Citrus Sinensis ID: 002641
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 897 | ||||||
| 147852653 | 1618 | hypothetical protein VITISV_002973 [Viti | 0.981 | 0.543 | 0.651 | 0.0 | |
| 297738795 | 1154 | unnamed protein product [Vitis vinifera] | 0.862 | 0.670 | 0.737 | 0.0 | |
| 357520957 | 1068 | U-box domain-containing protein [Medicag | 0.885 | 0.743 | 0.623 | 0.0 | |
| 356511369 | 1421 | PREDICTED: uncharacterized protein LOC10 | 0.847 | 0.534 | 0.621 | 0.0 | |
| 356527773 | 1492 | PREDICTED: uncharacterized protein LOC10 | 0.836 | 0.502 | 0.625 | 0.0 | |
| 449449627 | 1336 | PREDICTED: putative E3 ubiquitin-protein | 0.895 | 0.601 | 0.569 | 0.0 | |
| 326507154 | 1375 | predicted protein [Hordeum vulgare subsp | 0.806 | 0.525 | 0.529 | 0.0 | |
| 357127715 | 1418 | PREDICTED: uncharacterized protein LOC10 | 0.800 | 0.506 | 0.508 | 0.0 | |
| 242051493 | 1404 | hypothetical protein SORBIDRAFT_03g00087 | 0.809 | 0.517 | 0.492 | 0.0 | |
| 255546423 | 1268 | F-box and wd40 domain protein, putative | 0.570 | 0.403 | 0.735 | 0.0 |
| >gi|147852653|emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1174 bits (3036), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 612/939 (65%), Positives = 728/939 (77%), Gaps = 59/939 (6%)
Query: 2 RDDVSVVVPCAKLLSKMSGSQASELKELERNYEELLDENCRVFASYFKQVLENSNDSGLI 61
R + SVVV +LLSKMSG Q SELK LER+YEE+LDENCR+ YF++VL N N S LI
Sbjct: 471 RFEESVVVSGTRLLSKMSGGQTSELKXLERDYEEVLDENCRLLVGYFREVLGNENGSRLI 530
Query: 62 IVTPPSVVLRKIEKVGGLHFDSEIESSLDK------HLNNSSYSSSDSDAE--ATDEQKN 113
PPS++ K K F+ + ++ +++ NN +++ + E ++
Sbjct: 531 --RPPSLIFEKXRKSDEFKFNEDEQNKVEEIGLGNGRYNNPTWTEGERSVEFYSSGSSSK 588
Query: 114 IRMASLEPRQ---RQIRKQKQP-----------------------------------IFV 135
+ P++ + +R QK I++
Sbjct: 589 SKSPPFYPQRVSLKILRNQKSSRTLSAISXNLNSGSELESSSEDNLSNSSSESEGSYIWI 648
Query: 136 ESSCSPDHLIM-ADADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWI 194
S +M AD+D+PPG GK TPPKDF+CPIT+HIFDDPVTLETGQTYER+AIQEWI
Sbjct: 649 FPVISSPERVMAADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWI 708
Query: 195 ERGNSSCPITRQKLSSTKLPKTNYVLKRLIASWQEQNPGGLDLSHSEPMSKS-------- 246
+RGNS+CPITRQKL ST+LPKTNYVLKRLIASWQEQNPG + + P ++
Sbjct: 709 DRGNSTCPITRQKLHSTQLPKTNYVLKRLIASWQEQNPGFISIHSDNPDPETDPIFNSTL 768
Query: 247 -IVPSNSPNSV-ISQATIDGTITELKHAITSLCMSEILNESEMAVLQIERCWLEASMELD 304
++PS SPNSV ISQAT+DGTI EL+ AIT LCMSEIL ESE AVL+IER W E +M L+
Sbjct: 769 PVLPSTSPNSVIISQATMDGTICELRLAITKLCMSEILRESEKAVLRIERFWQEMNMGLE 828
Query: 305 IQIMLSKPAVINGFVEILFNSVDPRVLEATIFLLSELGSRDKSVIHTLTRVESDVERIVA 364
IQ MLSKPAVINGFVEILFNSVDPRVL AT+FLL ELGSRDK+VI TLTRV+SDVE IVA
Sbjct: 829 IQTMLSKPAVINGFVEILFNSVDPRVLRATVFLLCELGSRDKTVIQTLTRVDSDVECIVA 888
Query: 365 LFKKGLLEAVVLIDLLRPSTRTLIEMDMMESLMTVIKKKEEDFLKMCLKPKSVSVLLLGQ 424
LFK GLLEAVVLI LLRPST +LIEMDM+ESL+ VIKKK++ FL+MCLKPK+ S+LLLGQ
Sbjct: 889 LFKNGLLEAVVLIHLLRPSTISLIEMDMVESLLVVIKKKQDGFLEMCLKPKTASILLLGQ 948
Query: 425 MIGDSEESIVSSIANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQEDGKCRNSIA 484
++G SE +IV+SIA T+VS+K +S++ SLEAEWAEERIAAVGILLRCMQEDGKCR++IA
Sbjct: 949 ILGSSEGNIVTSIAKTVVSAKAIKSIVESLEAEWAEERIAAVGILLRCMQEDGKCRHTIA 1008
Query: 485 DKAELAPVMESFMAASDGERFEIVCFLSELVKLNRRTFNEQILHIIKDEGTYSSMHTLLV 544
DKAELAPV+ESFM ASDGERFEI+ F SELVKLNRRTFNEQ+LHIIKDEG +S+MHTLL+
Sbjct: 1009 DKAELAPVLESFMGASDGERFEIINFFSELVKLNRRTFNEQVLHIIKDEGAFSTMHTLLI 1068
Query: 545 YLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREEAIDTLISCLRNSDYPAAQLAAAKTI 604
YLQTA DQCPVVAGLLLQLDLL EPRKMSIYREEA+DTLISCLRNSD+PAAQ+AAA+TI
Sbjct: 1069 YLQTALQDQCPVVAGLLLQLDLLVEPRKMSIYREEAMDTLISCLRNSDFPAAQIAAAETI 1128
Query: 605 VSLQGRFTTSGKSLTRAMLLKRAGVGKSYKNLTRTEQIGNICGEDDDTSEEEKAADDWER 664
VSLQGRF++SGKSLTRA LLKRAG+ KSY+ L + +Q+ N GE ++ EEE+AAD+WER
Sbjct: 1129 VSLQGRFSSSGKSLTRASLLKRAGLDKSYRTLMQVDQLSNSSGESEENLEEEQAADEWER 1188
Query: 665 KMALVLVSHDFGLLFEALEEGLNSRFAELYSACFESATWLIYMLNFLPDTGIFGAARVSL 724
KMA VLVSH+FGLLFEAL EGL SR EL+S+CF SATWLI+ML LPDTGI GAARV L
Sbjct: 1189 KMAFVLVSHEFGLLFEALAEGLRSRNQELFSSCFMSATWLIHMLTVLPDTGIRGAARVCL 1248
Query: 725 LKRFISAFKSANDIDDRALSLLALNSFAQDPQGLRDINIHMKDIMKGLRELRKYSPLAFE 784
LK FIS FKSA +++ALS+LAL+SF DP+GL D+ HMKDI+KGLR+L+K LA +
Sbjct: 1249 LKHFISMFKSAKGTEEKALSMLALSSFIHDPEGLNDLTSHMKDILKGLRQLKKSCILAVD 1308
Query: 785 MVKVLSNGHDSSADFWNHRELVHVDSSENGKVLSIACFRDKIFSGHSDGTIKVWTGRGSI 844
M+KV S G++SS D WNH+ELV VD S NG+VLSI CFRDKIFSGHSDGTIKVWTGRGSI
Sbjct: 1309 MLKVFSEGNNSSIDLWNHKELVQVDCSANGEVLSIVCFRDKIFSGHSDGTIKVWTGRGSI 1368
Query: 845 LHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVRS 883
LHLI + REHTKAVT LAIL+SGE LYSGSLD+TAR+ S
Sbjct: 1369 LHLIHETREHTKAVTSLAILESGERLYSGSLDRTARIWS 1407
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738795|emb|CBI28040.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357520957|ref|XP_003630767.1| U-box domain-containing protein [Medicago truncatula] gi|355524789|gb|AET05243.1| U-box domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356511369|ref|XP_003524399.1| PREDICTED: uncharacterized protein LOC100787950 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527773|ref|XP_003532482.1| PREDICTED: uncharacterized protein LOC100808867 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449449627|ref|XP_004142566.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|326507154|dbj|BAJ95654.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|357127715|ref|XP_003565524.1| PREDICTED: uncharacterized protein LOC100836629 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242051493|ref|XP_002454892.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor] gi|241926867|gb|EES00012.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|255546423|ref|XP_002514271.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223546727|gb|EEF48225.1| F-box and wd40 domain protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 897 | ||||||
| TAIR|locus:2013990 | 628 | AT1G71020 [Arabidopsis thalian | 0.332 | 0.474 | 0.270 | 6.4e-15 | |
| UNIPROTKB|Q0IMG9 | 694 | SPL11 "E3 ubiquitin-protein li | 0.113 | 0.146 | 0.421 | 7.1e-14 | |
| TAIR|locus:2017719 | 612 | AT1G23030 [Arabidopsis thalian | 0.406 | 0.596 | 0.25 | 3e-13 | |
| TAIR|locus:2075140 | 660 | PUB13 "plant U-box 13" [Arabid | 0.092 | 0.125 | 0.494 | 1.5e-12 | |
| UNIPROTKB|Q5VRH9 | 611 | PUB12 "U-box domain-containing | 0.112 | 0.165 | 0.405 | 3.6e-12 | |
| TAIR|locus:2082682 | 632 | PUB14 "plant U-box 14" [Arabid | 0.206 | 0.292 | 0.307 | 3.8e-12 | |
| TAIR|locus:2032472 | 771 | AT1G24330 [Arabidopsis thalian | 0.102 | 0.119 | 0.432 | 5.5e-12 | |
| TAIR|locus:2010424 | 768 | PUB45 "plant U-box 45" [Arabid | 0.186 | 0.217 | 0.311 | 8.6e-12 | |
| TAIR|locus:2012136 | 421 | PUB26 "plant U-box 26" [Arabid | 0.230 | 0.491 | 0.292 | 4e-11 | |
| TAIR|locus:2014584 | 811 | PUB43 "plant U-box 43" [Arabid | 0.333 | 0.368 | 0.236 | 4.2e-11 |
| TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 222 (83.2 bits), Expect = 6.4e-15, Sum P(2) = 6.4e-15
Identities = 92/340 (27%), Positives = 156/340 (45%)
Query: 159 TPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPKTNY 218
T P+DF+CPI+ + DP + TGQTYER IQ WI+ GN SCP T+QKL + L NY
Sbjct: 242 TIPEDFLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTP-NY 300
Query: 219 VLKRLIASWQEQNPGGLDLSHSEPMSKSIVPSNSPNSVISQATIDGTITELKHAITSLCM 278
VL+ LI+ W + H+ + + NS S + G ++ ++ + L
Sbjct: 301 VLRSLISQWCTK--------HNIEQPGGYMNGRTKNSDGSFRDLSGDMSAIRALVCKLS- 351
Query: 279 SEILNESEMAVLQIERCWLEASMELDIQIMLSKPAVINGFVEILFNSVDPRVLEATIFLL 338
S+ + + AV +I + D +I++++ I V++L + D E + +
Sbjct: 352 SQSIEDRRTAVSEIRSL---SKRSTDNRILIAEAGAIPVLVKLLTSDGDTETQENAVTCI 408
Query: 339 SELGSRDKSVIHTLTRVESDVERIVALFKKGLLEA-----VVLIDL-LRPSTRTLIE--- 389
L + + L + V IV + + G +EA L L L + +I
Sbjct: 409 LNLSIYEHN--KELIMLAGAVTSIVLVLRAGSMEARENAAATLFSLSLADENKIIIGASG 466
Query: 390 --MDMMESLM--TVIKKKEED--FLKMCL----KPKSVS---VLLLGQMIGDSEESIVSS 436
M +++ L +V KK+ +C+ K ++V V L +M+ DS ++
Sbjct: 467 AIMALVDLLQYGSVRGKKDAATALFNLCIYQGNKGRAVRAGIVKPLVKMLTDSSSERMAD 526
Query: 437 IANTIVSSKVFESVISSLEAEWAEERIAAVGILLRCMQED 476
A TI+S + S+ A+ A R A+ L+ C+Q+D
Sbjct: 527 EALTILSV-----LASNQVAKTAILRANAIPPLIDCLQKD 561
|
|
| UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032472 AT1G24330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010424 PUB45 "plant U-box 45" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012136 PUB26 "plant U-box 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014584 PUB43 "plant U-box 43" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016710001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (958 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 897 | |||
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 8e-20 | |
| pfam04564 | 73 | pfam04564, U-box, U-box domain | 4e-15 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 1e-10 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 1e-09 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 2e-07 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 9e-07 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 1e-05 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 1e-05 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 1e-04 | |
| smart00320 | 40 | smart00320, WD40, WD40 repeats | 2e-04 | |
| pfam11789 | 57 | pfam11789, zf-Nse, Zinc-finger of the MIZ type in | 3e-04 | |
| pfam00400 | 39 | pfam00400, WD40, WD domain, G-beta repeat | 6e-04 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.002 |
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
Score = 83.4 bits (207), Expect = 8e-20
Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 4/66 (6%)
Query: 163 DFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKL-PKTNYVLK 221
+F+CPI+ + DPV L +GQTYER AI++W+ + + P+T Q L+ L P N LK
Sbjct: 1 EFLCPISLEVMKDPVILPSGQTYERSAIEKWLLS-HGTDPVTGQPLTHEDLIP--NLALK 57
Query: 222 RLIASW 227
I W
Sbjct: 58 SAIQEW 63
|
Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63 |
| >gnl|CDD|203049 pfam04564, U-box, U-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|197651 smart00320, WD40, WD40 repeats | Back alignment and domain information |
|---|
| >gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit | Back alignment and domain information |
|---|
| >gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 897 | |||
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.79 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.76 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.76 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.73 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.72 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.72 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.71 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.7 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.68 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.68 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.66 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.66 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.65 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.65 | |
| PTZ00421 | 493 | coronin; Provisional | 99.65 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.65 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.64 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.63 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.63 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.62 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.62 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.61 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.6 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.6 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.6 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.57 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.57 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.57 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.57 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.57 | |
| PTZ00420 | 568 | coronin; Provisional | 99.57 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.56 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.56 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.56 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.53 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.53 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.52 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.5 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.5 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.49 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.49 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.49 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.48 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.48 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.48 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.47 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.46 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.46 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.44 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.44 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.44 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.43 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.43 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.43 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.43 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.43 | |
| PTZ00421 | 493 | coronin; Provisional | 99.42 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.42 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.42 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.42 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.41 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.4 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.39 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.39 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.38 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.38 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.37 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.37 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.37 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.37 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.37 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.36 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 99.35 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.35 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.35 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.34 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.34 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.34 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.33 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.32 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.31 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.31 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.31 | |
| PTZ00420 | 568 | coronin; Provisional | 99.31 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.31 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.29 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.28 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.28 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.28 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.27 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.27 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.27 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.27 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.26 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.26 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.26 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.24 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.24 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 99.22 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.22 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.21 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.21 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.21 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.2 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.19 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 99.18 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 99.18 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.17 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.17 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.17 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.17 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.15 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.14 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.14 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 99.13 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.13 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 99.12 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.12 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.11 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 99.1 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.1 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 99.1 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.07 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.06 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 99.06 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 99.06 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 99.06 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.05 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.04 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 99.04 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 99.03 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.02 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 99.01 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.0 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.99 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 98.99 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 98.98 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 98.95 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 98.93 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 98.93 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 98.93 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 98.93 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.92 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 98.92 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 98.9 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 98.9 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.89 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 98.89 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 98.88 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.88 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 98.88 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.87 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 98.84 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.82 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 98.79 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 98.79 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 98.76 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 98.75 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.74 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 98.74 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.73 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.72 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 98.71 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 98.7 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 98.7 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 98.68 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 98.67 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 98.65 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.65 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 98.65 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.64 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 98.63 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.61 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 98.59 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 98.59 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 98.58 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.58 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 98.58 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 98.57 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 98.56 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 98.55 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.54 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 98.54 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.54 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 98.53 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 98.53 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.52 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.52 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.52 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 98.5 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.48 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.47 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.46 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 98.44 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 98.44 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.43 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 98.42 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 98.42 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.41 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.4 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 98.4 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 98.38 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.38 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 98.37 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.36 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 98.34 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.32 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 98.32 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.3 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.29 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.28 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 98.25 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.25 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 98.25 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 98.24 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 98.22 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.22 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 98.21 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.21 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 98.2 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 98.19 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 98.19 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.19 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 98.17 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 98.16 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.15 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.15 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 98.11 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.1 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 98.09 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.09 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.08 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 98.05 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 98.03 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.03 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.02 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 98.02 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.02 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.0 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 97.99 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 97.98 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 97.93 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 97.87 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.86 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 97.84 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 97.83 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 97.82 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 97.82 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 97.81 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 97.81 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 97.81 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.8 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 97.79 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 97.79 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 97.78 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 97.77 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 97.76 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 97.75 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 97.72 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.72 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 97.71 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 97.67 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 97.67 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 97.63 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.62 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 97.6 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.55 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 97.55 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.54 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 97.53 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 97.51 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 97.48 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 97.47 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.44 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.44 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.42 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.41 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.38 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 97.35 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 97.34 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 97.34 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 97.34 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 97.32 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 97.25 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 97.22 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.21 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 97.2 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 97.19 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 97.18 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 97.17 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 97.17 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 97.17 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.16 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.14 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 97.13 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.13 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 97.12 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 97.12 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 97.01 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 96.99 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.96 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 96.93 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.91 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 96.91 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 96.9 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.9 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 96.85 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 96.81 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 96.75 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 96.72 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 96.69 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 96.68 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.67 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.6 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 96.55 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 96.52 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 96.43 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 96.39 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 96.34 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.33 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 96.29 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 96.25 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 96.21 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 96.18 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 96.16 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 96.11 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 96.0 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.99 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 95.96 | |
| KOG2042 | 943 | consensus Ubiquitin fusion degradation protein-2 [ | 95.95 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.89 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 95.87 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 95.84 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.82 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 95.77 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 95.77 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 95.68 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 95.6 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 95.59 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 95.5 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 95.49 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.48 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 95.44 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 95.41 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.38 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 95.37 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 95.24 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.21 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.94 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.85 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 94.56 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 94.54 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 94.32 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 94.26 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 94.21 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.13 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 94.12 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.06 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 94.02 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 93.8 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.78 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 93.71 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 93.7 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 93.66 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.66 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 93.66 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 93.62 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 93.6 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.52 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.49 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 93.43 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 93.43 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.24 | |
| COG5113 | 929 | UFD2 Ubiquitin fusion degradation protein 2 [Postt | 92.94 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 92.93 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 92.83 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 92.82 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 92.72 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 92.65 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.51 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 92.49 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 92.44 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 92.36 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 92.19 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 92.03 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 91.84 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 91.81 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 91.66 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.16 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 90.99 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.91 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 90.82 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 90.79 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 90.72 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 90.71 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 90.52 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 90.49 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 90.45 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 90.34 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 90.25 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 90.22 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 90.14 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 89.83 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 89.81 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 89.81 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 89.71 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 89.58 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 89.27 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 89.21 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 88.99 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 88.96 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 88.95 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 88.57 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 87.71 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 87.38 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 87.18 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 86.87 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 86.1 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 85.66 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 85.64 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 85.49 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 84.96 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 84.62 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 84.18 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 84.12 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 83.81 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.54 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 83.53 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 82.93 | |
| KOG1916 | 1283 | consensus Nuclear protein, contains WD40 repeats [ | 82.49 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 82.34 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 82.15 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 82.06 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 81.93 | |
| KOG0314 | 448 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.85 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.57 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 81.56 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 80.86 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 80.69 |
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
Probab=99.79 E-value=2.5e-19 Score=206.28 Aligned_cols=137 Identities=18% Similarity=0.216 Sum_probs=126.0
Q ss_pred CCCCCceeeee--------cccccccceeEeeecccccEEEEecCCCCeEEEeCC--cceeeccCCCCcEEEEEEeCC--
Q 002641 757 GLRDINIHMKD--------IMKGLRELRKYSPLAFEMVKVLSNGHDSSADFWNHR--ELVHVDSSENGKVLSIACFRD-- 824 (897)
Q Consensus 757 ~~~~~~~~i~~--------~l~~~~~~~~~~~~s~d~~~LaSgs~DgtIklWd~~--~~l~~l~gH~~~V~sV~fspd-- 824 (897)
+..|.+.++|. +++||...++.+.|+|.|.|+||+|.|++.++|... ..++.+.||.+.|.|+.|+|+
T Consensus 469 cSED~svRLWsl~t~s~~V~y~GH~~PVwdV~F~P~GyYFatas~D~tArLWs~d~~~PlRifaghlsDV~cv~FHPNs~ 548 (707)
T KOG0263|consen 469 CSEDSSVRLWSLDTWSCLVIYKGHLAPVWDVQFAPRGYYFATASHDQTARLWSTDHNKPLRIFAGHLSDVDCVSFHPNSN 548 (707)
T ss_pred ccCCcceeeeecccceeEEEecCCCcceeeEEecCCceEEEecCCCceeeeeecccCCchhhhcccccccceEEECCccc
Confidence 45677788884 467999999999999999999999999999999987 899999999999999999997
Q ss_pred EEEEEecCCeEEEEeCCCCcceeEEEeeccCCCeEEEEEccCCCEEEEEeCCCcEEEEeCCCc-cceeeecc
Q 002641 825 KIFSGHSDGTIKVWTGRGSILHLIQQIREHTKAVTGLAILQSGEMLYSGSLDKTARVRSNDSF-TYAIFIQV 895 (897)
Q Consensus 825 ~L~Sgs~DgtIrlWd~~~~~~~~i~~l~gH~~~V~slafspdg~~L~SgS~D~tIrlWdi~~~-~l~~l~~~ 895 (897)
++++||.|.|||+||+.++ ..++.|.||+++|++++|||+|++|+||+.|+.|++||+.+| .+..|+.+
T Consensus 549 Y~aTGSsD~tVRlWDv~~G--~~VRiF~GH~~~V~al~~Sp~Gr~LaSg~ed~~I~iWDl~~~~~v~~l~~H 618 (707)
T KOG0263|consen 549 YVATGSSDRTVRLWDVSTG--NSVRIFTGHKGPVTALAFSPCGRYLASGDEDGLIKIWDLANGSLVKQLKGH 618 (707)
T ss_pred ccccCCCCceEEEEEcCCC--cEEEEecCCCCceEEEEEcCCCceEeecccCCcEEEEEcCCCcchhhhhcc
Confidence 9999999999999999999 589999999999999999999999999999999999999998 66555543
|
|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 897 | ||||
| 1t1h_A | 78 | Nmr Solution Structure Of The U Box Domain From Atp | 1e-13 |
| >pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 | Back alignment and structure |
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 897 | ||||
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 3e-18 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 4e-12 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 3e-11 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 7e-07 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 8e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 0.002 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 7e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-09 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 4e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 6e-09 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 7e-09 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 1e-08 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 3e-06 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 0.001 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 6e-08 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 1e-07 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 0.002 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 5e-07 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.001 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.003 | |
| d1pgua2 | 287 | b.69.4.1 (A:327-613) Actin interacting protein 1 { | 1e-05 | |
| d1pgua2 | 287 | b.69.4.1 (A:327-613) Actin interacting protein 1 { | 8e-04 | |
| d1pgua2 | 287 | b.69.4.1 (A:327-613) Actin interacting protein 1 { | 0.002 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-05 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 1e-05 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 6e-05 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 5e-05 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 2e-04 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 6e-05 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 6e-04 | |
| d1sq9a_ | 393 | b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake | 1e-04 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 1e-04 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 3e-04 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 0.002 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 5e-04 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 0.001 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 6e-04 | |
| d1k32a3 | 360 | b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar | 7e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.002 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 0.003 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 0.003 |
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: E3 ubiquitin ligase PUB14 species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 77.8 bits (191), Expect = 3e-18
Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
Query: 156 GKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQKLSSTKLPK 215
G P+ F CPI+ + DPV + TGQTYER +IQ+W++ G+ +CP +++ L L
Sbjct: 1 GSPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-T 59
Query: 216 TNYVLKRLIASWQEQN 231
NYVLK LIA W E N
Sbjct: 60 PNYVLKSLIALWCESN 75
|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 897 | |||
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.78 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.7 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.7 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.7 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.69 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.65 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.65 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.65 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.64 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.64 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.63 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.63 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.62 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.61 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.61 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.61 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.61 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.59 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.59 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.57 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.57 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.56 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.55 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.55 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.54 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.53 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.47 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.42 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.38 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.36 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.32 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.3 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.26 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.23 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.22 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.22 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.21 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.19 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.12 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.86 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.81 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.78 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.66 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.65 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.6 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.59 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.59 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.53 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.49 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.49 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.45 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.29 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.26 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.22 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.21 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.21 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.18 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.15 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.09 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.08 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 98.08 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.03 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.91 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.83 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.77 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.69 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 97.68 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.67 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.63 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.59 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.29 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.27 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 97.01 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 96.99 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.75 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 95.94 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 94.28 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 92.89 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 92.54 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 92.14 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 91.9 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 90.09 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 88.33 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 88.18 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 86.24 | |
| d2dida1 | 40 | Tripartite motif-containing protein 39 {Human (Hom | 85.68 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 85.0 | |
| d1frea_ | 39 | Nuclear factor XNF7 {African clawed frog (Xenopus | 84.16 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 84.13 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 82.32 |
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Antiviral protein Ski8 (Ski8p) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.78 E-value=7.5e-18 Score=138.88 Aligned_cols=119 Identities=13% Similarity=0.096 Sum_probs=99.7
Q ss_pred CCEEEEEECCCCCEEEEECCCCCEEEEECC--C------CEEECCCCCCCEEEEEEECC--EEEEEECCCE---EEEEEC
Q ss_conf 550673303456089973089976898088--6------40221479985799999099--7999754990---999957
Q 002641 774 ELRKYSPLAFEMVKVLSNGHDSSADFWNHR--E------LVHVDSSENGKVLSIACFRD--KIFSGHSDGT---IKVWTG 840 (897)
Q Consensus 774 ~~~~~~~~s~d~~~LaSgs~DgtIklWd~~--~------~~~~l~gH~~~V~sV~fspd--~L~Sgs~Dgt---IkiWdl 840 (897)
.......+++++ ++++|+.|++|++||+. + ....+.+|...|.+++|+|| +|++|+.|++ |++||+
T Consensus 185 ~~~~~v~~s~dg-~lasgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~ 263 (393)
T d1sq9a_ 185 QFATSVDISERG-LIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYET 263 (393)
T ss_dssp CCCCEEEECTTS-EEEEECTTSEEEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEET
T ss_pred CCEEEEEECCCC-EEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCEEEEECCCCCCCEEEECCC
T ss_conf 867899978999-8999938982999860233211000011111242563877004665320112428988421001035
Q ss_pred CCCCCEEEEEE-------------ECCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCC-CCEEEECC
Q ss_conf 88852038886-------------036888689999169999999958994999958876-40012034
Q 002641 841 RGSILHLIQQI-------------REHTKAVTGLAILQSGEMLYSGSLDKTARVRSNDSF-TYAIFIQV 895 (897)
Q Consensus 841 ~~~~~~~i~~l-------------~gH~~~V~slafspdg~~L~SgS~DgtIriWDi~t~-~l~~l~~~ 895 (897)
.++. .+..+ .||.+.|++++|+|++++|+|||.|++|++||+.++ ++++|...
T Consensus 264 ~~g~--~~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s~D~~v~vWd~~~g~~~~~l~gH 330 (393)
T d1sq9a_ 264 EFGE--RIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMH 330 (393)
T ss_dssp TTCC--EEEEECBC--------CCBSBSSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECC
T ss_pred CCCE--EEEEECCCCCCCCCEEEEECCCCCEEEECCCCCCCEEEEECCCCEEEEEECCCCCEEEEECCC
T ss_conf 3213--444311566664310232023586660013898880698779998999999999799999886
|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|