of Prp43p In Complex With Adp Len		1e-77
2xau_A		773	Crystal Structure Of The Prp43p Deah-Box Rna Helica		1e-77
3llm_A		235	Crystal Structure Analysis Of A Rna Helicase Length		1e-41
3i4u_A		270	Crystal Structure Analysis Of A Helicase Associated		2e-20

>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767

Back alignment and structure

Iteration: 1

Score = 288 bits (736), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 203/678 (29%), Positives = 324/678 (47%), Gaps = 90/678 (13%) Query: 236 SPEGNKMLDFRKSLPSFKEKERLLQAIARNQVIVISGETGCGKTTQLPQYILESEIESGR 295 +P+ +L R+ LP +++ L+ NQ++V GETG GKTTQ+PQ++L E+ Sbjct: 80 TPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLE 139 Query: 296 GAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMKGKNTHLLFCTSGILL 355 + CTQPRR++AM+V++RV+ E LGE VGY +R E T L + T G+LL Sbjct: 140 N--TQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLL 197 Query: 356 RRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVXXXXXXXXXXXXXXXMSATLNAELFSN 415 R + DH+L+ + + +DE HER + D L+ + MSATL+AE F Sbjct: 198 REAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQR 257 Query: 416 YFGGAPTIHIPGFTYPVQAH----FLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLP 471 YF AP + +PG TYPV+ + F D L+ + ++ ++ G L+ T Sbjct: 258 YFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGED--- 314 Query: 472 RKRKNQITALVEDALHKSNFENYSSRARDSLASWTADCIGFNLIEAVLCHICRKECPGAV 531 +EDA+ K + E + R+E G + Sbjct: 315 ---------EIEDAVRKISLEG--------------------------DQLVREEGCGPL 339 Query: 532 LVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNI-----R 586 V+ PL +GS+P +Q+ IFE AP + R Sbjct: 340 SVY-----------------PL------------YGSLPPHQQQRIFEPAPESHNGRPGR 370 Query: 587 KIVLATNMAEASITINDIVFVVDCGKAKETTYDALNNTPCLLPSWIXXXXXXXXXXXXXX 646 K+V++TN+AE S+TI+ IV+VVD G +K+ Y+ LL S I Sbjct: 371 KVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGR 430 Query: 647 VQPGQCYHLYPRCVYEA-FAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEP 705 +PG+C+ LY ++ E PE+LR+ L+S L++K L + + F + PP P Sbjct: 431 TRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHF--DFMDPPAP 488 Query: 706 LAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSG 765 + A++ L + LD++ NLT LG+ S P+DP L ML+ F+C +LTIV+ Sbjct: 489 ETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAM 548 Query: 766 LSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSG-YEYCWRNF 824 LSV + F+ P + K A+ AK+ F+ D DH+ L+ Y +K E G +++C ++ Sbjct: 549 LSVPNVFIRPTKDKKRADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHY 607 Query: 825 LSAQTLQAIHSLRKQFTFILR--DAGLLDEDGGNNKLSHNQSLVRAVICSGLFPGITSVV 882 L+ ++L A ++R Q ++ + L D + K N +R + SG F + Sbjct: 608 LNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDN---IRKALASGFFMQVAK-- 662 Query: 883 HRETSMSFKTMDDGQVFL 900 R + + T+ D Q L Sbjct: 663 KRSGAKGYITVKDNQDVL 680

PyMOL of 3kx2

>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773

Back alignment and structure

>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235

Back alignment and structure

>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		913
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	1e-114
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	4e-98
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	1e-73
3i4u_A		270	ATP-dependent RNA helicase DHX8; splicing, ATP-bin	1e-38
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	2e-34
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	4e-27
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	2e-34
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	7e-27
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	1e-32
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	3e-29
1yks_A		440	Genome polyprotein [contains: flavivirin protease	5e-32
1yks_A		440	Genome polyprotein [contains: flavivirin protease	1e-24
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	7e-32
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	6e-29
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	8e-30
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	7e-28
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	4e-27
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	5e-25
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	8e-06
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	2e-04
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	2e-04

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235	Back alignment and structure

 Score =  348 bits (895), Expect = e-114
 Identities = 92/222 (41%), Positives = 150/222 (67%), Gaps = 4/222 (1%)

Query: 206 TDSFLDGSVMEKVLQRRSLQMRN-MQRAWQESPEGNKMLDFRKSLPSFKEKERLLQAIAR 264
           + +  +G +     ++ S+ ++N +    ++  +   +L  R+ LP  K +  +L+AI++
Sbjct: 16  SSNIDEGPLAFATPEQISMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQ 75

Query: 265 NQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGE 324
           N V++I G TGCGKTTQ+PQ+IL+  I++ R A CNI+ TQPRRISA++V+ERV+ ERGE
Sbjct: 76  NSVVIIRGATGCGKTTQVPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGE 135

Query: 325 PLGETVGYKVRLEGMKGK-NTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNED 383
             G++ GY VR E +  + +  ++FCT G+LLR+L  +  + G++HV VDEIHER +N D
Sbjct: 136 EPGKSCGYSVRFESILPRPHASIMFCTVGVLLRKL--EAGIRGISHVIVDEIHERDINTD 193

Query: 384 FLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGAPTIHI 425
           FLL+VL+D++    ++R++LMSAT++  +F  YF   P I +
Sbjct: 194 FLLVVLRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCPIIEV 235

PyMOL of 3llm

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773	Back alignment and structure

>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		913
d1yksa2		299	c.37.1.14 (A:325-623) YFV helicase domain {Yellow	4e-29
d1a1va1		136	c.37.1.14 (A:190-325) HCV helicase domain {Human h	2e-23
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	6e-23
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	1e-15
d1yksa1		140	c.37.1.14 (A:185-324) YFV helicase domain {Yellow	6e-15
d1hv8a1		208	c.37.1.19 (A:3-210) Putative DEAD box RNA helicase	3e-04
d1gkub1		237	c.37.1.16 (B:1-250) Helicase-like "domain" of reve	3e-04
d1wp9a2		286	c.37.1.19 (A:201-486) putative ATP-dependent RNA h	0.002
d2p6ra3		202	c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus	0.002

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  116 bits (291), Expect = 4e-29
 Identities = 45/305 (14%), Positives = 78/305 (25%), Gaps = 45/305 (14%)

Query: 528 PGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEKAPPNIRK 587
                 F+      + +   L+          V++L  +      E              
Sbjct: 36  KRPTAWFLPSIRAANVMAASLRKAGK-----SVVVL--NRKTFEREY----PTIKQKKPD 84

Query: 588 IVLATNMAEASITINDIVFVVDCGKA-KETTYDALNNTPCLLPSWISQASARQRRGRAGR 646
            +LAT++AE    +  +  V+DC  A K    D         P  IS +SA QRRGR GR
Sbjct: 85  FILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGR 143

Query: 647 VQPGQ-CYHLYPRCVYEAFAEYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPEP 705
                   + Y     E  A +         L+++ ++   +      E           
Sbjct: 144 NPNRDGDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEG--TKTPVSPG 201

Query: 706 LAVQNAVDFLKRIGALDEKENLTNLGKFLSMLPVDPKLGKMLVMGAIFRCFDPVLTIVSG 765
                          +   +    L   ++   +     K    G               
Sbjct: 202 EMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTNDRKWCFEG--------------- 246

Query: 766 LSVRDPFLLPQEKKNLAEIAKSRFSAKDYSDHMALVRAYEGWKDAEREGSGYEYCWRNFL 825
                    P+E + L +  ++            L      W D  R  S        F+
Sbjct: 247 ---------PEEHEILNDSGETVKCRAPGGAKKPL---RPRWCDE-RVSSDQS-ALSEFI 292

Query: 826 SAQTL 830
                
Sbjct: 293 KFAEG 297

PyMOL of d1yksa2

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		913
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	100.0
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	99.97
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	99.91
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	99.91
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	99.91
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	99.9
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	99.9
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	99.9
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	99.9
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.9
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	99.89
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.89
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.88
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	99.88
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	99.88
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	99.88
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	99.88
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	99.87
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.87
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.87
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	99.86
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.86
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.85
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.81
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.8
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.8
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.79
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.78
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	99.76
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	99.76
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	99.74
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	99.73
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	99.72
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	99.7
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.69
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.69
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.59
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	99.56
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.19
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.05
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.98
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.85
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	98.77
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	98.5
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	98.16
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	98.15
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	98.06
d1okkd2		207	GTPase domain of the signal recognition particle r	98.01
d2qy9a2		211	GTPase domain of the signal recognition particle r	97.94
d1ls1a2		207	GTPase domain of the signal sequence recognition p	97.85
d1vmaa2		213	GTPase domain of the signal recognition particle r	97.84
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	97.73
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	97.51
d1j8yf2		211	GTPase domain of the signal sequence recognition p	97.47
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	97.45
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	97.05
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	96.99
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	96.74
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	96.44
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	96.34
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	96.24
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	96.0
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	95.95
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	95.86
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	95.83
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	95.61
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	95.56
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.44
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	94.92
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	94.68
d1xx6a1		141	Thymidine kinase, TK1, N-terminal domain {Clostrid	94.62
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	94.61
d1w36b1		485	Exodeoxyribonuclease V beta chain (RecB), N-termin	94.54
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	94.32
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	93.97
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	93.83
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	93.58
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	93.22
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	93.01
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	92.97
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	92.94
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	92.88
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	92.88
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	92.86
d1xbta1		133	Thymidine kinase, TK1, N-terminal domain {Human (H	92.28
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	92.26
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	91.97
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	91.83
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	91.82
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	91.72
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	91.67
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	91.58
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	91.45
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	91.39
d1d0xa2		712	Myosin S1, motor domain {Dictyostelium discoideum	91.34
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	91.33
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	91.33
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	91.22
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	91.22
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	91.2
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	91.09
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	90.92
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	90.77
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	90.72
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	90.58
d1br2a2		710	Myosin S1, motor domain {Chicken (Gallus gallus),	90.55
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	90.38
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	90.35
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	90.28
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	90.28
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	90.12
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	90.07
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	90.01
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	89.97
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	89.96
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	89.88
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	89.82
d2mysa2		794	Myosin S1, motor domain {Chicken (Gallus gallus),	89.82
d1lkxa_		684	Myosin S1, motor domain {Dictyostelium discoideum,	89.76
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	89.41
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	89.41
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	89.36
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	89.19
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	89.12
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	89.09
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	89.04
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	89.03
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	89.0
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	88.97
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	88.97
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	88.82
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	88.7
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	88.63
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	88.53
d1w7ja2		730	Myosin S1, motor domain {Chicken (Gallus gallus),	88.49
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	88.38
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	88.34
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	88.12
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	87.91
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	87.84
d1kk8a2		789	Myosin S1, motor domain {Bay scallop (Aequipecten	87.44
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	87.43
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	87.0
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	86.98
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	86.92
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	86.92
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	86.9
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	86.89
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	86.58
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	86.55
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	86.48
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	86.32
d2awna2		232	Maltose transport protein MalK, N-terminal domain	86.26
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	86.25
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	85.98
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	85.93
d1g2912		240	Maltose transport protein MalK, N-terminal domain	85.81
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	85.54
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	85.51
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	85.45
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	84.91
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	84.64
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	84.52
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	84.15
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	84.14
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	84.12
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	83.85
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	83.81
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	82.76
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	82.71
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	82.6
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	82.59
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	82.41
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	82.38
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	82.22
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	82.11
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	80.85
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	80.69
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	80.45
d1msza_		62	SmuBP-2 {Human (Homo sapiens) [TaxId: 9606]}	80.2
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	80.09

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=100.00  E-value=7.4e-42  Score=272.57  Aligned_cols=294  Identities=17%  Similarity=0.153  Sum_probs=207.3

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
Q ss_conf             99919919999279703896999999999998189982299975104989999999999882998662761377214557
Q 002521          261 AIARNQVIVISGETGCGKTTQLPQYILESEIESGRGAFCNIICTQPRRISAMAVSERVSAERGEPLGETVGYKVRLEGMK  340 (913)
Q Consensus       261 ~i~~~~~viI~a~TGSGKTt~~~~~ile~~~~~~~g~~~~Ilvt~P~r~lA~qia~ri~~e~~~~~g~~vGy~vr~e~~~  340 (913)
                      .+.+++++++.||||||||++++.++++.....  +.  ++++++|+|+||.|++++++....    ...++.  .+...
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~--~~--~~lvi~Ptr~La~q~~~~l~~~~~----~~~~~~--~~~~~   74 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKR--GL--RTLILAPTRVVAAEMEEALRGLPI----RYQTPA--IRAEH   74 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHHH--TC--CEEEEESSHHHHHHHHHHTTTSCC----BCCC---------
T ss_pred             HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--CC--EEEEECCHHHHHHHHHHHHHCCCC----CEEEEE--EEECC
T ss_conf             864699499997999978799999999998726--99--899982389999999999854875----211137--85012


Q ss_pred             CCCCEEEEEECHHHHHHHHCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCC
Q ss_conf             99830999800788999805999998319995364446741479999999867568665189804446888897361999
Q 002521          341 GKNTHLLFCTSGILLRRLLSDHNLNGVTHVFVDEIHERGMNEDFLLIVLKDLLPRRRDLRLILMSATLNAELFSNYFGGA  420 (913)
Q Consensus       341 ~~~~~Iiv~T~g~Ll~~l~~~~~L~~~~~IIIDEaHer~~~~d~ll~~lk~ll~~~~~~kiIlmSATl~~~~~~~yf~~~  420 (913)
                      +..+.|+++|++.|...+..+..+.++++|||||+|...........+++.... ++..++++||||++....       
T Consensus        75 ~~~~~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~-~~~~~~v~~SAT~~~~~~-------  146 (305)
T d2bmfa2          75 TGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVE-MGEAAGIFMTATPPGSRD-------  146 (305)
T ss_dssp             -CCCSEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHH-HTSCEEEEECSSCTTCCC-------
T ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHC-CCCCEEEEEECCCCCCEE-------
T ss_conf             576530137748999998458531540089853011125205788899998416-653138994157876433-------


Q ss_pred             CEECCCCCCCCCEEEEHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             95504894025135650447864104445666454114566777764211123454589999999720244555324442
Q 002521          421 PTIHIPGFTYPVQAHFLEDVLEMTGYKLTSLNQVDDYGQEKLWKTQRQLLPRKRKNQITALVEDALHKSNFENYSSRARD  500 (913)
Q Consensus       421 ~vi~i~~~~~pv~~~yl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~v~~~l~~~~~~~~~~~~~~  500 (913)
                         .......|+......-         .      .               .                 .          
T Consensus       147 ---~~~~~~~~~~~~~~~~---------~------~---------------~-----------------~----------  166 (305)
T d2bmfa2         147 ---PFPQSNAPIMDEEREI---------P------E---------------R-----------------S----------  166 (305)
T ss_dssp             ---SSCCCSSCEEEEECCC---------C------C---------------S-----------------C----------
T ss_pred             ---EECCCCCCCEEEEEEC---------C------H---------------H-----------------H----------
T ss_conf             ---4023478612799861---------5------8---------------8-----------------8----------


Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCHHHHHHHHCC
Q ss_conf             10012223233234999999886306999699982996799999999974999899997189980389995889988400
Q 002521          501 SLASWTADCIGFNLIEAVLCHICRKECPGAVLVFMTGWEDISCLRDQLKSHPLLGDPNRVLLLTCHGSMPTSEQKFIFEK  580 (913)
Q Consensus       501 ~l~~~~~~~~~~~li~~ll~~i~~~~~~g~iLVFl~~~~~i~~l~~~L~~~~~~~~~~~~~v~~lHs~l~~~er~~v~~~  580 (913)
                             ....       ...  ....++++||||+++++++.+++.|...       ++.+..+||++....    ...
T Consensus       167 -------~~~~-------~~~--~~~~~~~~lvf~~~~~~~~~l~~~L~~~-------~~~~~~l~~~~~~~~----~~~  219 (305)
T d2bmfa2         167 -------WNSG-------HEW--VTDFKGKTVWFVPSIKAGNDIAACLRKN-------GKKVIQLSRKTFDSE----YIK  219 (305)
T ss_dssp             -------CSSC-------CHH--HHSSCSCEEEECSCHHHHHHHHHHHHHH-------TCCCEECCTTCHHHH----GGG
T ss_pred             -------HHHH-------HHH--HHHHCCCEEEEECCHHHHHHHHHHHHHC-------CCCEEEECCCCHHHH----HHH
T ss_conf             -------9999-------999--9960799899963099999999999867-------998999578384777----754


Q ss_pred             CCCCCCEEEEECCHHHHCCCCCCEEEEEECCCCCC--EEECCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCE-EEEECC
Q ss_conf             89996279996102220477798679993899862--110489997767752047842997711049999938-999257
Q 002521          581 APPNIRKIVLATNMAEASITINDIVFVVDCGKAKE--TTYDALNNTPCLLPSWISQASARQRRGRAGRVQPGQ-CYHLYP  657 (913)
Q Consensus       581 f~~g~~kVIvATniae~GIdIP~V~~VId~g~~k~--~~yd~~~~~~~l~~~~iS~a~~~QR~GRAGR~~~G~-c~~L~s  657 (913)
                      +++|.+++++||+++++|+|+ +++.|||+|....  ..||+..+...+...++|.++|.||+|||||.+.|. ...+|.
T Consensus       220 ~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~  298 (305)
T d2bmfa2         220 TRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYM  298 (305)
T ss_dssp             GGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEEC
T ss_pred             HHCCCHHHHHHHHHHHHCCCC-CCCEEEECCCCEEEEEECCCCCCEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEEEC
T ss_conf             310001135556788725788-8408997587414657338987638804456998898324118682899926999989


Q ss_pred             HHH
Q ss_conf             525
Q 002521          658 RCV  660 (913)
Q Consensus       658 ~~~  660 (913)
                      .+.
T Consensus       299 ~~~  301 (305)
T d2bmfa2         299 GEP  301 (305)
T ss_dssp             SCC
T ss_pred             CCC
T ss_conf             988

PyMOL of d2bmfa2

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}	Back information, alignment and structure

>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1msza_ d.68.7.1 (A:) SmuBP-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure