Citrus Sinensis ID: 002758

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880----
MRIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
cHHHHHHHHHccccccccccccccccccccEEEEEHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHcccccccEEEEEEcccccccccccccccccccccc
ccEEEEEEEccccccccccccEccEEEcccEEEEEEHHHHHHEcccccccHccEEHHHHHHHHHHcccccEEEEccEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccccccccEEEEEEccccccccccccccHcHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccEcEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccHHHHHHHHHHcHHHccHHHHHHHHHHcccccccccHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEEEcHHHHccccccccccHHHHccccccccccccccHHHHHHcccccEEEEEHHHHHHcHHHHHHHHHHHHccccccccccEEEcEcEEEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHcccccHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHEEEEEccccccccccccccccccEEEEc
MRIVMTIMKndsnglglglGFGLsvqlsgldiiSIEAVVSKFVsgecekgsvkmkfEEVDVSIkrnlgpgvvvnygDLKVFvnnnkcnndddddnksgnnetsDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSiekdwdllllpitslrtssladschrsslmesfvpfggffptpsefknplgglcqnvsrcqqcsEKCEQEIIasskggftaSIADQCQSVLpswlqmaepdsnkaldlktKEDGLALRSKITKKWDDICQSLhrtqslqvgsqfptvvGFQFlqdkkenannsgsstnasvnggsyvnvysgipidsenvsasrsvfpfhtvsgakndSLLSKLREkssnadldsggsrspcclsnssvddgsrksptpvtsvttdlglgllgigsaptsnepkepiskdLTERSQelsgccsatvngsisnqlaqssssscpdlncqfdlSNWKTLFRALTEKIDWQDEAISVISQTIAQrrtghedhhgasprrdiwfnftgpdlcgkRKIAIALAEIIYggkenficadlcpqdgemnnppkfyhqvvggdsvqfrGKTLADYVAWELLKKPLSVVylenvdkadVHVQNSLSKaiqtgklpdsygrevsVSNAIFVTASSfvedarilpsemkdckfseEKIYRAKSRLTQILiepalvnrsssqklsasetsegmshqKLLNKrkligrndnpqqhdtsEMVKrahrsptrnldlnlpaeedevlvldsdddrnsdssenTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEghfleeltpgvclppklvln
MRIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFvsgecekgsvkmkfeevdvsikrnlgpgvvvNYGDLKVFVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPdsnkaldlktKEDGLALRSKITKKWDDICQSLHrtqslqvgsqFPTVVGFQFLQDKKENAnnsgsstnasvngGSYVNVYSGIPIDSENVSASRSVFPFhtvsgakndslLSKLREKSSnadldsggsrspCCLSnssvddgsrkspTPVTSVTTDLGLGLLGigsaptsnepkepISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQrrtghedhhgasprrdiWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAiqtgklpdsygREVSVSNAIFVTassfvedarilpsemkdckfsEEKIYRAKSRLTQILiepalvnrsssqklsasetsegmshqKLLNkrkligrndnpqqhdtsemvkrahrsptrnldlnlpaeEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLeeltpgvclppklvln
MRIVMTIMKNDsnglglglgfglsvqlsglDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVnnnkcnndddddnksgnnETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKEnannsgsstnasvnggsYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDlglgllgigSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQsssssCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAeedevlvldsdddrnsdssENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
****MTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNK******************AVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQ*****************GLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFL*********************SYVNVYSGIPID**********F***********************************************************LGLGLLG**************************************************DLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQ*************RRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPAL*************************************************************************************SWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPK****
*RIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFV*******SVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKS**NETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPIT********************VPFGGFFPTPS*********CQNVSRCQQCSEKCEQEI********************************************ALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFL********************************************************************************************************GL****************************************************************WKTLFRALTEKIDWQDEAISVISQTIAQ***************DIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVE**********************KSRLTQILIEPALVNRSSSQKLSAS*****************************************RNLDLNLPAEE*************************DFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVL*
MRIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKEN********NASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLR***************PCCLS****************SVTTDLGLGLLGIGSA**********************GCCSATVNGSISN***********DLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIA***********ASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVN*******************KLLNKRKLIGRNDN****************PTRNLDLNLPAEEDEVLVLDS***********TKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
MRIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLR***************SFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQD***************************************SVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRS**************************LGLGLLGIGSAPTSN****PISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIVMTIMKNDSNGLGLGLGFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNEPKEPISKDLTERSQELSGCCSATVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query884 2.2.26 [Sep-21-2011]
Q8EU05809 Chaperone protein ClpB OS yes no 0.208 0.227 0.299 4e-12
Q826F2879 Chaperone protein ClpB 2 yes no 0.167 0.168 0.279 2e-11
Q53LY0932 Chaperone protein ClpC3, no no 0.166 0.157 0.298 5e-11
Q2QVG9919 Chaperone protein ClpC2, no no 0.230 0.221 0.254 7e-11
Q7F9I1918 Chaperone protein ClpC1, no no 0.230 0.222 0.258 1e-10
P0A522848 Probable ATP-dependent Cl yes no 0.174 0.181 0.277 2e-10
P0A523848 Probable ATP-dependent Cl yes no 0.174 0.181 0.277 2e-10
Q72AW6865 Chaperone protein ClpB OS yes no 0.167 0.171 0.308 3e-10
P24428848 Probable ATP-dependent Cl yes no 0.174 0.181 0.277 3e-10
Q9PKA8870 Probable ATP-dependent Cl yes no 0.170 0.173 0.257 3e-10
>sp|Q8EU05|CLPB_OCEIH Chaperone protein ClpB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpB PE=3 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 110/224 (49%), Gaps = 40/224 (17%)

Query: 474 RALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIW-FNFTGPDLCGKRKIAIAL 532
           + L +++  Q EA++ +++ I + R G +D     P+R I  F F GP   GK ++A AL
Sbjct: 507 KILHDRVIGQSEAVNAVAKAIRRARAGLKD-----PKRPIGSFIFLGPTGVGKTELARAL 561

Query: 533 AEIIYGGKENFICADLCPQDGE------MNNPPKFYHQVVGGDSVQFRGKTLADYVAWEL 586
           AE+++  ++  I  D+            + +PP +    VG D     G  L + V    
Sbjct: 562 AEVMFADEDAMIRIDMSEYMERHATSRLVGSPPGY----VGYDE----GGQLTEKVR--- 610

Query: 587 LKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARI 646
            +KP SVV L+ V+KA   V N L + ++ G+L DS GR V   N + +  S+      +
Sbjct: 611 -RKPYSVVLLDEVEKAHPEVFNILLQVLEDGRLTDSKGRVVDFRNTVIIMTSN------V 663

Query: 647 LPSEMKDCKF------SEEKIYR-AKSRLTQIL---IEPALVNR 680
             SE+K  K+      +EEK Y+  KS++ + L     P  +NR
Sbjct: 664 GASELKRNKYVGFALDNEEKDYKDMKSKVIEELKKAFRPEFLNR 707
Part of a stress-induced multi-chaperone system, it is involved in the recovery of the cell from heat-induced damage, in cooperation with DnaK, DnaJ and GrpE. Acts before DnaK, in the processing of protein aggregates. Protein binding stimulates the ATPase activity; ATP hydrolysis unfolds the denatured protein aggregates, which probably helps expose new hydrophobic binding sites on the surface of ClpB-bound aggregates, contributing to the solubilization and refolding of denatured protein aggregates by DnaK.
Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) (taxid: 221109)
>sp|Q826F2|CLPB2_STRAW Chaperone protein ClpB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpB2 PE=3 SV=1 Back     alignment and function description
>sp|Q53LY0|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1 Back     alignment and function description
>sp|Q2QVG9|CLPC2_ORYSJ Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2 Back     alignment and function description
>sp|Q7F9I1|CLPC1_ORYSJ Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2 Back     alignment and function description
>sp|P0A522|CLPC_MYCTU Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium tuberculosis GN=clpC PE=1 SV=1 Back     alignment and function description
>sp|P0A523|CLPC_MYCBO Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|Q72AW6|CLPB_DESVH Chaperone protein ClpB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|P24428|CLPC_MYCLE Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium leprae (strain TN) GN=clpC PE=3 SV=2 Back     alignment and function description
>sp|Q9PKA8|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query884
255585368 1112 conserved hypothetical protein [Ricinus 0.951 0.756 0.533 0.0
225448447 1105 PREDICTED: uncharacterized protein LOC10 0.941 0.752 0.514 0.0
449499195 1109 PREDICTED: uncharacterized LOC101216395 0.935 0.745 0.457 0.0
147783009 1166 hypothetical protein VITISV_024923 [Viti 0.934 0.708 0.467 0.0
449441584 1123 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.935 0.736 0.446 0.0
225434576 1106 PREDICTED: uncharacterized protein LOC10 0.944 0.754 0.432 1e-178
147866119 1088 hypothetical protein VITISV_006557 [Viti 0.924 0.750 0.417 1e-164
224106239 1063 predicted protein [Populus trichocarpa] 0.885 0.736 0.411 1e-159
356569296942 PREDICTED: uncharacterized protein LOC10 0.820 0.769 0.445 1e-158
224112493628 predicted protein [Populus trichocarpa] 0.691 0.972 0.515 1e-156
>gi|255585368|ref|XP_002533380.1| conserved hypothetical protein [Ricinus communis] gi|223526773|gb|EEF28998.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/876 (53%), Positives = 605/876 (69%), Gaps = 35/876 (3%)

Query: 21   FGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKV 80
            + L V+LSGL +I IE+ V KF S   +KG V ++FEEV   +++NLGPG+VVN GDLK 
Sbjct: 260  YVLPVELSGLRVICIESDVMKFASENFDKGCVDLRFEEVGRFVEQNLGPGLVVNLGDLKA 319

Query: 81   FVNNNKCNNDDDDDNKSGNNETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFV 140
            F+++       ++D  + +N  +D +SY+V +LTR+LQL+G +VWLIG  A+YE YLKFV
Sbjct: 320  FISS-------ENDYSNSSNGLNDLMSYIVEKLTRMLQLYGRKVWLIGTTASYEGYLKFV 372

Query: 141  SRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFVPFGGFFPTPSEFKNPLGGLCQ 200
            SRF S+EKDWDL LLPITS RTS + +SC RSSLMESF+PFGGFF TPSE    L    Q
Sbjct: 373  SRFPSVEKDWDLQLLPITSFRTS-MPESCPRSSLMESFIPFGGFFSTPSELNGSLSSSYQ 431

Query: 201  NVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKEDGL 260
             +SRC  C+EKCEQE++A SKGG  AS+ADQ QS LPSWLQMAE  +NK LD+KT++DG 
Sbjct: 432  CISRCHLCNEKCEQEVLAVSKGGCVASVADQYQSNLPSWLQMAELGTNKGLDVKTRDDGD 491

Query: 261  ALRSKIT---KKWDDICQSLHRTQ---SLQVGSQFPTVVGFQFLQDKKENA-NNSGSSTN 313
             L +K+    KKWD IC  LH T+   S  + S FPTVVGFQ ++DKK++A   S ++TN
Sbjct: 492  VLSAKVAGLQKKWDSICWRLHLTRPQGSNTLPSGFPTVVGFQLVEDKKDDAEKGSSNNTN 551

Query: 314  ASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGS 373
            A ++G   +NV    PID + +S  +   P    S A  +S+  +    S   D +S G 
Sbjct: 552  APLDGNRCMNV----PIDLQKISRRQLGVPLSAASVANTESV-KQWERPSKEEDHESDGL 606

Query: 374  RSPCCLSNSSVDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNEPKEPISKDLTERSQEL 433
            RSPC  SNSS+ DG+R SPT  TSVTTDLGL +  I    TS + K+P +K   E S++L
Sbjct: 607  RSPCSYSNSSIADGNRASPTSATSVTTDLGLRISPIS---TSYDTKKPENKHYVELSRDL 663

Query: 434  SGCCSA---TVNGSISNQLAQSSSSSCPDLNCQFDLSNWKTLFRALTEKIDWQDEAISVI 490
            SG  S     +NGSIS+ LA SSS S  D+  QFD +++K L RALTEK+  QDEA+ +I
Sbjct: 664  SGSFSPNNDVINGSISDHLAHSSSFSSLDIGRQFDPTSFKMLVRALTEKVSCQDEAVHLI 723

Query: 491  SQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCP 550
            SQTIA  RT +E H G+S +RDIWFNF GPD C KRKIA ALAEII+G  EN I ADL P
Sbjct: 724  SQTIAHYRTRNERHQGSSLKRDIWFNFLGPDRCSKRKIAAALAEIIFGSSENLISADLSP 783

Query: 551  QDGEMNNPPKFYHQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSL 610
            QDG +N     + + V    V FRGKT+ DYVA EL KKPL+VV+LENVDKADV  QNSL
Sbjct: 784  QDGIVN----MHSEEVHAYDVMFRGKTIIDYVAGELGKKPLAVVFLENVDKADVQAQNSL 839

Query: 611  SKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKD-CKFSEEKIYRAKSRLT 669
            S+AI+TGK  DS+GREV ++NAIFVT S+  +D ++  S  KD   +SEE+I R K +  
Sbjct: 840  SRAIRTGKFSDSHGREVGINNAIFVTTSTLGDDKKL--SSTKDFSTYSEERILRIKGQPM 897

Query: 670  QILIEPALVNRSSSQKLSASETSEGM-SHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRS 728
            Q+LIE A   +   Q L+ S     + S    +NKRKL+G N N  +H TSE+ KRAH++
Sbjct: 898  QMLIEQAPAEKMV-QNLNHSPVMRKVPSSSVFVNKRKLVGANQNVNRHKTSEVAKRAHKT 956

Query: 729  PTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAE 788
             +R LDLNLPAEE+++ ++++ D  N   S N+K+WLQDF +Q  +IV FK F+FDAL E
Sbjct: 957  SSRYLDLNLPAEENDMQIIENGDSDNDSMSSNSKAWLQDFLDQLDRIVVFKPFDFDALGE 1016

Query: 789  KILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSESNRVIEDWLEKVLVRGFLDAQE 848
            +IL  IN SF K VGSECLL+ID KV EQLLAAAYLS   RV+E+W+E+VL +GF++  E
Sbjct: 1017 RILTGINDSFHKIVGSECLLDIDSKVTEQLLAAAYLSPRKRVVEEWMEQVLNKGFVEVLE 1076

Query: 849  KYNLTANSIVKLVACEGHFLEELTPGVCLPPKLVLN 884
            +YNL+A+SIVKLV+C+G FL+E   G  LP K++LN
Sbjct: 1077 RYNLSAHSIVKLVSCKGLFLDEDMAGGHLPSKIILN 1112

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448447|ref|XP_002272110.1| PREDICTED: uncharacterized protein LOC100260392 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449499195|ref|XP_004160747.1| PREDICTED: uncharacterized LOC101216395 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147783009|emb|CAN72301.1| hypothetical protein VITISV_024923 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441584|ref|XP_004138562.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101216395 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225434576|ref|XP_002279036.1| PREDICTED: uncharacterized protein LOC100241532 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866119|emb|CAN78825.1| hypothetical protein VITISV_006557 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106239|ref|XP_002314097.1| predicted protein [Populus trichocarpa] gi|222850505|gb|EEE88052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356569296|ref|XP_003552839.1| PREDICTED: uncharacterized protein LOC100786125 [Glycine max] Back     alignment and taxonomy information
>gi|224112493|ref|XP_002316209.1| predicted protein [Populus trichocarpa] gi|222865249|gb|EEF02380.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query884
TAIR|locus:2065074910 AT2G40130 [Arabidopsis thalian 0.228 0.221 0.405 2e-55
TAIR|locus:2007412979 AT1G07200 "AT1G07200" [Arabido 0.212 0.192 0.405 2.2e-70
TAIR|locus:20456531002 AT2G29970 [Arabidopsis thalian 0.209 0.184 0.452 1.1e-63
TAIR|locus:2172585990 AT5G57710 [Arabidopsis thalian 0.243 0.217 0.316 1.8e-39
TAIR|locus:2118806924 AT4G30350 "AT4G30350" [Arabido 0.148 0.141 0.353 2.2e-31
TAIR|locus:2079904815 AT3G52490 [Arabidopsis thalian 0.238 0.258 0.245 2.1e-17
UNIPROTKB|Q889C2854 clpB "Chaperone protein ClpB" 0.174 0.180 0.280 2.2e-08
UNIPROTKB|Q3A9N1811 CHY_2348 "Negative regulator o 0.255 0.278 0.263 2.5e-08
TIGR_CMR|CHY_2348811 CHY_2348 "negative regulator o 0.255 0.278 0.263 2.5e-08
UNIPROTKB|P0A522848 clpC "Probable ATP-dependent C 0.219 0.228 0.266 3.7e-08
TAIR|locus:2065074 AT2G40130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 2.0e-55, Sum P(3) = 2.0e-55
 Identities = 94/232 (40%), Positives = 129/232 (55%)

Query:   510 RRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVGG- 568
             RRD+W N  GPD  GKR++++ LAEI+Y  +  F+  DL   +           Q +GG 
Sbjct:   571 RRDVWLNLVGPDTVGKRRMSLVLAEIVYQSEHRFMAVDLGAAE-----------QGMGGC 619

Query:   569 -DSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREV 627
              D ++ RGKT+ D++   + + P  VV+LEN++KAD  +Q SLSKAI+TGK  DS+GREV
Sbjct:   620 DDPMRLRGKTMVDHIFEVMCRNPFCVVFLENIEKADEKLQMSLSKAIETGKFMDSHGREV 679

Query:   628 SVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLS 687
              + N IFV  SS    A           +SEEK+ R K R  +I IE       SS  L 
Sbjct:   680 GIGNTIFVMTSSSQGSATTT-------SYSEEKLLRVKGRQVEIRIETV-----SS--LP 725

Query:   688 ASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPA 739
                +  G +    +NKRKL+G  +  +  DT E VKR +R+    LDLNLPA
Sbjct:   726 MVRSVYGPTS---VNKRKLMGLGNLQETKDTVESVKRLNRTTNGVLDLNLPA 774
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2007412 AT1G07200 "AT1G07200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045653 AT2G29970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172585 AT5G57710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118806 AT4G30350 "AT4G30350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079904 AT3G52490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q889C2 clpB "Chaperone protein ClpB" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q3A9N1 CHY_2348 "Negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2348 CHY_2348 "negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P0A522 clpC "Probable ATP-dependent Clp protease ATP-binding subunit" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 6e-14
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 1e-12
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 7e-08
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 2e-07
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 3e-07
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 3e-06
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 9e-05
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.002
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 75.8 bits (187), Expect = 6e-14
 Identities = 62/222 (27%), Positives = 96/222 (43%), Gaps = 41/222 (18%)

Query: 474 RALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDI-WFNFTGPDLCGKRKIAIAL 532
           R L +++  QDEA+  +S  I + R G  D     P R I  F F GP   GK ++A AL
Sbjct: 487 RRLKKRVIGQDEAVEAVSDAIRRARAGLGD-----PNRPIGSFLFLGPTGVGKTELAKAL 541

Query: 533 AEIIYGGKENFICADLCPQDGEMNNPPKFYHQV----------VGGDSVQFRGKTLADYV 582
           AE ++G ++  I  D+     E        H V          VG +     G  L + V
Sbjct: 542 AEALFGDEQALIRIDM----SEYMEK----HSVSRLIGAPPGYVGYEE----GGQLTEAV 589

Query: 583 AWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVE 642
                +KP SV+ L+ ++KA   V N L + +  G+L D  GR V   N I +  +S   
Sbjct: 590 R----RKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIII-MTSNAG 644

Query: 643 DARILPSEMKDCKFSEEKIYRA-KSRLTQILIE---PALVNR 680
            +  +   ++D    +     A K  + + L +   P  +NR
Sbjct: 645 -SEEI---LRDADGDDFADKEALKEAVMEELKKHFRPEFLNR 682

Length = 786
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 884
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.97
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.96
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.9
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.88
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.87
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.82
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.8
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.79
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.76
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.74
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.73
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.7
COG2204464 AtoC Response regulator containing CheY-like recei 99.67
CHL00181287 cbbX CbbX; Provisional 99.63
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.63
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.62
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.58
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.57
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.57
PRK11608326 pspF phage shock protein operon transcriptional ac 99.52
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.52
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.51
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.5
PRK15424538 propionate catabolism operon regulatory protein Pr 99.49
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.49
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.49
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.47
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.44
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.43
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.42
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.4
COG1221403 PspF Transcriptional regulators containing an AAA- 99.4
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.37
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.35
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.31
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.3
PRK13531498 regulatory ATPase RavA; Provisional 99.3
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.29
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.28
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.28
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.27
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.27
PLN03025319 replication factor C subunit; Provisional 99.26
PRK13342413 recombination factor protein RarA; Reviewed 99.26
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.25
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.24
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.24
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.24
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.21
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.21
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.19
PRK15115444 response regulator GlrR; Provisional 99.19
PRK13341 725 recombination factor protein RarA/unknown domain f 99.19
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.18
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.18
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.17
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.15
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.15
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.15
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.14
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.12
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.11
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.11
CHL00195489 ycf46 Ycf46; Provisional 99.11
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.11
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.1
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.1
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 99.09
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.09
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.09
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.09
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.06
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.04
KOG2028554 consensus ATPase related to the helicase subunit o 99.04
PRK12402337 replication factor C small subunit 2; Reviewed 99.04
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.04
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.04
PRK06893229 DNA replication initiation factor; Validated 99.03
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.03
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.03
COG0714329 MoxR-like ATPases [General function prediction onl 99.01
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.0
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.0
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.0
PHA02544316 44 clamp loader, small subunit; Provisional 98.99
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.99
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.98
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.98
PRK03992389 proteasome-activating nucleotidase; Provisional 98.98
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.97
PRK04195482 replication factor C large subunit; Provisional 98.96
PRK00440319 rfc replication factor C small subunit; Reviewed 98.96
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.95
PRK08084235 DNA replication initiation factor; Provisional 98.94
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.93
PF07726131 AAA_3: ATPase family associated with various cellu 98.93
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.91
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.91
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.91
PRK08727233 hypothetical protein; Validated 98.91
smart00350509 MCM minichromosome maintenance proteins. 98.91
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.89
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.88
PF00004132 AAA: ATPase family associated with various cellula 98.88
PRK07940394 DNA polymerase III subunit delta'; Validated 98.88
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.86
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.84
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.84
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.84
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.82
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.82
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.82
PHA02244383 ATPase-like protein 98.81
CHL00176638 ftsH cell division protein; Validated 98.81
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.8
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.8
PRK09112351 DNA polymerase III subunit delta'; Validated 98.79
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.75
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.75
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.74
PRK05642234 DNA replication initiation factor; Validated 98.74
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.74
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.74
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.73
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.72
PRK07399314 DNA polymerase III subunit delta'; Validated 98.69
PRK07471365 DNA polymerase III subunit delta'; Validated 98.69
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 98.69
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.69
PTZ001121164 origin recognition complex 1 protein; Provisional 98.69
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.68
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.65
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.64
PRK13765 637 ATP-dependent protease Lon; Provisional 98.64
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.63
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.63
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.62
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.62
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.61
PRK05564313 DNA polymerase III subunit delta'; Validated 98.61
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.6
PRK10865 857 protein disaggregation chaperone; Provisional 98.58
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.56
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.56
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 98.55
PRK00149450 dnaA chromosomal replication initiation protein; R 98.55
CHL00095 821 clpC Clp protease ATP binding subunit 98.52
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 98.52
PRK08058329 DNA polymerase III subunit delta'; Validated 98.5
KOG0736953 consensus Peroxisome assembly factor 2 containing 98.5
CHL00206 2281 ycf2 Ycf2; Provisional 98.49
PRK12422445 chromosomal replication initiation protein; Provis 98.48
KOG0734752 consensus AAA+-type ATPase containing the peptidas 98.48
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.48
PRK06871325 DNA polymerase III subunit delta'; Validated 98.47
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.46
PRK14087450 dnaA chromosomal replication initiation protein; P 98.45
PRK04132846 replication factor C small subunit; Provisional 98.44
PRK08769319 DNA polymerase III subunit delta'; Validated 98.44
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.42
PRK07993334 DNA polymerase III subunit delta'; Validated 98.42
PRK14086617 dnaA chromosomal replication initiation protein; P 98.41
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.41
PRK14088440 dnaA chromosomal replication initiation protein; P 98.4
PRK06090319 DNA polymerase III subunit delta'; Validated 98.4
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.38
PRK05707328 DNA polymerase III subunit delta'; Validated 98.38
PRK09087226 hypothetical protein; Validated 98.38
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.35
PRK06620214 hypothetical protein; Validated 98.34
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.34
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.31
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 98.26
KOG0731774 consensus AAA+-type ATPase containing the peptidas 98.26
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.25
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.24
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 98.22
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.2
PRK12377248 putative replication protein; Provisional 98.19
PRK08699325 DNA polymerase III subunit delta'; Validated 98.18
PRK06964342 DNA polymerase III subunit delta'; Validated 98.16
smart00382148 AAA ATPases associated with a variety of cellular 98.15
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.15
PRK09862506 putative ATP-dependent protease; Provisional 98.13
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.1
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.1
PRK05917290 DNA polymerase III subunit delta'; Validated 98.09
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.07
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.06
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.03
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.02
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 97.94
COG0593408 DnaA ATPase involved in DNA replication initiation 97.92
PRK08116268 hypothetical protein; Validated 97.91
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.91
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 97.89
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.87
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 97.85
PRK07276290 DNA polymerase III subunit delta'; Validated 97.85
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 97.82
PRK06835329 DNA replication protein DnaC; Validated 97.78
PF13173128 AAA_14: AAA domain 97.77
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.77
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 97.77
PRK06526254 transposase; Provisional 97.72
PRK08939306 primosomal protein DnaI; Reviewed 97.72
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 97.71
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.69
PRK07952244 DNA replication protein DnaC; Validated 97.69
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.69
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.68
PRK05818261 DNA polymerase III subunit delta'; Validated 97.67
PRK08181269 transposase; Validated 97.63
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.57
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 97.57
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.57
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.53
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.47
PRK06921266 hypothetical protein; Provisional 97.46
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.45
PRK09183259 transposase/IS protein; Provisional 97.44
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.41
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.41
KOG0480764 consensus DNA replication licensing factor, MCM6 c 97.37
PRK07132299 DNA polymerase III subunit delta'; Validated 97.32
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.32
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.31
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.2
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 97.12
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.12
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 97.06
PRK15455 644 PrkA family serine protein kinase; Provisional 97.05
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 97.0
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.94
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 96.93
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.92
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.75
PF05729166 NACHT: NACHT domain 96.68
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.67
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.61
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.55
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.43
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.4
PRK04296190 thymidine kinase; Provisional 96.33
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 96.31
PRK06581263 DNA polymerase III subunit delta'; Validated 96.27
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.25
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 96.25
KOG1514767 consensus Origin recognition complex, subunit 1, a 96.24
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.22
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.2
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.18
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.13
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.09
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.06
PRK14974336 cell division protein FtsY; Provisional 96.06
KOG0736 953 consensus Peroxisome assembly factor 2 containing 96.04
PRK10536262 hypothetical protein; Provisional 96.03
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 96.03
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.98
TIGR00064272 ftsY signal recognition particle-docking protein F 95.83
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.79
PRK06696223 uridine kinase; Validated 95.78
PRK10867433 signal recognition particle protein; Provisional 95.73
PHA00729226 NTP-binding motif containing protein 95.68
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.66
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.62
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.58
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 95.56
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.51
KOG0481729 consensus DNA replication licensing factor, MCM5 c 95.47
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 95.46
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.45
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.44
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.44
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.42
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.4
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.4
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.35
PHA02774613 E1; Provisional 95.34
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 95.23
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.23
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.21
PRK00131175 aroK shikimate kinase; Reviewed 95.16
TIGR00959428 ffh signal recognition particle protein. This mode 95.07
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.05
PRK10416318 signal recognition particle-docking protein FtsY; 95.01
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.97
PRK08118167 topology modulation protein; Reviewed 94.92
PRK13833323 conjugal transfer protein TrbB; Provisional 94.92
PRK00771437 signal recognition particle protein Srp54; Provisi 94.89
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.88
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 94.88
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.87
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.79
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.69
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 94.67
PRK13947171 shikimate kinase; Provisional 94.63
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.59
PRK13851344 type IV secretion system protein VirB11; Provision 94.59
PRK05541176 adenylylsulfate kinase; Provisional 94.53
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.45
PF13479213 AAA_24: AAA domain 94.45
PRK10436462 hypothetical protein; Provisional 94.44
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.4
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.38
PRK03839180 putative kinase; Provisional 94.36
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.23
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.13
PRK06762166 hypothetical protein; Provisional 94.11
PF04851184 ResIII: Type III restriction enzyme, res subunit; 94.09
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.07
KOG0482721 consensus DNA replication licensing factor, MCM7 c 94.07
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.06
PRK08233182 hypothetical protein; Provisional 94.02
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.98
PRK07261171 topology modulation protein; Provisional 93.97
PRK00625173 shikimate kinase; Provisional 93.77
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.73
PRK06067234 flagellar accessory protein FlaH; Validated 93.73
PLN02200234 adenylate kinase family protein 93.69
PRK06217183 hypothetical protein; Validated 93.67
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 93.59
PRK05480209 uridine/cytidine kinase; Provisional 93.58
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 93.54
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.52
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.49
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.49
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.48
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.4
PRK03846198 adenylylsulfate kinase; Provisional 93.33
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 93.31
PRK00889175 adenylylsulfate kinase; Provisional 93.27
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 93.25
PHA01747425 putative ATP-dependent protease 93.21
PRK08154309 anaerobic benzoate catabolism transcriptional regu 93.18
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 93.16
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 93.08
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.0
PRK06547172 hypothetical protein; Provisional 92.93
PRK13949169 shikimate kinase; Provisional 92.92
PRK07667193 uridine kinase; Provisional 92.85
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 92.79
PRK03731171 aroL shikimate kinase II; Reviewed 92.68
PRK14532188 adenylate kinase; Provisional 92.61
PRK13948182 shikimate kinase; Provisional 92.59
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 92.58
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.57
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 92.51
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.5
cd03115173 SRP The signal recognition particle (SRP) mediates 92.46
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 92.44
PRK04220301 2-phosphoglycerate kinase; Provisional 92.32
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 92.25
PRK09270229 nucleoside triphosphate hydrolase domain-containin 92.24
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.23
PRK11823446 DNA repair protein RadA; Provisional 92.22
PRK14530215 adenylate kinase; Provisional 92.16
PTZ00088229 adenylate kinase 1; Provisional 92.15
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 92.15
PRK05057172 aroK shikimate kinase I; Reviewed 92.14
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.11
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 92.07
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.04
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 92.01
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.0
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 91.98
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.95
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 91.92
PRK13764602 ATPase; Provisional 91.91
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 91.88
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 91.82
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 91.81
PF1324576 AAA_19: Part of AAA domain 91.8
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 91.74
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.73
PRK13946184 shikimate kinase; Provisional 91.63
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.6
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 91.51
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 91.45
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 91.38
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 91.33
PRK10875615 recD exonuclease V subunit alpha; Provisional 91.33
PRK02496184 adk adenylate kinase; Provisional 91.2
PRK14531183 adenylate kinase; Provisional 91.14
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 91.11
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.04
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 91.03
PRK14527191 adenylate kinase; Provisional 91.0
PRK13975196 thymidylate kinase; Provisional 91.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 90.94
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 90.9
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 90.86
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 90.8
PRK00279215 adk adenylate kinase; Reviewed 90.75
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 90.73
PLN02165334 adenylate isopentenyltransferase 90.69
COG4088261 Predicted nucleotide kinase [Nucleotide transport 90.68
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 90.67
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 90.65
PRK14528186 adenylate kinase; Provisional 90.53
PRK09361225 radB DNA repair and recombination protein RadB; Pr 90.46
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 90.45
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 90.37
cd01394218 radB RadB. The archaeal protein radB shares simila 90.35
PRK14738206 gmk guanylate kinase; Provisional 90.34
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 90.31
COG1485367 Predicted ATPase [General function prediction only 90.29
PRK15453290 phosphoribulokinase; Provisional 90.25
PRK00300205 gmk guanylate kinase; Provisional 90.24
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 90.18
PRK05439311 pantothenate kinase; Provisional 90.16
PLN02924220 thymidylate kinase 90.11
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 90.1
PLN02840421 tRNA dimethylallyltransferase 90.03
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 90.02
PF1355562 AAA_29: P-loop containing region of AAA domain 89.95
cd01128249 rho_factor Transcription termination factor rho is 89.95
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 89.89
PLN02674244 adenylate kinase 89.85
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 89.82
PRK00698205 tmk thymidylate kinase; Validated 89.78
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 89.7
PRK13826 1102 Dtr system oriT relaxase; Provisional 89.64
PF05609465 LAP1C: Lamina-associated polypeptide 1C (LAP1C); I 89.63
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.63
PHA02624647 large T antigen; Provisional 89.61
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 89.58
PHA02530300 pseT polynucleotide kinase; Provisional 89.53
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 89.38
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 89.38
PLN02199303 shikimate kinase 89.32
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 89.26
PRK04040188 adenylate kinase; Provisional 89.21
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 89.16
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 89.08
cd03216163 ABC_Carb_Monos_I This family represents the domain 89.08
TIGR00376637 DNA helicase, putative. The gene product may repre 88.99
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 88.95
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 88.94
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 88.81
PRK04182180 cytidylate kinase; Provisional 88.77
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 88.74
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 88.73
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 88.67
PF12846304 AAA_10: AAA-like domain 88.63
PRK14737186 gmk guanylate kinase; Provisional 88.53
PTZ00301210 uridine kinase; Provisional 88.46
PF01057271 Parvo_NS1: Parvovirus non-structural protein NS1; 88.36
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.25
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 88.23
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 88.22
PRK12338319 hypothetical protein; Provisional 88.15
PRK12337475 2-phosphoglycerate kinase; Provisional 88.13
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 87.86
PRK09825176 idnK D-gluconate kinase; Provisional 87.8
COG0802149 Predicted ATPase or kinase [General function predi 87.8
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 87.78
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 87.75
PRK13973213 thymidylate kinase; Provisional 87.74
PRK12339197 2-phosphoglycerate kinase; Provisional 87.7
PRK14526211 adenylate kinase; Provisional 87.51
PLN02459261 probable adenylate kinase 87.45
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 87.34
PRK14529223 adenylate kinase; Provisional 87.22
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 87.22
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 87.2
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 87.19
PLN02796347 D-glycerate 3-kinase 87.13
PRK13768253 GTPase; Provisional 87.11
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 87.01
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 86.91
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 86.88
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 86.69
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 86.66
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 86.6
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 86.59
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 86.53
PRK10646153 ADP-binding protein; Provisional 86.53
PF13337457 Lon_2: Putative ATP-dependent Lon protease 86.38
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-74  Score=686.55  Aligned_cols=613  Identities=25%  Similarity=0.321  Sum_probs=437.4

Q ss_pred             CcCcccccCCcEEEEechhhcccccCcccchhhhhhHHHHHHHHHhcCCCcEEEEeccceeeecCCCCCCCCCCCCCCCC
Q 002758           20 GFGLSVQLSGLDIISIEAVVSKFVSGECEKGSVKMKFEEVDVSIKRNLGPGVVVNYGDLKVFVNNNKCNNDDDDDNKSGN   99 (884)
Q Consensus        20 ~~~~p~~l~~~~vi~l~~e~~~~~~~~~~~~~v~~k~~eL~~~v~~~~g~Gvvl~~GDLkw~ve~~~~~~~~~~~~~~~~   99 (884)
                      -+.+|.-|.+.+++.|.  +.....+.+.++|+|.|+++|...|++ +|+||||++|||+|+|+....            
T Consensus       234 ~G~vp~~l~~~~l~~l~--~g~l~aGa~~rge~E~rlk~l~k~v~~-~~~gvILfigelh~lvg~g~~------------  298 (898)
T KOG1051|consen  234 TGDVPETLKDKKLIALD--FGSLVAGAKRRGEFEERLKELLKEVES-GGGGVILFLGELHWLVGSGSN------------  298 (898)
T ss_pred             cCCCCccccccceEEEE--hhhcccCcccchHHHHHHHHHHHHHhc-CCCcEEEEecceeeeecCCCc------------
Confidence            35789866666666666  555667778889999999999999998 588999999999999997753            


Q ss_pred             CCCCchHHHHHHHHHHHHhhcCCeEEEEEehhhHHHHHhccccCCCccccCccceeeeccCCCCCCCccccCCccccccc
Q 002758          100 NETSDAVSYVVAQLTRLLQLHGGRVWLIGAAATYETYLKFVSRFSSIEKDWDLLLLPITSLRTSSLADSCHRSSLMESFV  179 (884)
Q Consensus       100 ~~~~~~~~~~V~El~rLl~~~g~rvWl~G~aaty~tYmkc~~~~PslE~~WdLq~v~I~s~~~~~~~~~~~~ssl~~s~~  179 (884)
                         |+ +-.+|.-|.-+|.. | .+|+||+ +||+||+||+.++|+||.+|+||+|+|||...  +.+.++..+.+ .++
T Consensus       299 ---~~-~~d~~nlLkp~L~r-g-~l~~IGa-tT~e~Y~k~iekdPalErrw~l~~v~~pS~~~--~~~iL~~l~~~-~e~  368 (898)
T KOG1051|consen  299 ---YG-AIDAANLLKPLLAR-G-GLWCIGA-TTLETYRKCIEKDPALERRWQLVLVPIPSVEN--LSLILPGLSER-YEV  368 (898)
T ss_pred             ---ch-HHHHHHhhHHHHhc-C-CeEEEec-ccHHHHHHHHhhCcchhhCcceeEeccCcccc--hhhhhhhhhhh-hcc
Confidence               33 33333334444442 3 4999998 69999999999999999999999999999763  33566665555 688


Q ss_pred             cCCCCCCCCCCCCCCCC-CCCCCCccchHhhhhHHHHHHHhhcCCCCCccccccCCCCCcccccccCCCcccccccccch
Q 002758          180 PFGGFFPTPSEFKNPLG-GLCQNVSRCQQCSEKCEQEIIASSKGGFTASIADQCQSVLPSWLQMAEPDSNKALDLKTKED  258 (884)
Q Consensus       180 p~~~~~s~~~~~~~~~~-~~~~~~~~C~~C~~~~e~e~~~~~~~~~~~s~~~~~~~~LP~WLq~~~~~~~~~~~~~~kdd  258 (884)
                      ++|.+++.......... ..+....||++|+.+|++|+++..+.         +...||+|||+++....+     .+++
T Consensus       369 ~hg~~~s~~a~~~a~~~s~~~~t~r~lpd~aidl~dEa~a~~~~---------~~~~lP~wL~~~~~~~~~-----~~~e  434 (898)
T KOG1051|consen  369 HHGVRISDESLFSAAQLSARYITLSFLPDCAIDLEDEAAALVKS---------QAESLPPWLQNLERVDIK-----LQDE  434 (898)
T ss_pred             ccCCcccccccccccchhhhhcccCcCchhcccHHHHHHHHHhh---------hhhhCCHHHHhhhhhhhh-----hHHH
Confidence            89999987766544433 34677899999999999999988653         256799999999743321     1222


Q ss_pred             hhhhhhHHhhhhHHhhhccccccccccCCCCCccccccccccccccCCCCCCCCCCccCCCccccccCCCCCCCcccccc
Q 002758          259 GLALRSKITKKWDDICQSLHRTQSLQVGSQFPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSAS  338 (884)
Q Consensus       259 ~~~~~~~~~kkW~~~C~~lh~~~~~~~~~~~~~~~g~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  338 (884)
                      ..    .++||||   +++|++....++      ..+.....     +.+-+|.         +..              
T Consensus       435 ~~----~L~kk~d---~~~h~r~~~~~~------~~~~~~~~-----~l~~~~~---------~~~--------------  473 (898)
T KOG1051|consen  435 IS----ELQKKWN---QALHKRPSLESL------APSKPTQQ-----PLSASVD---------SER--------------  473 (898)
T ss_pred             HH----HHHHhhh---hhhccccccccc------cccccccc-----cchhhhc---------cch--------------
Confidence            22    3599999   889987542321      10000000     0000010         000              


Q ss_pred             CccccccccccccccchhhhhhhcccccccCCCCCCCCccCCCCC-CCCCCCCCCCCCcceeeeccCCcccCCCCCCCCC
Q 002758          339 RSVFPFHTVSGAKNDSLLSKLREKSSNADLDSGGSRSPCCLSNSS-VDDGSRKSPTPVTSVTTDLGLGLLGIGSAPTSNE  417 (884)
Q Consensus       339 ~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~p~~~~~~~~~~~~-~~~~~~~sp~~~~~VttdL~Lg~~~~~~~~~~~~  417 (884)
                                         ++.++...         .+.++...+ ....+  .+ ...++.|||.+|..|+...     
T Consensus       474 -------------------s~~~~l~~---------~~~~~~~~~~~~k~~--r~-~d~~~~~~l~~~~~p~~~~-----  517 (898)
T KOG1051|consen  474 -------------------SVIEELKL---------KKNSLDRNSLLAKAH--RP-NDYTRETDLRYGRIPDELS-----  517 (898)
T ss_pred             -------------------hHHhhhcc---------ccCCcccchhhhccc--CC-CCcchhhhccccccchhhh-----
Confidence                               00000000         000000000 00111  11 3345789999999441110     


Q ss_pred             CCCCCcccccccccccccCccCccCCCcccccccCCC-CCC--CCCccccchHhHHHHHHHhhccCccchHHHHHHHHHH
Q 002758          418 PKEPISKDLTERSQELSGCCSATVNGSISNQLAQSSS-SSC--PDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTI  494 (884)
Q Consensus       418 ~~~~~~~~~~~~~~~~s~~~s~~~~~~~~~~~~~s~~-~~~--~~~~~~~d~e~lk~L~~~L~~~ViGQ~eAi~~Ia~aI  494 (884)
                      .+                  +.++.+ ++..++.+.+ +.+  .++..+.++++|+.|++.|.++|+||++|+.+|+.+|
T Consensus       518 ~~------------------~~~~~~-~~~~i~~~~s~~tgip~~~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~aIa~AI  578 (898)
T KOG1051|consen  518 EK------------------SNDNQG-GESDISEVVSRWTGIPVDRLAEAEAERLKKLEERLHERVIGQDEAVAAIAAAI  578 (898)
T ss_pred             hh------------------cccccC-CccchhhhhhhhcCCchhhhhhhHHHHHHHHHHHHHhhccchHHHHHHHHHHH
Confidence            11                  111111 2222233221 111  2455666889999999999999999999999999999


Q ss_pred             HHHhcCCCCCCCCCCCCceEEEEEcCCCCchHHHHHHHHHHHcCCCcceEEeccCCCCCCCCCCCCcc--cccccccccc
Q 002758          495 AQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFY--HQVVGGDSVQ  572 (884)
Q Consensus       495 ~~~rsg~~~~~~p~~k~~~~lLf~Gp~GvGKT~LA~aLAe~L~gs~~~fi~id~s~~~~e~~~~s~L~--p~gy~G~~~g  572 (884)
                      .+++.|+.++     +.++||+|.||+|+|||+||++||+.+||+++.||+|||++|..    +++++  ||||+|+.++
T Consensus       579 ~~sr~gl~~~-----~~~awflflGpdgvGKt~lAkaLA~~~Fgse~~~IriDmse~~e----vskligsp~gyvG~e~g  649 (898)
T KOG1051|consen  579 RRSRAGLKDP-----NPDAWFLFLGPDGVGKTELAKALAEYVFGSEENFIRLDMSEFQE----VSKLIGSPPGYVGKEEG  649 (898)
T ss_pred             HhhhcccCCC-----CCCeEEEEECCCchhHHHHHHHHHHHHcCCccceEEechhhhhh----hhhccCCCcccccchhH
Confidence            9999999877     34669999999999999999999999999999999999997642    66776  7888888776


Q ss_pred             ccccchHHHHHHHHHhCCCeEEEEccccccCHHHHHHHHHHHhCCeeeCCCCeEeecCceEEEEecCCCccccccccccc
Q 002758          573 FRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMK  652 (884)
Q Consensus       573 ~rgk~~l~~L~eal~~~p~~VIlLDEIEKa~~~vq~~Llq~le~G~l~ds~Gr~V~~~naI~IlTSN~g~~~~~~~~~~~  652 (884)
                             ++|+++++++|++|||||||||||+.+++.|+|+||+|+++|++||+|+|+|+|||||+|.++..+.-     
T Consensus       650 -------g~LteavrrrP~sVVLfdeIEkAh~~v~n~llq~lD~GrltDs~Gr~Vd~kN~I~IMTsn~~~~~i~~-----  717 (898)
T KOG1051|consen  650 -------GQLTEAVKRRPYSVVLFEEIEKAHPDVLNILLQLLDRGRLTDSHGREVDFKNAIFIMTSNVGSSAIAN-----  717 (898)
T ss_pred             -------HHHHHHHhcCCceEEEEechhhcCHHHHHHHHHHHhcCccccCCCcEeeccceEEEEecccchHhhhc-----
Confidence                   89999999999999999999999999999999999999999999999999999999999998764320     


Q ss_pred             cCCchhHHHHHhhhhhhhhhccccccccccccccccccccccchhhhhhhhhhccCCCCCCCCCchhHHHHhhcCCCCcc
Q 002758          653 DCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQKLLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRN  732 (884)
Q Consensus       653 ~~~fseeki~~ak~~~l~i~i~~~~~~~~~~~~v~~~~~~~~~~~p~~~~KRk~~~~~~~~~~~~~~~~~K~~~~~s~~~  732 (884)
                      ... .+++++            ...+                  +      +.           .+....+++.....  
T Consensus       718 ~~~-~~~~l~------------~~~~------------------~------~~-----------~~~~~k~~v~~~~~--  747 (898)
T KOG1051|consen  718 DAS-LEEKLL------------DMDE------------------K------RG-----------SYRLKKVQVSDAVR--  747 (898)
T ss_pred             ccc-cccccc------------cchh------------------h------hh-----------hhhhhhhhhhhhhh--
Confidence            111 121111            0000                  0      00           00000011100000  


Q ss_pred             cCCCCCcchhhhhhcCCCCCCCCCcccccccChhHHhcccceeeecCCCCHHHHHHHHHHHHHHHHhhhcCCCceEEeCH
Q 002758          733 LDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECLLEIDR  812 (884)
Q Consensus       733 lDLNl~~~e~e~~~~~~~~~~~~~~~~~~~~f~~efl~rID~IVvFkPLd~e~L~eIi~~~L~~~~~~l~g~gi~L~Idd  812 (884)
                                               -.+...|++||+||+|.+++|+|++.+++.+|+...+.+..+++.+.++.+.+.+
T Consensus       748 -------------------------~~~~~~~r~Ef~nrid~i~lf~~l~~~~~~~i~~~~~~e~~~r~~~~~~~~~v~~  802 (898)
T KOG1051|consen  748 -------------------------IYNKQFFRKEFLNRIDELDLNLPLDRDELIEIVNKQLTEIEKRLEERELLLLVTD  802 (898)
T ss_pred             -------------------------cccccccChHHhcccceeeeecccchhhHhhhhhhHHHHHHHHhhhhHHHHHHHH
Confidence                                     0011589999999999999999999999999999999999888877789999999


Q ss_pred             HHHHHHHHhccCCC-ChHHHHHHHHHHHHHHHHHHHHhcCCCCCcEEEEEeec
Q 002758          813 KVMEQLLAAAYLSE-SNRVIEDWLEKVLVRGFLDAQEKYNLTANSIVKLVACE  864 (884)
Q Consensus       813 eAle~La~~~~~~~-gaR~le~wIE~vl~~~L~~~~~~~~~~~~~~v~L~~~~  864 (884)
                      .+.+.++..+|... |||+|+++|++.|...|..... ..+....++++.+-.
T Consensus       803 ~~~~~v~~~~~d~~ygAr~ikr~i~~~~~~~la~~~l-~ei~~~~~~~i~~~~  854 (898)
T KOG1051|consen  803 RVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALL-GEVEDGLTERILVAD  854 (898)
T ss_pred             HHHhhhhhcCcChHHHhhHHHHHHHHHHHHHHhhhhe-eeecCCceEEEEecc
Confidence            99999999999988 9999999999999999999887 666667888886644

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF05609 LAP1C: Lamina-associated polypeptide 1C (LAP1C); InterPro: IPR008662 This entry contains Rattus norvegicus LAP1C proteins and several uncharacterised highly related sequences from both Mus sp Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
3pxi_A758 Structure Of Meca108:clpc Length = 758 3e-09
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 5e-09
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 9e-09
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 2e-08
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 4e-05
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 64/132 (48%), Gaps = 21/132 (15%)
Query: 509 PRRDIW-FNFTGPDLCGKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQVVG 567
           P+R I  F F GP   GK ++A ALAE I+G +E+ I  D+      M       H   G
Sbjct: 517 PKRPIGSFIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEY---MEK-----HSTSG 568
Query: 568 GDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREV 627
           G             +  ++ +KP SVV L+ ++KA   V N L + ++ G+L DS GR V
Sbjct: 569 G------------QLTEKVRRKPYSVVLLDAIEKAHPDVFNILLQVLEDGRLTDSKGRTV 616
Query: 628 SVSNAIFVTASS 639
              N I +  S+
Sbjct: 617 DFRNTILIMTSN 628
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query884
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 5e-07
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-05
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 74.1 bits (181), Expect = 1e-13
 Identities = 102/686 (14%), Positives = 196/686 (28%), Gaps = 203/686 (29%)

Query: 231 QCQSVLPSWLQMAEPDSNKALDLKTKEDGLALRSKITKK-WDDICQSLHR-TQSLQVGSQ 288
           Q + +L  +    E       D K  +D    +S ++K+  D I  S    + +L++   
Sbjct: 17  QYKDILSVF----EDAFVDNFDCKDVQD--MPKSILSKEEIDHIIMSKDAVSGTLRL--- 67

Query: 289 FPTVVGFQFLQDKKENANNSGSSTNASVNGGSYVNVYSGIPIDSENVSASRSVFPFHTVS 348
                 F  L  K+E                  V  +    +   N       + F    
Sbjct: 68  ------FWTLLSKQEEM----------------VQKFVE-EVLRIN-------YKF---- 93

Query: 349 GAKNDSLLSKLREKSSNADLDSG---GSRSPCCLSNSSVDDGSRKSPTPVTSVTTDL--- 402
                 L+S ++ +     + +      R      N      +     P   +   L   
Sbjct: 94  ------LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL 147

Query: 403 ----GL---GLLGIGSAPTSNEPKEPISKD-LTERSQELSGCCSATVNGSISNQLAQSSS 454
                +   G+LG G             K  +      L  C S  V   +  ++   + 
Sbjct: 148 RPAKNVLIDGVLGSG-------------KTWVA-----LDVCLSYKVQCKMDFKIFWLNL 189

Query: 455 SSC--PDLNCQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQ-----RRTGHEDHHGA 507
            +C  P+      L   + L   +      + +  S I   I       RR      +  
Sbjct: 190 KNCNSPET----VLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPY-- 243

Query: 508 SPR-----RDIW-------FNF------TGPD------LCGKRKIAIALAEIIYG----- 538
                    ++        FN       T         L       I+L           
Sbjct: 244 -ENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 539 GKENFI-CADLCPQDGEMNNPPKFYHQVVGGD--SVQFRGKTLADYVA-WELLKKPLSVV 594
            K   +   D  PQD     P     +V+  +   +    +++ D +A W+  K      
Sbjct: 303 VKSLLLKYLDCRPQD----LPR----EVLTTNPRRLSIIAESIRDGLATWDNWKHV---- 350

Query: 595 YLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSFVEDARILPSEMKDC 654
              N DK    +++SL+       L  +  R++    ++F         A I P+ +   
Sbjct: 351 ---NCDKLTTIIESSLNV------LEPAEYRKMFDRLSVFP------PSAHI-PTILL-S 393

Query: 655 KFSEEKIYRAKSRLTQILIEPALVNRSSSQ----------KLSASETSEGMSHQKLLNKR 704
               + I      +   L + +LV +   +          +L     +E   H+ +++  
Sbjct: 394 LIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHY 453

Query: 705 KLIGRNDN----PQQHD------------TSEMVKRAHRSPTRNLDLN-LPAEEDEVLVL 747
            +    D+    P   D              E  +R        LD   L  +    +  
Sbjct: 454 NIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQK----IRH 509

Query: 748 DSDDDRNSDSSENTKSWLQDFFNQRVKIVAFKAFNFDALAEKILKDINASFRKTVGSECL 807
           DS     S S  NT   LQ     +  I      + D   E+++  I   F   +    +
Sbjct: 510 DSTAWNASGSILNT---LQQLKFYKPYI-----CDNDPKYERLVNAI-LDFLPKIEENLI 560

Query: 808 LEIDRKVMEQLLAAAYLSESNRVIED 833
                 ++ ++   A ++E   + E+
Sbjct: 561 CSKYTDLL-RI---ALMAEDEAIFEE 582
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 884
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 8e-23
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 8e-14
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-04
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score = 97.9 bits (243), Expect = 8e-23
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 16/179 (8%)

Query: 465 DLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDI-WFNFTGPDLC 523
           +      L   L +++  QDEAI  ++  I + R G +D     P R I  F F GP   
Sbjct: 10  EREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKD-----PNRPIGSFLFLGPTGV 64

Query: 524 GKRKIAIALAEIIYGGKENFICADLCPQDGEMNNPPKFYHQV--VGGDSVQFRGKTLADY 581
           GK ++A  LA  ++  +E  I  D+     +        H V  + G    + G      
Sbjct: 65  GKTELAKTLAATLFDTEEAMIRIDMTEYMEK--------HAVSRLIGAPPGYVGYEEGGQ 116

Query: 582 VAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKLPDSYGREVSVSNAIFVTASSF 640
           +   + ++P SV+  + ++KA   V N L + +  G+L DS+GR V   N + +  S+ 
Sbjct: 117 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNL 175
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query884
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.94
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.91
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.66
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.59
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.57
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.56
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.51
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.48
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.48
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.47
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.45
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.42
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.41
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.39
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.37
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.32
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.31
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.18
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.17
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.04
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.98
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.88
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.8
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.8
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.62
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.41
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.0
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.06
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.67
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.64
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.58
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.53
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.53
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.32
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.23
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.01
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.98
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.68
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.58
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.56
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.55
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.5
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.49
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.47
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.44
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.41
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.29
d2qy9a2211 GTPase domain of the signal recognition particle r 95.27
d1okkd2207 GTPase domain of the signal recognition particle r 95.19
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.18
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.16
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.87
d1vmaa2213 GTPase domain of the signal recognition particle r 94.84
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.8
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.75
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.7
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.56
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.56
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.54
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.49
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.45
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.41
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.37
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.36
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.33
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.27
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.17
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.04
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.95
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.83
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.53
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.31
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.12
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.03
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.8
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.8
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.53
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.29
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.24
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.8
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.61
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.31
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.18
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.81
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 89.81
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.7
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 89.63
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.35
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 88.32
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.74
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 87.54
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 87.41
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.23
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.05
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.69
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 86.35
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.95
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 85.44
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.72
d1g2912240 Maltose transport protein MalK, N-terminal domain 84.23
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.65
d2awna2232 Maltose transport protein MalK, N-terminal domain 83.63
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 83.28
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 82.53
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 82.51
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 82.46
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.31
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 82.16
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.15
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 81.83
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 81.83
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.98
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 80.69
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 80.58
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 80.25
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 80.06
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=0  Score=351.12  Aligned_cols=298  Identities=18%  Similarity=0.226  Sum_probs=255.1

Q ss_pred             CCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             40005769999999616375626899999999999854888889999998618999737998068999999999739996
Q 002758          462 CQFDLSNWKTLFRALTEKIDWQDEAISVISQTIAQRRTGHEDHHGASPRRDIWFNFTGPDLCGKRKIAIALAEIIYGGKE  541 (884)
Q Consensus       462 ~~~d~e~lk~L~~~L~~~ViGQ~~Ai~~I~~aI~~~rsg~~~~~~p~~k~~~~lLl~Gp~GvGKt~lAraLAe~l~gs~~  541 (884)
                      .+.+.+++..|++.|.++|+||++|+..|+.++.++++|+..+++|.+    ++||+||+|+|||++|+.||+.+|+...
T Consensus         7 ~~~~~~~l~~l~~~L~~~v~GQ~~ai~~v~~~i~~~~~~l~~~~kp~~----~~lf~Gp~G~GKt~lak~la~~l~~~~~   82 (315)
T d1qvra3           7 LEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIG----SFLFLGPTGVGKTELAKTLAATLFDTEE   82 (315)
T ss_dssp             TCCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSE----EEEEBSCSSSSHHHHHHHHHHHHHSSGG
T ss_pred             HHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHCCCCCCCCCCE----EEEEECCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             587999999999995682708799999999999998657899888766----9999788862489999999998358875


Q ss_pred             CEEEECCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHCCEE
Q ss_conf             239940688888889999743--455566655543201177999999708970899833024699999999987727813
Q 002758          542 NFICADLCPQDGEMNNPPKFY--HQVVGGDSVQFRGKTLADYVAWELLKKPLSVVYLENVDKADVHVQNSLSKAIQTGKL  619 (884)
Q Consensus       542 ~fi~Idls~~~~~~~~~~sl~--p~g~~G~~e~~rgkt~~~~l~~al~~~P~~VIllDEIEka~~~vq~~Ll~ale~G~l  619 (884)
                      +|++++|+.+.. .+..+.++  |+||+|+.++       +.++++++++|++||+||||||||+.+|+.|++++++|++
T Consensus        83 ~~~~~~~~~~~~-~~~~~~L~g~~~gyvG~~~~-------~~l~~~~~~~p~~Vvl~DEieK~~~~v~~~ll~~l~~g~~  154 (315)
T d1qvra3          83 AMIRIDMTEYME-KHAVSRLIGAPPGYVGYEEG-------GQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRL  154 (315)
T ss_dssp             GEEEECTTTCCS-SGGGGGC---------------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEE
T ss_pred             CEEEEECCCCCC-CHHHHHHCCCCCCCCCCCCC-------CHHHHHHHHCCCCEEEEEHHHHCCHHHHHHHHHHHCCCCE
T ss_conf             348873155454-21566514899987674667-------8489999849983799714754078999899998613834


Q ss_pred             ECCCCEEEECCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             07999286348619999038884222465554667741579998631122542010000234433233343333321344
Q 002758          620 PDSYGREVSVSNAIFVTASSFVEDARILPSEMKDCKFSEEKIYRAKSRLTQILIEPALVNRSSSQKLSASETSEGMSHQK  699 (884)
Q Consensus       620 ~d~~Gr~V~l~naIiIlTsn~g~~~~~~~~~~~~~~f~Eeki~~~k~~~l~i~i~~~~~~~~~~~~v~~~~~~~~~~~p~  699 (884)
                      ++..||.++++|+|||+|||+|.+.+..                       ......                       
T Consensus       155 ~~~~gr~v~~~~~i~i~tsnlG~~~i~~-----------------------~~~~~~-----------------------  188 (315)
T d1qvra3         155 TDSHGRTVDFRNTVIILTSNLGSPLILE-----------------------GLQKGW-----------------------  188 (315)
T ss_dssp             CCSSSCCEECTTEEEEEECCTTHHHHHH-----------------------HHHTTC-----------------------
T ss_pred             ECCCCCEECCCCEEEEEECCCCHHHHHH-----------------------HCCCCC-----------------------
T ss_conf             2799968537542898742457677764-----------------------001122-----------------------


Q ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEECC
Q ss_conf             44343203789999887616888752179886567899710122210378888788730000367267740533034248
Q 002758          700 LLNKRKLIGRNDNPQQHDTSEMVKRAHRSPTRNLDLNLPAEEDEVLVLDSDDDRNSDSSENTKSWLQDFFNQRVKIVAFK  779 (884)
Q Consensus       700 ~~~kRk~~~~~~~~~~~~~~~~~K~~~~~s~~~lDLNlp~~e~e~~~~~~~~~~~~~~~~~~~~f~~efl~rID~iVvFk  779 (884)
                          .             ........                               .....+.|.|||++|+|.+++|+
T Consensus       189 ----~-------------~~~~~~~~-------------------------------~~~l~~~f~pEflnRid~Ii~F~  220 (315)
T d1qvra3         189 ----P-------------YERIRDEV-------------------------------FKVLQQHFRPEFLNRLDEIVVFR  220 (315)
T ss_dssp             ----C-------------HHHHHHHH-------------------------------HHHHHTTSCHHHHHTCSBCCBCC
T ss_pred             ----C-------------HHHHHHHH-------------------------------HHHHHHHCCHHHHHCCCEEEECC
T ss_conf             ----0-------------45556778-------------------------------88888623887872178054321


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCC-CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99999999999999999996641898368817999999998603988-81899999999999999999972487899489
Q 002758          780 AFNFDALAEKILKDINASFRKTVGSECLLEIDRKVMEQLLAAAYLSE-SNRVIEDWLEKVLVRGFLDAQEKYNLTANSIV  858 (884)
Q Consensus       780 PLd~~eL~eIi~~~L~~~~ekl~~~~i~LeIddevie~La~~~~~~~-GaR~Le~~iE~vl~~~L~e~~~~~~~~~~~~v  858 (884)
                      ||+.+++.+|+...+.+...++...++.+.++++++++|+..+|.+. |||+|++.|++.+.+.|++..+..+......|
T Consensus       221 ~L~~~~~~~I~~~~l~~l~~rl~~~~i~l~i~~~~~~~L~~~~y~~~~GAR~L~r~Ie~~i~~~La~~iL~~~~~~g~~i  300 (315)
T d1qvra3         221 PLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRV  300 (315)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHTTTCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEE
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             02454368999999999999987242022066999999999488987782108999999989999999983768998999


Q ss_pred             EEEEECC
Q ss_conf             9996348
Q 002758          859 KLVACEG  865 (884)
Q Consensus       859 ~Lv~~~~  865 (884)
                      ++...++
T Consensus       301 ~i~~~~~  307 (315)
T d1qvra3         301 QVDVGPA  307 (315)
T ss_dssp             EEECCTT
T ss_pred             EEEEECC
T ss_conf             9999799
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure