Citrus Sinensis ID: 002652

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890------

MDIKENRQEKTPTVPKSTPSPSPKEKVNVNASQSSSSHPPHQNPNATSPKKTVVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPADEDQNNKDDAMDEDDEATQEDSVG

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHccccccccccEEEEccccEEEccccccccEEEcccccccccEEEEEcccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccHHHHHcccccccHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHcccHHHcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccc

ccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEEcccccEEcEEEcccEEEEccccccccccEEEEEEcccccccccccccEEEEEEEccccccEEccEEccccccccEcccccEEEcccccccccHEEEEEHHHHcccccHccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEHccccHHHHHHcccccccccccccHHHcccccccccccHHHcHccccHHHHHHHHHHHHccccccccHHcccccccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHcccccHHHHHHHHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccc

mdikenrqektptvpkstpspspkekvnvnasqsssshpphqnpnatspkktvvpsHFVFWVAgtyaaqplqnydpkVWGVLTAISNNARKRHQGINILLTADEHcigrlvddahfqidsnavsanhCKIYRkkfasgdldhspsgcssvclkdtstngtyvncerfkknssevnidhgdiisfaappqhdlAFAFvfrdvsrstptmeGAAAKRKAEEYVsdnkrlkgigicspdgplslddfRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEdeenyentsvdidlcvpdgensrtivgeklpnghhsnsaakadssgeasttekhdcdirsqeegqntqeaeftsgdrtckggfgsdidgvgtgpilegdpigteqvhetespgidgeqnidlnkpetlagetmqledeahgheideqipptcqetvnhsqlnnplsqktmEDTIRTADLLASEVAgswacstapsvhgenesprsrdnneegplgphdfsaqaaesqnlpsskaaptkwshDRQALCEMIgivtpelkvqfggavdndlhqgtgksgsisssdteccgdsddndgadtkcsgadndgsnpadedqnnkddamdeddeatqedsvg

mdikenrqektptvpkstpspspkeKVNVNASqsssshpphqnpnatSPKKTVVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFasgdldhspSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMegaaakrkaeeyvsdnkrlkgigicspdgplSLDDFRSLQRSNTELRKQLesqvleidklrnenrvvVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANeimksqkvtidelktqldeernlrrvdRENAEADLKAavqksqletqeKLKRLSDAASRRELEQQEVINKlqiaekqsslqveslklkldetrerlvtsdnkvrlletqvckeqnvsaswkkRVEELENEIKKLREELESEKQAAREVAWAKVSgleldilaatrdldfERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTledeenyentsvdidlcvPDGENSRTIVgeklpnghhsnsaakadssgeastTEKHDCdirsqeegqntqeaeftsgdrtcKGGFGSDIDGVGTGPILEGDPIGTEQVHETespgidgeqnidLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTApsvhgenesprSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGtgksgsisssdtECCGDSDDNDGADTKcsgadndgsnpadedqnnkdDAMDEDDEatqedsvg

MDIKENRQektptvpkstpspspkekvnvnasqsssshpphqnpnaTSPKKTVVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENrvvverhekemkemkesvsISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPADEDQNNKDDAMDEDDEATQEDSVG

****************************************************VVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLD****GCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDV****************************IGIC**********************************************************ISYLHQLKVLRDM**********************************************************************************************************************************************VRLLETQVC***********************************EVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFAR**********************VDIDLCV******************************************************************************************************************************************************************LLASEVAGSWAC****************************************************RQALCEMIGIVTPELKVQFGGAVD*********************************************************************

***************************************************************************PKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKN****NIDHGDIISFAAPPQHDLAFAFVFR*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************

**************************************************KTVVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRS***************YVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREEL**********AWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNG***************************************TSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACS*********************PLGPHDFSAQ*******************DRQALCEMIGIVTPELKVQFGGAVDNDLHQG*******************DNDGADTKCSGAD*******************************

********************************************************HFVFWV*GTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTI***KL*******************************************************************************************************QLED*AH*******IPPTCQETVNHS*******QKTMEDTIRTADLLASEVAGSWACST******************************************A*TKWSHDRQALCEMIGIVTPELKVQF**************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDIKENRQEKTPTVPKSTPSPSPKEKVNVNASQSSSSHPPHQNPNATSPKKTVVPSHFVFWVAGTYAAQPLQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSISYLHQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSASMQSCTEANEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxVCKEQNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKVSGLELDxxxxxxxxxxxxxxxxxxxxxIMLRETQLRAFYSTTEEISVLxxxxxxxxxxxxxxxxxxxxxENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPxxxxxxxxxxxxxxxxxxxxxDSVG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		896
359489534		910	PREDICTED: uncharacterized protein LOC10	0.972	0.957	0.618	0.0
255541346		900	conserved hypothetical protein [Ricinus	0.958	0.954	0.621	0.0
356566838		881	PREDICTED: uncharacterized protein LOC10	0.904	0.919	0.604	0.0
296089166		815	unnamed protein product [Vitis vinifera]	0.863	0.949	0.580	0.0
449433117		893	PREDICTED: uncharacterized protein LOC10	0.879	0.882	0.565	0.0
449522151		868	PREDICTED: uncharacterized LOC101216456,	0.878	0.906	0.565	0.0
334184923		902	SMAD/FHA domain-containing protein [Arab	0.910	0.904	0.520	0.0
334184921		916	SMAD/FHA domain-containing protein [Arab	0.910	0.890	0.512	0.0
30690030		915	SMAD/FHA domain-containing protein [Arab	0.909	0.890	0.510	0.0
297828263		916	forkhead-associated domain-containing pr	0.909	0.889	0.521	0.0

>gi\|359489534\|ref\|XP_002273779.2\| PREDICTED: uncharacterized protein LOC100260735 [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/912 (61%), Positives = 674/912 (73%), Gaps = 41/912 (4%)

Query: 11  TPTVPKSTPSPSPKEKVNVNASQSSSSHPPHQNPNATSPKKTVVPSHFVFWVAGTYAAQP 70
           TP VP++    S      V+ + SS  H P Q+    S  K      F+  VA   ++QP
Sbjct: 14  TPIVPRARDGGSI-----VSDTGSSQPHNPAQDDVTASATKPQSSKDFIISVATKISSQP 68

Query: 71  LQNYDPKVWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKI 130
           LQN+DP+VWGVLTAISN ARKR QGIN+LLTA+EHCIGRL +D  FQI+S AVSANHCKI
Sbjct: 69  LQNFDPEVWGVLTAISNCARKRRQGINVLLTANEHCIGRLAEDTRFQIESAAVSANHCKI 128

Query: 131 YRKKFASGDLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQH 190
           YRK  A  D DH      S  LKDTSTNGTY+N E+ KKNS E  + HGDIISFAAPP H
Sbjct: 129 YRKMVAYEDEDHP-----SAFLKDTSTNGTYLNWEKLKKNSPESMLHHGDIISFAAPPDH 183

Query: 191 DLAFAFVFRDVSRSTPTMEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRS 250
           ++AF FV+RDV +S+P +  A  KRKAEE   +NKR+KGIGI +P+GP+SLDDFRSLQRS
Sbjct: 184 EIAFTFVYRDVLKSSP-LNVAVPKRKAEELRIENKRIKGIGIGAPEGPISLDDFRSLQRS 242

Query: 251 NTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQK 310
           NTELRKQLE+QVL ID L+NENR  +ERHE EMKE+KE VS  Y+ QL+ L  +L+ KQK
Sbjct: 243 NTELRKQLENQVLTIDTLQNENRAAIERHENEMKELKELVSKPYVDQLQELHHLLEVKQK 302

Query: 311 ELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRV 370
           EL E++RI AEQKH M DLN+RLSASMQSC EANEIM SQK +I +L+ +LDEE++ R  
Sbjct: 303 ELVEVNRILAEQKHAMSDLNERLSASMQSCAEANEIMTSQKASISKLEARLDEEQDQRME 362

Query: 371 DRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLK 430
           +RE A ADLKAA+ ++Q E QE++KRLS+ A RRE E QEVIN+LQ +EK+  L VE+L+
Sbjct: 363 EREKATADLKAAIHRAQSEAQEEIKRLSEVALRRERELQEVINRLQESEKERCLLVETLR 422

Query: 431 LKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAR 490
            KL++TR++LV SDNKVR LETQVC+EQ  SA  +KR EEL++E+ +LR+ELESEKQAAR
Sbjct: 423 SKLEDTRQKLVISDNKVRQLETQVCEEQLASADGRKRAEELQHEMTRLRKELESEKQAAR 482

Query: 491 EVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQ 550
           E AWAKVS LEL+I AA RDLDFERRRLK ARERIMLRETQLRAFYSTTEEIS LFA+QQ
Sbjct: 483 EEAWAKVSMLELEINAAMRDLDFERRRLKGARERIMLRETQLRAFYSTTEEISNLFAKQQ 542

Query: 551 EQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKAD------ 604
           EQLKAMQ+TLEDE+NYENTSVDIDL   +G  + T++ EK   G  S+SAAK        
Sbjct: 543 EQLKAMQRTLEDEDNYENTSVDIDLNPTNGFINGTVIREKEAIGFRSSSAAKTGSATSAQ 602

Query: 605 ---------SSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGP 655
                    SS EAS TEKHDCDIR+QE   NTQEAEFTS D   KGGFGSDIDGVGT P
Sbjct: 603 RFGRNLAETSSNEASVTEKHDCDIRTQE---NTQEAEFTSADCLVKGGFGSDIDGVGTAP 659

Query: 656 ILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQE 715
            LEGDPI TE+V ETESPGI+GE+NIDLNK   LAG+TMQ++DEAH  E +E       E
Sbjct: 660 ALEGDPIETERVMETESPGINGEKNIDLNKCIDLAGDTMQIDDEAHIRETEEPGRINRGE 719

Query: 716 TVNHSQLNNPLSQ-KTMED-----TIRTADLLASEVAGSWACSTAPSVHGENESPRSRDN 769
             +HSQ N+     K+MED     TIRTADLLASEVAGSWACSTAPSVHGENESP+SRD+
Sbjct: 720 GSHHSQSNSGFENLKSMEDTEAGGTIRTADLLASEVAGSWACSTAPSVHGENESPKSRDH 779

Query: 770 NEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDND 829
           ++  P+  HD + Q AESQ  PSS+ A  + S + QAL EMIGIV P+LK QFGGA D+D
Sbjct: 780 DQNHPVALHDANGQVAESQTNPSSEVAANRLSREPQALSEMIGIVAPDLKEQFGGAGDDD 839

Query: 830 LHQGTGKSGSISSSDTECCGDSDDND-----GADTKCSGADNDGSNPADEDQNNKDDAMD 884
              G  K G  S+SDTE C DS D+D       D   S A+ +G + ADED+ N+++AM+
Sbjct: 840 YDGGREKGGCTSNSDTENCTDSSDDDYVRVHAKDGSISDAETEGGDQADEDE-NRNEAME 898

Query: 885 EDDEATQEDSVG 896
           EDDEATQE S+G
Sbjct: 899 EDDEATQEGSLG 910

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255541346\|ref\|XP_002511737.1\| conserved hypothetical protein [Ricinus communis] gi\|223548917\|gb\|EEF50406.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|356566838\|ref\|XP_003551633.1\| PREDICTED: uncharacterized protein LOC100807844 [Glycine max]	Back alignment and taxonomy information

>gi\|296089166\|emb\|CBI38869.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449433117\|ref\|XP_004134344.1\| PREDICTED: uncharacterized protein LOC101216456 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449522151\|ref\|XP_004168091.1\| PREDICTED: uncharacterized LOC101216456, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334184923\|ref\|NP_001189751.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255464\|gb\|AEC10558.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334184921\|ref\|NP_001189750.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255463\|gb\|AEC10557.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30690030\|ref\|NP_850437.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255462\|gb\|AEC10556.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828263\|ref\|XP_002882014.1\| forkhead-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297327853\|gb\|EFH58273.1\| forkhead-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		896
UNIPROTKB\|F1PJ01		1972	MYH11 "Uncharacterized protein	0.459	0.208	0.234	2.7e-10
UNIPROTKB\|F1MYM9		1973	MYH11 "Uncharacterized protein	0.456	0.207	0.238	3.4e-10
RGD\|1307994		1941	Myh7b "myosin, heavy chain 7B,	0.351	0.162	0.26	4.3e-10
WB\|WBGene00015643		789	C09E7.9 [Caenorhabditis elegan	0.297	0.338	0.227	6e-10
UNIPROTKB\|Q02224		2701	CENPE "Centromere-associated p	0.287	0.095	0.251	6.2e-10
UNIPROTKB\|E1BPX8		1942	LOC521764 "Uncharacterized pro	0.349	0.161	0.255	7e-10
UNIPROTKB\|F1MQ37		1964	MYH9 "Uncharacterized protein"	0.566	0.258	0.205	7.1e-10
MGI\|MGI:102643		1972	Myh11 "myosin, heavy polypepti	0.462	0.209	0.237	7.1e-10
ZFIN\|ZDB-GENE-030131-5870		1964	myh9a "myosin, heavy polypepti	0.349	0.159	0.242	9.1e-10
UNIPROTKB\|H9KYY1		1184	Gga.30045 "Uncharacterized pro	0.350	0.265	0.232	1e-09

UNIPROTKB\|F1PJ01 MYH11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

 Score = 188 (71.2 bits), Expect = 2.7e-10, P = 2.7e-10
 Identities = 111/473 (23%), Positives = 220/473 (46%)

Query:   297 QLKVLRDMLDAKQ--KELAEISRISAEQK-HEMEDLNDRLSASMQSCTEANEIMKSQKVT 353
             Q+  L + L+ ++  ++  ++ +++AE K  ++ED  D L    Q+    N++ K +K+ 
Sbjct:   951 QMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLED--DILVMDDQN----NKLSKERKLL 1004

Query:   354 ---IDELKTQLDEE----RNLRRVDR--ENAEADLKAAVQKSQLETQEKLKRLSDAASRR 404
                I +L T L EE    +NL ++    E+  ++L+  ++K +   QE L++L     +R
Sbjct:  1005 EERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQE-LEKL-----KR 1058

Query:   405 ELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASW 464
             +LE +      QIA+ Q+  Q+  LK++L +  E L  +  +   L+ ++ ++ N     
Sbjct:  1059 KLEGEASDFHEQIADLQA--QIAELKMQLAKKEEELQAALGR---LDDEIAQKNNAL--- 1110

Query:   465 KKRVEELENEIKKLREELESEKQAAREVAWAKVS-GLELDILAA----TRDLDFERRRLK 519
              K++ ELE  I  L+E+L+SE+ A  +    K   G EL+ L      T D    ++ L+
Sbjct:  1111 -KKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELR 1169

Query:   520 AARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPD 579
             A RE+ +    +     + + E  V   RQ+   +A+++  E  E ++    ++D     
Sbjct:  1170 AKREQEVTVLKKALDEETRSHEAQVQEMRQKHT-QAVEELTEQLEQFKRAKANLD----- 1223

Query:   580 GENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRT 639
              +N +T+  EK  N   +      + + +    +K   +++ QE      + E    +  
Sbjct:  1224 -KNKQTL--EK-ENADLAGELRVLNQAKQEVEHKKKKLEVQLQELQSKCSDGERARAELN 1279

Query:   640 CK-GGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPET-----LAGET 693
              K     ++++ V TG + E +    +   +  S G   +   +L + ET     ++ + 
Sbjct:  1280 DKVHKLQNEVESV-TGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKL 1338

Query:   694 MQLEDEAHG--HEIDEQIPPTCQETVNH-SQLNNPLS--QKTMEDTIRTADLL 741
              QLEDE +    ++DE++    Q    H S LN  LS  +K ++D   T + L
Sbjct:  1339 RQLEDERNSLQDQLDEEMEAK-QNLERHISTLNIQLSDSKKKLQDFASTVEAL 1390

GO:0048739 "cardiac muscle fiber development" evidence=IEA

GO:0048251 "elastic fiber assembly" evidence=IEA

GO:0030485 "smooth muscle contractile fiber" evidence=IEA

GO:0008307 "structural constituent of muscle" evidence=IEA

GO:0006939 "smooth muscle contraction" evidence=IEA

GO:0005859 "muscle myosin complex" evidence=IEA

GO:0003774 "motor activity" evidence=IEA

GO:0001725 "stress fiber" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0003779 "actin binding" evidence=IEA

UNIPROTKB\|F1MYM9 MYH11 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1307994 Myh7b "myosin, heavy chain 7B, cardiac muscle, beta" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

WB\|WBGene00015643 C09E7.9 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|Q02224 CENPE "Centromere-associated protein E" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BPX8 LOC521764 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MQ37 MYH9 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:102643 Myh11 "myosin, heavy polypeptide 11, smooth muscle" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5870 myh9a "myosin, heavy polypeptide 9a, non-muscle" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|H9KYY1 Gga.30045 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00026367001	SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (878 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		896
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-14
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-12
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	8e-11
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	5e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-09
cd00060		102	cd00060, FHA, Forkhead associated domain (FHA); fo	3e-09
pfam00498		67	pfam00498, FHA, FHA domain	3e-09
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	3e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-09
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	8e-09
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	9e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-07
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	2e-07
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	4e-07
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	7e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	7e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	2e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-05
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	4e-05
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	7e-05
smart00240		52	smart00240, FHA, Forkhead associated domain	8e-05
TIGR01843		423	TIGR01843, type_I_hlyD, type I secretion membrane	2e-04
pfam09730		711	pfam09730, BicD, Microtubule-associated protein Bi	2e-04
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	3e-04
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	4e-04
COG5022		1463	COG5022, COG5022, Myosin heavy chain [Cytoskeleton	4e-04
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	5e-04
COG1716		191	COG1716, COG1716, FOG: FHA domain [Signal transduc	5e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	6e-04
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	7e-04
pfam05667		536	pfam05667, DUF812, Protein of unknown function (DU	7e-04
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	9e-04
pfam00038		312	pfam00038, Filament, Intermediate filament protein	0.001
COG3264		835	COG3264, COG3264, Small-conductance mechanosensiti	0.001
TIGR00606		1311	TIGR00606, rad50, rad50	0.001
pfam10174		774	pfam10174, Cast, RIM-binding protein of the cytoma	0.001
TIGR03185		650	TIGR03185, DNA_S_dndD, DNA sulfur modification pro	0.001
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.002
TIGR00618		1042	TIGR00618, sbcc, exonuclease SbcC	0.002
PRK04863		1486	PRK04863, mukB, cell division protein MukB; Provis	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	0.003
PRK04863		1486	PRK04863, mukB, cell division protein MukB; Provis	0.003
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.003
COG1340		294	COG1340, COG1340, Uncharacterized archaeal coiled-	0.003
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	0.004
pfam13870		177	pfam13870, DUF4201, Domain of unknown function (DU	0.004

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

 Score = 76.3 bits (188), Expect = 6e-14
 Identities = 72/325 (22%), Positives = 138/325 (42%), Gaps = 36/325 (11%)

Query: 214 KRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKL---RN 270
             KAE Y      L+ +     +  L L   + L++   EL ++L     E+++L     
Sbjct: 209 AEKAERYQELKAELREL-----ELALLLAKLKELRKELEELEEELSRLEEELEELQEELE 263

Query: 271 ENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLN 330
           E    +E  + E++E++E                L+  Q+EL E+     E + E+  L 
Sbjct: 264 EAEKEIEELKSELEELREE---------------LEELQEELLELKEEIEELEGEISLLR 308

Query: 331 DRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLET 390
           +RL        E  E ++  K  I+ LK +L+E   L   + E   A+L+ A +    E 
Sbjct: 309 ERLEELENELEELEERLEELKEKIEALKEELEERETLLE-ELEQLLAELEEAKE----EL 363

Query: 391 QEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLL 450
           +EKL  L +         +E + +L+    +   ++E LK +++   ERL     ++  L
Sbjct: 364 EEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDL 423

Query: 451 ETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAAREVAWAKVSGLELDILAATRD 510
           + ++ + +      +  +EEL  E+++L E+LE  +   +E        LE ++     +
Sbjct: 424 KEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKE--------LERELAELQEE 475

Query: 511 LDFERRRLKAARERIMLRETQLRAF 535
           L    + L +   R+   E + RA 
Sbjct: 476 LQRLEKELSSLEARLDRLEAEQRAS 500

Length = 1163

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>gnl\|CDD\|215951 pfam00498, FHA, FHA domain	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|214578 smart00240, FHA, Forkhead associated domain	Back alignment and domain information

>gnl\|CDD\|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>gnl\|CDD\|220368 pfam09730, BicD, Microtubule-associated protein Bicaudal-D	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|218681 pfam05667, DUF812, Protein of unknown function (DUF812)	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|200948 pfam00038, Filament, Intermediate filament protein	Back alignment and domain information

>gnl\|CDD\|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|129694 TIGR00606, rad50, rad50	Back alignment and domain information

>gnl\|CDD\|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone	Back alignment and domain information

>gnl\|CDD\|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|129705 TIGR00618, sbcc, exonuclease SbcC	Back alignment and domain information

>gnl\|CDD\|235316 PRK04863, mukB, cell division protein MukB; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235316 PRK04863, mukB, cell division protein MukB; Provisional	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|222426 pfam13870, DUF4201, Domain of unknown function (DUF4201)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		896
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.92
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.87
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.87
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.83
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.81
KOG0018		1141	consensus Structural maintenance of chromosome pro	99.74
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.73
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.64
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.62
PF00038		312	Filament: Intermediate filament protein; InterPro:	99.52
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	99.47
PF00498		68	FHA: FHA domain; InterPro: IPR000253 The forkhead-	99.47
cd00060		102	FHA Forkhead associated domain (FHA); found in euk	99.25
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.24
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.23
TIGR03354		396	VI_FHA type VI secretion system FHA domain protein	99.22
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.2
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.15
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.15
KOG1882		293	consensus Transcriptional regulator SNIP1, contain	99.12
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	99.1
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	99.07
PRK03918		880	chromosome segregation protein; Provisional	99.02
PRK02224		880	chromosome segregation protein; Provisional	99.0
PRK02224		880	chromosome segregation protein; Provisional	98.96
COG1716		191	FOG: FHA domain [Signal transduction mechanisms]	98.95
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.91
COG3456		430	Predicted component of the type VI protein secreti	98.88
smart00240		52	FHA Forkhead associated domain. Found in eukaryoti	98.87
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.84
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.82
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.82
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.79
PRK03918		880	chromosome segregation protein; Provisional	98.78
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.78
KOG1881		793	consensus Anion exchanger adaptor protein Kanadapt	98.76
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	98.76
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.7
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.7
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.67
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.62
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.61
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.59
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.56
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.56
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.54
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	98.53
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.53
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.51
PRK01156		895	chromosome segregation protein; Provisional	98.51
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.49
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.49
KOG0996		1293	consensus Structural maintenance of chromosome pro	98.48
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	98.47
PRK04863		1486	mukB cell division protein MukB; Provisional	98.46
PRK11637		428	AmiB activator; Provisional	98.44
PRK04863		1486	mukB cell division protein MukB; Provisional	98.43
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	98.43
PRK01156		895	chromosome segregation protein; Provisional	98.42
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.42
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.42
PHA02562		562	46 endonuclease subunit; Provisional	98.42
PHA02562		562	46 endonuclease subunit; Provisional	98.42
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.41
PRK11637		428	AmiB activator; Provisional	98.41
KOG4673		961	consensus Transcription factor TMF, TATA element m	98.38
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.33
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	98.33
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.21
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.2
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.2
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	98.18
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	98.17
PRK04778		569	septation ring formation regulator EzrA; Provision	98.17
KOG0963		629	consensus Transcription factor/CCAAT displacement	98.16
PRK04778		569	septation ring formation regulator EzrA; Provision	98.13
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.12
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	98.11
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.1
COG4942		420	Membrane-bound metallopeptidase [Cell division and	98.08
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	98.06
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.98
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.98
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.97
PRK10929		1109	putative mechanosensitive channel protein; Provisi	97.97
PRK11281		1113	hypothetical protein; Provisional	97.89
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.88
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.87
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.86
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.85
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.85
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.82
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.81
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.8
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.76
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.73
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.71
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.71
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.71
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	97.7
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	97.67
KOG0979		1072	consensus Structural maintenance of chromosome pro	97.62
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.61
KOG1880		337	consensus Nuclear inhibitor of phosphatase-1 [Gene	97.61
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.58
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.56
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.56
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.52
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.47
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.46
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.41
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	97.39
KOG1003		205	consensus Actin filament-coating protein tropomyos	97.39
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	97.38
PF13514		1111	AAA_27: AAA domain	97.37
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	97.33
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	97.29
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.28
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	97.28
COG4372		499	Uncharacterized protein conserved in bacteria with	97.27
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	97.25
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.23
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.23
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.11
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.1
PRK09039		343	hypothetical protein; Validated	97.09
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.06
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.04
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.0
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.0
PRK09039		343	hypothetical protein; Validated	96.96
COG4477		570	EzrA Negative regulator of septation ring formatio	96.93
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	96.9
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	96.84
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.84
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	96.8
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.76
COG4372		499	Uncharacterized protein conserved in bacteria with	96.68
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.64
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	96.63
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	96.63
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.61
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.55
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.52
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.46
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	96.44
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	96.43
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.41
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	96.4
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	96.39
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	96.38
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	96.36
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.36
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	96.33
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.3
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.3
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.29
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.25
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	96.24
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.24
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.23
PRK10246		1047	exonuclease subunit SbcC; Provisional	96.19
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.12
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	96.08
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	96.08
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	96.04
PRK11281		1113	hypothetical protein; Provisional	95.99
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	95.96
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	95.95
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.93
PRK10929		1109	putative mechanosensitive channel protein; Provisi	95.91
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	95.87
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	95.83
KOG4302		660	consensus Microtubule-associated protein essential	95.81
PRK10869		553	recombination and repair protein; Provisional	95.75
PRK10246		1047	exonuclease subunit SbcC; Provisional	95.7
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.64
KOG0249		916	consensus LAR-interacting protein and related prot	95.55
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	95.52
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	95.5
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	95.49
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.48
COG4477		570	EzrA Negative regulator of septation ring formatio	95.44
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	95.43
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	95.41
PF13166		712	AAA_13: AAA domain	95.22
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	94.99
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	94.97
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	94.9
KOG0249		916	consensus LAR-interacting protein and related prot	94.89
KOG0979		1072	consensus Structural maintenance of chromosome pro	94.86
PF03148		384	Tektin: Tektin family; InterPro: IPR000435 Tektin	94.86
PRK10869		553	recombination and repair protein; Provisional	94.85
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	94.81
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	94.71
TIGR02500		410	type_III_yscD type III secretion apparatus protein	94.65
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	94.57
PF13514		1111	AAA_27: AAA domain	94.34
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	94.33
KOG2293		547	consensus Daxx-interacting protein MSP58/p78, cont	94.3
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	94.29
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	94.26
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.2
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	94.19
KOG1103		561	consensus Predicted coiled-coil protein [Function	94.11
KOG1892		1629	consensus Actin filament-binding protein Afadin [C	94.09
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	94.02
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.9
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	93.85
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.84
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	93.81
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	93.8
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	93.78
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	93.75
COG4026		290	Uncharacterized protein containing TOPRIM domain,	93.7
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	93.67
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	93.57
PLN02939		977	transferase, transferring glycosyl groups	93.49
PRK12704		520	phosphodiesterase; Provisional	93.48
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.48
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	93.4
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	93.38
PF13166		712	AAA_13: AAA domain	93.36
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	93.25
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	93.19
PF12252		1439	SidE: Dot/Icm substrate protein; InterPro: IPR0210	93.12
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	93.08
KOG4807		593	consensus F-actin binding protein, regulates actin	92.98
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	92.97
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	92.96
PRK10361		475	DNA recombination protein RmuC; Provisional	92.92
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	92.89
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	92.83
COG2433		652	Uncharacterized conserved protein [Function unknow	92.71
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	92.56
KOG4807		593	consensus F-actin binding protein, regulates actin	92.54
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	92.51
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	92.33
KOG4302		660	consensus Microtubule-associated protein essential	92.28
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	92.2
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	92.16
KOG2991		330	consensus Splicing regulator [RNA processing and m	92.15
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	92.12
COG3096		1480	MukB Uncharacterized protein involved in chromosom	92.02
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	91.99
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	91.73
PLN02939		977	transferase, transferring glycosyl groups	91.69
KOG1937		521	consensus Uncharacterized conserved protein [Funct	91.67
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	91.64
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	91.57
PRK00106		535	hypothetical protein; Provisional	91.49
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	91.3
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	91.23
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	91.2
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	91.13
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	91.12
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	90.93
PF15294		278	Leu_zip: Leucine zipper	90.85
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	90.47
PRK10884		206	SH3 domain-containing protein; Provisional	90.47
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	90.27
KOG4787		852	consensus Uncharacterized conserved protein [Funct	90.03
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	89.98
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.8
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	89.59
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	89.37
COG2433		652	Uncharacterized conserved protein [Function unknow	89.2
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	89.19
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	89.17
PLN03188		1320	kinesin-12 family protein; Provisional	89.17
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	89.13
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	88.82
PF00901		508	Orbi_VP5: Orbivirus outer capsid protein VP5; Inte	88.67
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	88.58
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	88.55
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	88.51
COG4026		290	Uncharacterized protein containing TOPRIM domain,	88.45
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	88.22
PF14992		280	TMCO5: TMCO5 family	88.08
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	88.0
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	87.92
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	87.89
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	87.75
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	87.72
PRK10884		206	SH3 domain-containing protein; Provisional	87.71
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	87.39
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	87.33
KOG1937		521	consensus Uncharacterized conserved protein [Funct	87.22
PRK00106		535	hypothetical protein; Provisional	87.17
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	86.93
PF05335		188	DUF745: Protein of unknown function (DUF745); Inte	86.86
PF03148		384	Tektin: Tektin family; InterPro: IPR000435 Tektin	86.85
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	86.54
KOG2991		330	consensus Splicing regulator [RNA processing and m	86.43
PRK10698		222	phage shock protein PspA; Provisional	86.39
KOG1103		561	consensus Predicted coiled-coil protein [Function	86.21
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	86.0
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	85.77
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	85.57
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	85.21
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	85.08
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	84.55
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	84.39
PTZ00121		2084	MAEBL; Provisional	84.38
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	84.26
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	83.73
PF07798		177	DUF1640: Protein of unknown function (DUF1640); In	83.65
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	83.63
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	83.62
PF08581		79	Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t	83.22
PRK11519		719	tyrosine kinase; Provisional	82.96
PRK10698		222	phage shock protein PspA; Provisional	82.91
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	82.8
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	82.69
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	82.56
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	82.55
KOG1962		216	consensus B-cell receptor-associated protein and r	82.38
KOG4787		852	consensus Uncharacterized conserved protein [Funct	82.19
PF12761		195	End3: Actin cytoskeleton-regulatory complex protei	82.12
PF14992		280	TMCO5: TMCO5 family	81.94
PF05335		188	DUF745: Protein of unknown function (DUF745); Inte	81.93
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	81.93
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	81.88
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	81.65
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	81.43
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	81.39
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	81.24
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	81.16
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	81.11
COG3096		1480	MukB Uncharacterized protein involved in chromosom	80.98
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	80.84
KOG4403		575	consensus Cell surface glycoprotein STIM, contains	80.78
KOG2685		421	consensus Cystoskeletal protein Tektin [Cytoskelet	80.64
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	80.51
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	80.49
PLN03188		1320	kinesin-12 family protein; Provisional	80.41
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	80.38
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	80.3
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	80.3
PRK00409		782	recombination and DNA strand exchange inhibitor pr	80.18
PF04102		69	SlyX: SlyX; InterPro: IPR007236 The SlyX protein h	80.06

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

Probab=99.92  E-value=2.5e-22  Score=254.73  Aligned_cols=440  Identities=20%  Similarity=0.228  Sum_probs=222.3

Q ss_pred             ceEEEEeCCCC-ceeecCccccCCCCccccCCCCEEE----Ec-cCCCCCccEEEEEcccccCCCcc------ccccccc
Q 002652          148 SSVCLKDTSTN-GTYVNCERFKKNSSEVNIDHGDIIS----FA-APPQHDLAFAFVFRDVSRSTPTM------EGAAAKR  215 (896)
Q Consensus       148 ~~~~L~D~StN-GTfVNg~ri~kng~~~~L~~GDvIs----La-~dp~~~~af~FVF~dtlv~~~~e------~g~~~~e  215 (896)
                      |+-||+....+ .|||+..+|............+.|.    |. ++|.|.++|.|||++|++|++++      +......
T Consensus       557 ~i~~lk~~~~gr~tflpl~~i~~~~~~~~~~~~g~~~~a~dli~~d~~~~~~~~~~l~~t~Iv~~l~~A~~l~~~~~~~~  636 (1163)
T COG1196         557 AIEFLKENKAGRATFLPLDRIKPLRSLKSDAAPGFLGLASDLIDFDPKYEPAVRFVLGDTLVVDDLEQARRLARKLRIKY  636 (1163)
T ss_pred             HHHHHhhcCCCccccCchhhhccccccccccccchhHHHHHHhcCCHHHHHHHHHHhCCeEEecCHHHHHHHHHhcCCCc
Confidence            56788887666 9999999998521111111344443    33 57788889999999999999998      2221245


Q ss_pred             ceeeecccccccccccccCCCCCCCH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHH
Q 002652          216 KAEEYVSDNKRLKGIGICSPDGPLSL----DDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVS  291 (896)
Q Consensus       216 KSgamtGgs~~~sG~~~sa~~~~~~l----dkvr~Le~e~~eL~~qlee~~~~i~~Lr~ei~~ir~r~E~El~El~e~l~  291 (896)
                      |.+|++|+.+.++|.+.+....+.+.    .++..|..++..+..++......+..+...+..+...    +.+++..+ 
T Consensus       637 riVTl~G~~~~~~G~~tGG~~~~~~~~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~-  711 (1163)
T COG1196         637 RIVTLDGDLVEPSGSITGGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDL----LEELRRQL-  711 (1163)
T ss_pred             eEEecCCcEEeCCeeeecCCccccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHH-
Confidence            66777777777777766441111111    1344556666666666666666666666655444444    33333333 


Q ss_pred             HHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q 002652          292 ISYLHQLKVLRDMLD-------AKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEE  364 (896)
Q Consensus       292 kklE~QLeELq~kLe-------e~ekeL~el~~k~~kLEsEleEL~eqLee~e~~~~eLekeik~LE~eI~ELe~qLEeE  364 (896)
                      ..+..++..+...+.       .....+..+...+..+..++..++.++..++..+..+...+..++..+.++...+...
T Consensus       712 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~  791 (1163)
T COG1196         712 EELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQAL  791 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            222222333333333       2233333333333333333333333444444444444444433333333333211111


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------HHHHHHHH---
Q 002652          365 RNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAE--------------KQSSLQVE---  427 (896)
Q Consensus       365 r~~~~EELEe~~~eLk~qIqkl~~El~eerkk~eee~~~~ieElee~l~KLqE~E--------------Kklr~elE---  427 (896)
                      . ..+..++..+..++..+..+..++..|..+.. .....++.+...+..+.+..              ..+..+++   
T Consensus       792 ~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~ei~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~  869 (1163)
T COG1196         792 Q-EELEELEEELEEAERRLDALERELESLEQRRE-RLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELE  869 (1163)
T ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence            1 12222222333333333333333333333321 22222222222222222111              12222222   


Q ss_pred             ----HHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHH
Q 002652          428 ----SLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKQAARE--------VAWA  495 (896)
Q Consensus       428 ----dLq~eLE~lra~l~~lEkk~reLdk~LeEek~~~~~lqkel~elE~EireLe~ELE~~k~~~~E--------e~~~  495 (896)
                          .+...+...+.....+++.++.+...+.+.+.....+...+..+......+...+........+        .+..
T Consensus       870 ~~~~~l~~~l~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  949 (1163)
T COG1196         870 AEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLETELER  949 (1163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccchhHHHHH
Confidence                2222222222222222333333333333333333222333332222333333222222111111        4566


Q ss_pred             HHHHHHHHHH-------HHhhhHHHHHHH----------HHHHHHHHHHHHHHH-----HHhhhhHHHHHHHHHHHHHHH
Q 002652          496 KVSGLELDIL-------AATRDLDFERRR----------LKAARERIMLRETQL-----RAFYSTTEEISVLFARQQEQL  553 (896)
Q Consensus       496 ki~~LE~Eie-------ka~reLE~Ek~r----------Lq~~rerL~~~eqq~-----ka~iek~EEiee~fkk~~~qL  553 (896)
                      .+..|+.++.       .|+.+|+....|          +..++..|+...+.+     ..|+++|..|+.+|..+|+.|
T Consensus       950 ~i~~le~~i~~lg~VN~~Aiee~e~~~~r~~~l~~~~~dl~~a~~~l~~~i~~~d~~~~~~f~~~f~~In~~F~~if~~L 1029 (1163)
T COG1196         950 EIERLEEEIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKEL 1029 (1163)
T ss_pred             HHHHHHHHHHhccCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6666666654       356666666665          333444555443333     378899999999999999999


Q ss_pred             HH---HhhhhhhhhhhcccccccccCCCCC---CCcccccCcccccc
Q 002652          554 KA---MQKTLEDEENYENTSVDIDLCVPDG---ENSRTIVGEKLPNG  594 (896)
Q Consensus       554 ~~---lq~~LEdEek~~s~~leld~~p~~k---rleamSGGEKs~~~  594 (896)
                      -.   ..+.|.++++||++++++-++|.+|   +|..|||||||.+.
T Consensus      1030 ~~GG~a~L~l~~~dd~l~~Giei~a~ppgK~~~~l~~LSGGEKsLtA 1076 (1163)
T COG1196        1030 FGGGTAELELTEPDDPLTAGIEISARPPGKKLQSLSLLSGGEKSLTA 1076 (1163)
T ss_pred             CCCCeeEEEeCCCCchhhcCcEEEEECCCCCccchhhcCCcHHHHHH
Confidence            66   4577788899999999999999999   89999999998754

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins	Back alignment and domain information

>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR03354 VI_FHA type VI secretion system FHA domain protein	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1716 FOG: FHA domain [Signal transduction mechanisms]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>smart00240 FHA Forkhead associated domain	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules []	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton]	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG4787 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>PF00901 Orbi_VP5: Orbivirus outer capsid protein VP5; InterPro: IPR000145 The orbivirus VP5 protein is one of the two proteins (with VP2) which make up the virus particle outer capsid	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function	Back alignment and domain information

>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules []	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>KOG4787 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]	Back alignment and domain information

>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton]	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		896
1dmz_A		158	Protein (protein kinase SPK1); beta-sandwich, anti	8e-18
1lgp_A		116	Cell cycle checkpoint protein CHFR; FHA, tungstate	9e-18
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-17
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-12
1gxc_A		149	CHK2, CDS1, serine/threonine-protein kinase CHK2;	2e-16
1qu5_A		182	Protein kinase SPK1; FHA, RAD53, transferase; NMR	3e-16
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
3i6u_A		419	CDS1, serine/threonine-protein kinase CHK2; Ser/Th	1e-13
2jqj_A		151	DNA damage response protein kinase DUN1; protein/p	1e-12
1g6g_A		127	Protein kinase RAD53; beta-sandwich, phosphopeptid	1e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	7e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-06
1g3g_A		164	Protien kinase SPK1; FHA domain, RAD53, phosphopep	7e-11
1r21_A		128	Antigen KI-67; beta sandwich, cell cycle; NMR {Hom	5e-10
3hx1_A		131	SLR1951 protein; P74513_SYNY3, adenylate cyclase-l	1e-09
2csw_A		145	Ubiquitin ligase protein RNF8; 11-stranded beta sa	1e-09
3gqs_A		106	Adenylate cyclase-like protein; FHA domain, struct	3e-09
2pie_A		138	E3 ubiquitin-protein ligase RNF8; FHA domain, comp	9e-09
2xt9_B		115	Putative signal transduction protein GARA; lyase-s	2e-08
3po8_A		100	RV0020C protein, putative uncharacterized protein	4e-08
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	5e-08
1uht_A		118	Expressed protein; FHA domain, beta-sandwich, anti	6e-08
3va4_A		132	Mediator of DNA damage checkpoint protein 1; cell	1e-07
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	1e-07
3oun_A		157	Putative uncharacterized protein TB39.8; peptidogl	2e-07
2kfu_A		162	RV1827 PThr 22; FHA domain, phosphorylation, intra	3e-07
3huf_A		325	DNA repair and telomere maintenance protein NBS1;	7e-07
2jpe_A		140	Nuclear inhibitor of protein phosphatase 1; FHA do	9e-07
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	9e-07
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	4e-06
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	9e-06
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	9e-06
2kb3_A		143	Oxoglutarate dehydrogenase inhibitor; forkhead-ass	1e-06
3els_A		158	PRE-mRNA leakage protein 1; intrinsically unstruct	2e-06
3elv_A		205	PRE-mRNA leakage protein 1; intrinsically unstruct	2e-06
1mzk_A		139	Kinase associated protein phosphatase; beta sandwi	2e-06
2xs1_A		704	Programmed cell death 6-interacting protein; prote	6e-06
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	2e-05
3iyk_A		526	VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu	7e-04

>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158	Back alignment and structure

 Score = 80.6 bits (198), Expect = 8e-18
 Identities = 28/140 (20%), Positives = 52/140 (37%), Gaps = 4/140 (2%)

Query: 93  HQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFASGD--LDHSPSGCSSV 150
            + + I    +   IGR  +D + +I+ N +S  HC I++K+ A G    +    G   +
Sbjct: 17  QESLEIQQGVNPFFIGRS-EDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDI 75

Query: 151 CLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSRSTPTMEG 210
               T TN +Y+N  R  + +    +  GD I       +     F       +    EG
Sbjct: 76  WYCHTGTNVSYLNNNRMIQGTK-FLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEG 134

Query: 211 AAAKRKAEEYVSDNKRLKGI 230
               ++    +      K +
Sbjct: 135 LGMLQEQRVVLKQTAEEKDL 154

PyMOL of 1dmz

>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149	Back alignment and structure

>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419	Back alignment and structure

>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151	Back alignment and structure

>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164	Back alignment and structure

>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128	Back alignment and structure

>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131	Back alignment and structure

>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145	Back alignment and structure

>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106	Back alignment and structure

>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138	Back alignment and structure

>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115	Back alignment and structure

>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118	Back alignment and structure

>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592	Back alignment and structure

>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157	Back alignment and structure

>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162	Back alignment and structure

>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Length = 325	Back alignment and structure

>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143	Back alignment and structure

>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158	Back alignment and structure

>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		896
d1dmza_		158	b.26.1.2 (A:) Phosphotyrosine binding domain of Ra	8e-16
d1lgpa_		113	b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {	9e-10
d1uhta_		118	b.26.1.2 (A:) FHA domain containing protein At4G14	2e-07
d1g6ga_		127	b.26.1.2 (A:) Phosphotyrosine binding domain of Ra	4e-06
d2piea1		127	b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8	1e-05
d1mzka_		122	b.26.1.2 (A:) Kinase associated protein phosphatas	1e-05
d2ff4a3		99	b.26.1.2 (A:284-382) Probable regulatory protein E	3e-05
d1f5na1		300	a.114.1.1 (A:284-583) Interferon-induced guanylate	9e-05
d2g1la1		102	b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H	1e-04

>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158	Back information, alignment and structure


class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: Phosphotyrosine binding domain of Rad53
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 73.7 bits (180), Expect = 8e-16
 Identities = 28/144 (19%), Positives = 53/144 (36%), Gaps = 6/144 (4%)

Query: 78  VWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSNAVSANHCKIYRKKFAS 137
            +  L  + ++     + + I    +   IGR  D  + +I+ N +S  HC I++K+ A 
Sbjct: 4   RFLTLKPLPDS--IIQESLEIQQGVNPFFIGRSED-CNCKIEDNRLSRVHCFIFKKRHAV 60

Query: 138 G--DLDHSPSGCSSVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFA 195
           G    +    G   +    T TN +Y+N  R  + +    +  GD I       +     
Sbjct: 61  GKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTK-FLLQDGDEIKIIWDKNNKFVIG 119

Query: 196 FVFRDVSRSTPTMEGAAAKRKAEE 219
           F       +    EG    ++   
Sbjct: 120 FKVEINDTTGLFNEGLGMLQEQRV 143

PyMOL of d1dmza_

>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113	Back information, alignment and structure

>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118	Back information, alignment and structure

>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127	Back information, alignment and structure

>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127	Back information, alignment and structure

>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122	Back information, alignment and structure

>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300	Back information, alignment and structure

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		896
d1gxca_		116	Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1lgpa_		113	Cell cycle checkpoint protein Chfr {Human (Homo sa	99.72
d1dmza_		158	Phosphotyrosine binding domain of Rad53 {Baker's y	99.67
d2piea1		127	Ubiquitin ligase protein RNF8 {Human (Homo sapiens	99.54
d2ff4a3		99	Probable regulatory protein EmbR, C-terminal domai	99.48
d1g6ga_		127	Phosphotyrosine binding domain of Rad53 {Baker's y	99.47
d1uhta_		118	FHA domain containing protein At4G14490 {Thale cre	99.43
d1mzka_		122	Kinase associated protein phosphatase {Thale cress	99.4
d2brfa1		101	Polynucleotide kinase 3'-phosphatase {Human (Homo	99.4
d2affa1		98	Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}	99.32
d2g1la1		102	Kinesin-like protein kif1c {Human (Homo sapiens) [	99.16
d1wlna1		107	Afadin {Mouse (Mus musculus) [TaxId: 10090]}	99.15
d1gxja_		161	Smc hinge domain {Thermotoga maritima [TaxId: 2336	88.97
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	84.37

>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: Chk2 kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=7.6e-19  Score=150.56  Aligned_cols=106  Identities=25%  Similarity=0.341  Sum_probs=88.5

Q ss_pred             CEEEEEEECCCCCCCCCCEEEEECCCCEEECCCCCCCCEECCCC---------CCCCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             40899951266223576404883599258448999985121897---------544344379983157898999999984
Q 002652           78 VWGVLTAISNNARKRHQGINILLTADEHCIGRLVDDAHFQIDSN---------AVSANHCKIYRKKFASGDLDHSPSGCS  148 (896)
Q Consensus        78 ~WG~L~~i~~~~~~~~~g~~i~L~~~e~~iGR~~~~~d~~i~~~---------~IS~~Hc~I~r~~~~~~~~~~~~~~~~  148 (896)
                      |||+|+++...      +..+.|..+.|+|||++.| |++|+++         .||++||+|++.....        ...
T Consensus         1 PwgrL~~~~~~------~~~~~L~~~~~~iGR~~~c-di~l~~~~~~~~~~~~~ISr~H~~I~~~~~~~--------~~~   65 (116)
T d1gxca_           1 PWARLWALQDG------FANLECVNDNYWFGRDKSC-EYCFDEPLLKRTDKYRTYSKKHFRIFREVGPK--------NSY   65 (116)
T ss_dssp             CCEEEEECSTT------CCCEEECSSEEEEESSTTC-SEECCCGGGGGSSGGGGSCTTCEEEEEEECTT--------SSE
T ss_pred             CEEEEEECCCC------CCEEEECCCCEEEEECCCC-CEEECCCCCCCCCCCCEEECCEEEEEEECCCC--------CCC
T ss_conf             94999854899------8638858887896157778-75844873234333433723149999942568--------987


Q ss_pred             EEEEEECCCCCEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCC
Q ss_conf             1899857977524468203589974225799999972599987208999723466
Q 002652          149 SVCLKDTSTNGTYVNCERFKKNSSEVNIDHGDIISFAAPPQHDLAFAFVFRDVSR  203 (896)
Q Consensus       149 ~~~L~D~StNGTfVNg~ki~kng~~~~L~~GDvIsL~~~p~~~~af~FVF~dtlv  203 (896)
                      .+||.|.|+||||||+.+|.+ +..+.|.+||+|.|+.+.    ...|+|.|..+
T Consensus        66 ~~~i~d~S~NGT~vN~~~i~~-~~~~~L~~gD~I~ig~~~----~~~f~f~d~~~  115 (116)
T d1gxca_          66 IAYIEDHSGNGTFVNTELVGK-GKRRPLNNNSEIALSLSR----NKVFVFFDLTV  115 (116)
T ss_dssp             EEEEEECCSSCEEETTEECCT-TCEEECCTTEEEEESSTT----CEEEEEEETTC
T ss_pred             EEEEECCCCCCCEECCEECCC-CCEEECCCCCEEEECCCE----EEEEEEEECCC
T ss_conf             899978986574699989679-977888999999989977----48999997237

PyMOL of d1gxca_

>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure