Citrus Sinensis ID: 002901

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------87
MELKQDQDWQECDQEQEEGSQSSNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNVKKKAKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSASSSKKRKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGKDQREVSTDDLRILMSL
cccccccccccccHHHHcccccccccEEEEEEEEEEEEEEEEccccccccEEEEEEccccccccccEEEEcccccEEEEEcHHHHHHHHHHHHcccEEEEEEEEccccccccccccEEEEEEccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHccccEEEEcHHHHHHccccccccccccEEEEEEEccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccccEEEEEEccccccccccccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccHHccccHHHHHHHHcc
ccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccccccccEEEEEcccccccccccHHHHHHHHHHHHcccEEEEEEEcccccccccEcccEEEEEEccHHHHHHHHHHHHHccccccccccccccHHHHcccHHcccccccccHHHHHHHHHHcHcccccccccccccHHEccccHHHHHHHHHHHHHHHccccccccHHHHcccEEEEcccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEccccccccHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHcccEEEEEHHHHHHHcccccccccEEEEEEEEEEccHHcccHHHHHHHHHHHHHHcccEEEcccHHHccHHHHHHHHHHHcccccccHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccHcHcHHHHHHHHHHHHHHccccHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEcccccHccHHHHHHHHHHHccccccccccccHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccccccEEEEEEEEcccccEEEEEccEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcc
melkqdqdwQECDqeqeegsqssneTYMLGFVIANIVGLqyysgtisgremvglvreplnpydsnaVKVLNTRTDQVGHIERSVAAVLAPlidsgmilvegivpntrskgnrfkipcqvhIFTRLEMFSIVKDVILEgglqlisgndvsfgLSEAMVVKerkgergvkSVDEIFKLVDKNVKKKAkmeameppkevIKSELFVhqkeglgwlvrrenseelppfweekgggfvNVLTnyhtdkrpeplrggifaddmglgKTLTLLSLIALdkcagvapgltgtnsldlnevedeemsassskkrkrgkmsnkgsargkkhktvntkmddnvkgksvgmlnksssfmgkkitlivcppsvfsTWITQLEEHTVPGMLKTYmyygdrtqdvEELKMYDLVLTTYSTLAIEEswlespvkkiEWWRVILDEAHVIKnanaqqsrtvtnlnakrrwvvtgtpiqngsfdLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLrrtkdkgliglqpKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTnlalcpsdvrsiipsntiedvsnnPDLLKKLVEVLqdgedfdcpicisppsdiiiTCCAHIFCRSCILKtlqhtkpccplcrhpllqsdlfssppessdmdiagktlknFTSSKVSALLTLLLQLrdkkpttksVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEefgnpgpggpTVLLASLKasgagvnlTAASRVFLlepwwnpaveEQAMDRVhrigqkedVKIVRLIVRNSIEERILELQDRKKKLAREAFRRkgkdqrevstDDLRILMSL
melkqdqdwqECDQEQEEGSQSSNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVpntrskgnrfKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMvvkerkgergvksvdeifklvdknvkkkakmeameppkevikselfVHQKEGLGWLVRRENSEELppfweekggGFVNVLTNYhtdkrpeplrggifaddMGLGKTLTLLSLIALDKCAGVAPGLtgtnsldlnevedeemsassskkrkrgkmsnkgsargkkhktvntkmddnvkgksvgmLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLaieeswlespvkkIEWWRVILDEAHViknanaqqsrtvtnlnakrrwvVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLaqgnrkglsRLQVLMStislrrtkdkgliglqpktiEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSntiedvsnnpDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLqlrdkkpttksVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRvhrigqkedvkivRLIVRNSIEERILELQDRKKKLAreafrrkgkdqrevstddlrilmsl
MELKqdqdwqecdqeqeegsqssneTYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNVkkkakmeameppkeVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEmsassskkrkrgkmsnkgsARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFdcpicisppsdiiiTCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSAlltlllqlRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGKDQREVSTDDLRILMSL
*************************TYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKE******VKSVDEIFKLVD******************IKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTG**************************************************************FMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQS********************NFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSM******QVIEEF******GPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILE**********************************
**LKQDQ*****************ETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPN*R****RFKIPCQVHIFT**************************************************************************KSELFVHQKEGLGWLVRRENSE***PFWEEKGGGFVNVLT********************GLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSA*******************************NVKG************MGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQR*L*******LSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVV***********NYSTVLSILLRLRQICTNLALCPS******************DLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKK*********************LRILMSL
**********************SNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNV**********PPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNE*******************************TVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAR*************STDDLRILMSL
***********************NETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLI****************************E*F**V*****KKAKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDK************************SASSSKKRKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDV******NTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSP**************NFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGK*QREVSTDDLRILMSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELKQDQDWQECDQEQEEGSQSSNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNVKKKAKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSASSSKKRKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVxxxxxxxxxxxxxxxxxxxxxAFRRKGKDQREVSTDDLRILMSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query869 2.2.26 [Sep-21-2011]
Q9FF61881 Putative SWI/SNF-related yes no 0.968 0.955 0.663 0.0
Q6PCN71003 Helicase-like transcripti yes no 0.966 0.837 0.366 1e-166
Q145271009 Helicase-like transcripti yes no 0.963 0.829 0.353 1e-154
Q952161005 Helicase-like transcripti yes no 0.617 0.534 0.428 1e-120
Q9FIY71277 Putative SWI/SNF-related no no 0.726 0.494 0.345 1e-107
Q9FNI61029 Putative SWI/SNF-related no no 0.741 0.625 0.340 1e-107
Q4IJ841154 DNA repair protein RAD5 O yes no 0.727 0.547 0.315 2e-93
Q4WVM11245 DNA repair protein rad5 O yes no 0.710 0.495 0.304 4e-87
Q6CJM41114 DNA repair protein RAD5 O yes no 0.860 0.671 0.282 1e-86
Q7S1P91222 DNA repair protein rad-5 N/A no 0.726 0.516 0.304 1e-85
>sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 Back     alignment and function desciption
 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/870 (66%), Positives = 688/870 (79%), Gaps = 28/870 (3%)

Query: 5   QDQDWQECDQEQEEGSQSSNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNPYDS 64
           +D+     +  Q++     +E+Y++GFVIANIVGL+YYSG I+GREMVGLVREPLN YD+
Sbjct: 35  EDEFQSPVEPSQQQSQDCVSESYLIGFVIANIVGLKYYSGRINGREMVGLVREPLNVYDN 94

Query: 65  NAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHIFTR 124
           NA++VLNTR++QVGHIER+VAAVLAP+IDS  I+VEGIVPNTRS  NR++IPCQ+H+F +
Sbjct: 95  NAIRVLNTRSEQVGHIERTVAAVLAPMIDSHTIVVEGIVPNTRSNSNRYRIPCQIHVFAK 154

Query: 125 LEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNVKKK 184
           LE  S VK  I  GGL LIS +D SFGLSEA+VVKE+ G    +SVD+IFKLVD+NVK  
Sbjct: 155 LEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDKIFKLVDENVKLM 214

Query: 185 AKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKR 244
            K+ A EPP+EVIKSELF HQKEGLGWL+ RE S ELPPFWEEK G F+N LTNY +DKR
Sbjct: 215 GKLVAAEPPREVIKSELFAHQKEGLGWLLHREKSGELPPFWEEKDGEFLNTLTNYRSDKR 274

Query: 245 PEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSASSSKK 304
           P+PLRGG+FADDMGLGKTLTLLSLIA D+          + S    E  D E      K 
Sbjct: 275 PDPLRGGVFADDMGLGKTLTLLSLIAFDRYGN------ASTSTPTEEPLDGEGDKIEKKG 328

Query: 305 RKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTW 364
           +KRG+  +  S   KK KT      D+V G +V           +K TLIVCPPSV S W
Sbjct: 329 KKRGRGKSSESVTRKKLKT------DDVVGMNVS----------QKTTLIVCPPSVISAW 372

Query: 365 ITQLEEHTVPGMLKTYMYYG-DRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIEWW 423
           ITQLEEHTVPG+LK YMY+G +RT DV EL  YD+VLTTY TLA+EESW +SPVKK+EW 
Sbjct: 373 ITQLEEHTVPGILKVYMYHGGERTDDVNELMKYDIVLTTYGTLAVEESWEDSPVKKMEWL 432

Query: 424 RVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKS 483
           R+ILDEAH IKNANAQQSR V  L A RRW VTGTPIQNGSFDL+SLMAFL+FEPFS+KS
Sbjct: 433 RIILDEAHTIKNANAQQSRVVCKLKASRRWAVTGTPIQNGSFDLYSLMAFLRFEPFSIKS 492

Query: 484 YWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKL 543
           YWQSLIQRPL QGN+KGLSRLQVLM+TISLRRTK+K LIGL PKT+E  YVELS EER+L
Sbjct: 493 YWQSLIQRPLGQGNKKGLSRLQVLMATISLRRTKEKSLIGLPPKTVETCYVELSPEERQL 552

Query: 544 YDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIED 603
           YD +EG+AKGVVQ+ IN GSLMRNYSTVLSI+LRLRQ+C +++LCP ++RS   S ++ED
Sbjct: 553 YDHMEGEAKGVVQNLINNGSLMRNYSTVLSIILRLRQLCDDMSLCPPELRSFTTSTSVED 612

Query: 604 VSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPL 663
           V++ P+LL+KLV  LQDGEDFDCPICISPP++IIIT CAHIFCR+CIL+TLQ +KP CPL
Sbjct: 613 VTDKPELLQKLVAALQDGEDFDCPICISPPTNIIITRCAHIFCRACILQTLQRSKPLCPL 672

Query: 664 CRHPLLQSDLFSS---PPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVF 720
           CR  L QSDL+++   PP+SS+ D       +  SSKVSALL+LL+  R + P TKSVVF
Sbjct: 673 CRGSLTQSDLYNAPPPPPDSSNTD-GEDAKSSTKSSKVSALLSLLMASRQENPNTKSVVF 731

Query: 721 SQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGA 780
           SQFRKML+LLE PL+AAGF +LRLDG+M  KKR QVI EFGNP   GP VLLASLKASG 
Sbjct: 732 SQFRKMLLLLETPLKAAGFTILRLDGAMTVKKRTQVIGEFGNPELTGPVVLLASLKASGT 791

Query: 781 GVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRK 840
           G+NLTAASRV+L +PWWNPAVEEQAMDR+HRIGQK++VK++R+I RNSIEER+LELQ +K
Sbjct: 792 GINLTAASRVYLFDPWWNPAVEEQAMDRIHRIGQKQEVKMIRMIARNSIEERVLELQQKK 851

Query: 841 KKLAREAF-RRKGKDQREVSTDDLRILMSL 869
           K LA EAF RR+ KD+REV+ +D+  LMSL
Sbjct: 852 KNLANEAFKRRQKKDEREVNVEDVVALMSL 881
Possesses intrinsic ATP-dependent nucleosome-remodeling activity. This activity may be required for transcriptional activation or repression of specific target promoters.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 Back     alignment and function description
>sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 Back     alignment and function description
>sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 Back     alignment and function description
>sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 Back     alignment and function description
>sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 Back     alignment and function description
>sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 Back     alignment and function description
>sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 Back     alignment and function description
>sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rad-5 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query869
225440123874 PREDICTED: putative SWI/SNF-related matr 0.979 0.973 0.715 0.0
297806511861 SNF2 domain-containing protein [Arabidop 0.966 0.975 0.660 0.0
22326612862 DNA/RNA helicase [Arabidopsis thaliana] 0.968 0.976 0.663 0.0
60390959881 RecName: Full=Putative SWI/SNF-related m 0.968 0.955 0.663 0.0
357509293844 DNA repair protein RAD5 [Medicago trunca 0.919 0.946 0.561 0.0
356503369823 PREDICTED: putative SWI/SNF-related matr 0.937 0.990 0.553 0.0
242046730822 hypothetical protein SORBIDRAFT_02g04096 0.909 0.961 0.537 0.0
414887861824 TPA: hypothetical protein ZEAMMB73_07247 0.909 0.958 0.535 0.0
125559347821 hypothetical protein OsI_27065 [Oryza sa 0.917 0.970 0.523 0.0
115473675821 Os07g0642400 [Oryza sativa Japonica Grou 0.917 0.970 0.523 0.0
>gi|225440123|ref|XP_002277489.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1277 bits (3305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/869 (71%), Positives = 722/869 (83%), Gaps = 18/869 (2%)

Query: 9   WQE--CDQEQEEGSQ-----SSNETYMLGFVIANIVGLQYYSGTISGREMVGLVREPLNP 61
           W+E   D + +E S      S +ETY++GFVI NIVG+QYYSGTISGRE VGLVREPLNP
Sbjct: 16  WREFPIDADDDEDSSQCPLSSPSETYLVGFVIVNIVGIQYYSGTISGRERVGLVREPLNP 75

Query: 62  YDSNAVKVLNTRTDQVGHIERSVAAVLAPLIDSGMILVEGIVPNTRSKGNRFKIPCQVHI 121
           YD NA+KVLNT T QVGHI+RS AAVLAPL+D+ ++ VEGIVPNT   GNR++IPCQVHI
Sbjct: 76  YDRNAIKVLNTTTIQVGHIDRSAAAVLAPLMDANLVTVEGIVPNTPGSGNRYRIPCQVHI 135

Query: 122 FTRLEMFSIVKDVILEGGLQLISGNDVSFGLSEAMVVKERKGERGVKSVDEIFKLVDKNV 181
           F ++E F  V+  I  GGLQLIS +D SF LSEA++VKE+K ++  KS+DEIFKL  +NV
Sbjct: 136 FAQIEWFPRVRSAISRGGLQLISDSDPSFTLSEAVIVKEKKCDKEFKSLDEIFKLAIENV 195

Query: 182 KKKAKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHT 241
            K+  +EAMEPPK+VIKSELF+HQKE LGWLV RENS ELPPFWE++ G +VNVLTNY T
Sbjct: 196 NKQGALEAMEPPKDVIKSELFLHQKEALGWLVHRENSCELPPFWEKQNGSYVNVLTNYQT 255

Query: 242 DKRPEPLRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSASS 301
           +KRPEPLRGGIFADDMGLGKTLTLL LIA DKC+         ++++    EDEE+  SS
Sbjct: 256 NKRPEPLRGGIFADDMGLGKTLTLLCLIAFDKCSSDLSYSVNRDNIEKLGEEDEELIVSS 315

Query: 302 SKKRKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVF 361
            KK ++G++S K S   KK KT +T  DD +KG SV            K TLIVCPPSVF
Sbjct: 316 GKKSRKGRVSRKASGLRKKRKTDDTPSDDMLKGNSVV----------SKTTLIVCPPSVF 365

Query: 362 STWITQLEEHTVPGMLKTYMYYGDRTQDVEELKMYDLVLTTYSTLAIEESWLESPVKKIE 421
           STW+TQL EHT P  LK YMYYG+RTQ+ EEL+ YD+VLTTYSTLA EE+W  SPVKKIE
Sbjct: 366 STWVTQLLEHTTPKRLKVYMYYGNRTQEAEELQKYDIVLTTYSTLATEEAWSGSPVKKIE 425

Query: 422 WWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSV 481
           WWRVILDEAH+IKN NAQQS+ VTNL AKRRWVVTGTPIQNG+FDLFSLMAFL+FEPFS+
Sbjct: 426 WWRVILDEAHMIKNVNAQQSQAVTNLRAKRRWVVTGTPIQNGTFDLFSLMAFLRFEPFSI 485

Query: 482 KSYWQSLIQRPLAQGNRKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEER 541
           KSYWQSL+QRPL QG  KGLSRLQVLM+TISLRRTKDKGLIGL PK++E  +VELS EER
Sbjct: 486 KSYWQSLVQRPLGQGKEKGLSRLQVLMATISLRRTKDKGLIGLPPKSVETCFVELSAEER 545

Query: 542 KLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTI 601
           +LYD++E + K V++DYI+AGS+MRNYSTVL I+LRLRQICT++ALCPSD+RS++ SN I
Sbjct: 546 ELYDQMEAEGKCVIRDYIDAGSVMRNYSTVLGIILRLRQICTDVALCPSDLRSLLLSNNI 605

Query: 602 EDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCC 661
           EDVSNNP+LLKK+V VLQDGEDFDCPICISPP++I+ITCCAHIFCR CILKTL+ TKPCC
Sbjct: 606 EDVSNNPELLKKMVLVLQDGEDFDCPICISPPTNIVITCCAHIFCRVCILKTLKRTKPCC 665

Query: 662 PLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFS 721
           PLCRHPL QSDLFS+PPES++ D +       TSSKV  LL  L   RD+ P+TKSVVFS
Sbjct: 666 PLCRHPLSQSDLFSAPPESTETDNSEIPSSECTSSKVLTLLKFLSASRDQNPSTKSVVFS 725

Query: 722 QFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAG 781
           QFRKML+LLE+PL+AAGFK LRLDGSMNAK+RAQVIEEFG PGP GPTVLLASLKASGAG
Sbjct: 726 QFRKMLLLLEQPLKAAGFKTLRLDGSMNAKRRAQVIEEFGAPGPNGPTVLLASLKASGAG 785

Query: 782 VNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKK 841
           +NLTAASRV+LLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLI RNSIEERILELQ+RKK
Sbjct: 786 INLTAASRVYLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIARNSIEERILELQERKK 845

Query: 842 KLAREAFRRKG-KDQREVSTDDLRILMSL 869
           KLA+EAF R+G KD+REV  +DLR+LMSL
Sbjct: 846 KLAKEAFGRRGLKDRREVGVEDLRMLMSL 874

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297806511|ref|XP_002871139.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316976|gb|EFH47398.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22326612|ref|NP_196132.2| DNA/RNA helicase [Arabidopsis thaliana] gi|20260624|gb|AAM13210.1| helicase-like transcription factor-like protein [Arabidopsis thaliana] gi|31711770|gb|AAP68241.1| At5g05130 [Arabidopsis thaliana] gi|332003449|gb|AED90832.1| DNA/RNA helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|60390959|sp|Q9FF61.1|SM3L1_ARATH RecName: Full=Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1; Short=SMARCA3-like protein 1 gi|10178052|dbj|BAB11535.1| helicase-like transcription factor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357509293|ref|XP_003624935.1| DNA repair protein RAD5 [Medicago truncatula] gi|124360542|gb|ABN08552.1| SNF2-related; Zinc finger, RING-type; ATP-requiring DNA helicase RecQ [Medicago truncatula] gi|355499950|gb|AES81153.1| DNA repair protein RAD5 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356503369|ref|XP_003520482.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1-like [Glycine max] Back     alignment and taxonomy information
>gi|242046730|ref|XP_002461111.1| hypothetical protein SORBIDRAFT_02g040960 [Sorghum bicolor] gi|241924488|gb|EER97632.1| hypothetical protein SORBIDRAFT_02g040960 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|414887861|tpg|DAA63875.1| TPA: hypothetical protein ZEAMMB73_072475 [Zea mays] Back     alignment and taxonomy information
>gi|125559347|gb|EAZ04883.1| hypothetical protein OsI_27065 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115473675|ref|NP_001060436.1| Os07g0642400 [Oryza sativa Japonica Group] gi|23237908|dbj|BAC16482.1| putative RUSH-1alpha [Oryza sativa Japonica Group] gi|50509930|dbj|BAD30251.1| putative RUSH-1alpha [Oryza sativa Japonica Group] gi|113611972|dbj|BAF22350.1| Os07g0642400 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query869
UNIPROTKB|F1MLM21009 HLTF "Uncharacterized protein" 0.617 0.532 0.414 1.8e-148
ZFIN|ZDB-GENE-030131-3306942 hltf "helicase-like transcript 0.592 0.546 0.411 2.9e-148
RGD|13090311004 Hltf "helicase-like transcript 0.616 0.533 0.415 9.6e-148
UNIPROTKB|I3LM881011 HLTF "Uncharacterized protein" 0.598 0.514 0.423 5.3e-147
MGI|MGI:11964371003 Hltf "helicase-like transcript 0.598 0.518 0.413 1.8e-146
UNIPROTKB|E2R9I51007 HLTF "Uncharacterized protein" 0.617 0.533 0.413 3.7e-146
UNIPROTKB|Q145271009 HLTF "Helicase-like transcript 0.598 0.515 0.417 9.8e-146
ASPGD|ASPL0000049992972 AN2256 [Emericella nidulans (t 0.581 0.519 0.341 1.7e-101
UNIPROTKB|H7C5K0425 HLTF "Helicase-like transcript 0.468 0.957 0.434 1.8e-85
POMBASE|SPBC582.10c830 SPBC582.10c "ATP-dependent DNA 0.491 0.514 0.331 1.4e-75
UNIPROTKB|F1MLM2 HLTF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1057 (377.1 bits), Expect = 1.8e-148, Sum P(2) = 1.8e-148
 Identities = 229/552 (41%), Positives = 329/552 (59%)

Query:   333 KGKSVGMLNKSSSFMGK-KITLIVCPPSVFSTWITQLEEHTVPGM-LKTYMYYG-DRTQD 389
             +G S    +K +    K + TLI+CP SV S W+ Q  +H    + L  Y+YYG DR +D
Sbjct:   458 RGASAVESSKKTDVEDKPRTTLIICPLSVLSNWMDQFGQHIKSDVHLNFYVYYGPDRVRD 517

Query:   390 VEELKMYDLVLTTYSTLAIEESWL-ESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLN 448
                L   D+VLTTY+ L  +     +SP+  I W RVILDE H I+N NAQQ++ V +L 
Sbjct:   518 PTLLSKQDIVLTTYNILTHDYGTKGDSPLHSIRWLRVILDEGHAIRNPNAQQTKAVLDLE 577

Query:   449 AKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGNRKGLSRLQVLM 508
             A+RRWV+TGTPIQN   DL+SL++FL+ +PF  + +W   IQRP+  G+  GL RLQ L+
Sbjct:   578 AERRWVLTGTPIQNSLKDLWSLLSFLKLKPFVDREWWHRTIQRPVTMGDEAGLRRLQSLI 637

Query:   509 STISLRRTKD---KG--LIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGS 563
               I+LRRTK    KG  ++ L  + +   ++ LS EERK+Y  ++ + K  +  Y N G+
Sbjct:   638 KNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERKIYQSVKNEGKATIGRYFNEGT 697

Query:   564 LMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGED 623
             ++ +Y+ VL +LLRLRQIC +  L  + V S  PS           L+KK+  +L  G D
Sbjct:   698 VLAHYADVLGLLLRLRQICCHTHLLANAVSSSGPSGNDTPEELRKKLIKKMKLILSSGSD 757

Query:   624 FXXXXXXXXXXXXXXTCCAHIFCRSCILKTLQHTKPC--CPLCRHPLLQSDLFSSPPESS 681
                            T CAH+FC+ CI + +Q+ +P   CPLCR+ +    L   PPE  
Sbjct:   758 EECAICLDSLMAPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHGDSLIECPPEEL 817

Query:   682 DMDIAGKTLKNFTSS-KVSAXXXXXXXXRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFK 740
               +   K+   +TSS K++A        R K P  KS+V SQF   L L+E PL+A+GF 
Sbjct:   818 ACNTEKKSNMEWTSSSKINALMHALIDLRKKNPNIKSLVVSQFTTFLSLIETPLRASGFV 877

Query:   741 LLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPA 800
               RLDGSM  KKR + I+ F N   G PT++L SLKA G G+NL+AASRVFL++P WNPA
Sbjct:   878 FTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPA 937

Query:   801 VEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRK---GKDQRE 857
              E+Q  DR HR+GQK++V I + IV++S+EE +L++Q+ K++LA  AF  K     + ++
Sbjct:   938 AEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNTKRELAAGAFGTKKTNASEMKQ 997

Query:   858 VSTDDLRILMSL 869
                +++R L+ L
Sbjct:   998 AKINEIRTLIDL 1009
GO:0016887 "ATPase activity" evidence=IEA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
ZFIN|ZDB-GENE-030131-3306 hltf "helicase-like transcription factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309031 Hltf "helicase-like transcription factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM88 HLTF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1196437 Hltf "helicase-like transcription factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9I5 HLTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14527 HLTF "Helicase-like transcription factor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000049992 AN2256 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|H7C5K0 HLTF "Helicase-like transcription factor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPBC582.10c SPBC582.10c "ATP-dependent DNA helicase Rhp16b (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q14527HLTF_HUMAN6, ., 3, ., 2, ., -0.35340.96310.8295yesno
Q9FF61SM3L1_ARATH3, ., 6, ., 4, ., -0.66320.96890.9557yesno
Q6PCN7HLTF_MOUSE6, ., 3, ., 2, ., -0.36650.96660.8374yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.6__436__AT5G05130.1
annotation not avaliable (861 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query869
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 1e-64
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-50
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-24
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 7e-22
smart0091090 smart00910, HIRAN, The HIRAN protein (HIP116, Rad5 5e-20
pfam0879795 pfam08797, HIRAN, HIRAN domain 9e-20
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 4e-17
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-16
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-13
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-13
smart0018440 smart00184, RING, Ring finger 2e-11
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-10
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-09
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-08
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 3e-07
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 8e-07
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-06
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-05
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 3e-05
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 2e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 9e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.001
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.003
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  233 bits (594), Expect = 1e-64
 Identities = 167/547 (30%), Positives = 245/547 (44%), Gaps = 115/547 (21%)

Query: 352 TLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYGD------RTQDVEEL------KMYDLV 399
            LIV P S+ S W  + E+   P +    +Y+G+      + + + +L       ++D+V
Sbjct: 393 ALIVVPASLLSNWKREFEKFA-PDLRLVLVYHGEKSELDKKREALRDLLKLHLVIIFDVV 451

Query: 400 LTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTP 459
           +TTY  L          +KKIEW RV+LDEAH IKN  + + + +  L A  R  +TGTP
Sbjct: 452 ITTYELLR-RFLVDHGGLKKIEWDRVVLDEAHRIKNDQSSEGKALQFLKALNRLDLTGTP 510

Query: 460 IQNGSFDLFSLM-AFLQFEPFSVK-SYWQSLIQRPLA--------QGNRKGLSRLQVLMS 509
           ++N   +L+SL+  FL         + +  L ++P+         +    G+  L+ L+S
Sbjct: 511 LENRLGELWSLLQEFLNPGLLGTSFAIFTRLFEKPIQAEEDIGPLEARELGIELLRKLLS 570

Query: 510 TISLRRTK-DKGLI-GLQPKTIEKYYVELSLEERKLYDEL---EGKAKGVVQDYINAGSL 564
              LRRTK D  ++  L PK  +    ELS E+R+LY+ L     K + +++D   A S 
Sbjct: 571 PFILRRTKEDVEVLKELPPKIEKVLECELSEEQRELYEALLEGAEKNQQLLEDLEKADSD 630

Query: 565 MRNYST----VLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQD 620
                     +L++L RLRQIC                       N+P L      V + 
Sbjct: 631 ENRIGDSELNILALLTRLRQIC-----------------------NHPAL------VDEG 661

Query: 621 GEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPES 680
            E     I +    D           +                                 
Sbjct: 662 LEATFDRIVLLLREDKDFDYLKKPLIQLSK------------------------------ 691

Query: 681 SDMDIAGKTLKNFTSSKVSALLTLLL-QLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGF 739
                           K+ AL  LLL +L ++    K ++FSQF  +L LLE+ L+A G 
Sbjct: 692 ---------------GKLQALDELLLDKLLEEGHYHKVLIFSQFTPVLDLLEDYLKALGI 736

Query: 740 KLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNP 799
           K +RLDGS  AK+R ++I+ F         V L SLKA G G+NLT A  V L +PWWNP
Sbjct: 737 KYVRLDGSTPAKRRQELIDRFNADE--EEKVFLLSLKAGGLGLNLTGADTVILFDPWWNP 794

Query: 800 AVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGKDQREVS 859
           AVE QA+DR HRIGQK  VK+ RLI R +IEE+ILELQ++K++L          D     
Sbjct: 795 AVELQAIDRAHRIGQKRPVKVYRLITRGTIEEKILELQEKKQELLDSL-----IDAEGEK 849

Query: 860 TDDLRIL 866
                 +
Sbjct: 850 ELSKLSI 856

Length = 866
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|214906 smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p Back     alignment and domain information
>gnl|CDD|220020 pfam08797, HIRAN, HIRAN domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 869
KOG1002791 consensus Nucleotide excision repair protein RAD16 100.0
KOG4439901 consensus RNA polymerase II transcription terminat 100.0
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
KOG0387 923 consensus Transcription-coupled repair protein CSB 100.0
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 100.0
KOG1001674 consensus Helicase-like transcription factor HLTF/ 100.0
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 100.0
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 100.0
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 100.0
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 100.0
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 100.0
KOG02981394 consensus DEAD box-containing helicase-like transc 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG0383696 consensus Predicted helicase [General function pre 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.97
PHA02558501 uvsW UvsW helicase; Provisional 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.96
PTZ00110545 helicase; Provisional 99.9
KOG1123776 consensus RNA polymerase II transcription initiati 99.9
KOG0354 746 consensus DEAD-box like helicase [General function 99.9
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.9
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.89
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.89
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.89
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.89
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.89
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.89
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.88
PTZ00424401 helicase 45; Provisional 99.87
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.87
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.86
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.86
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.83
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.83
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.83
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.82
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.82
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.81
PRK10689 1147 transcription-repair coupling factor; Provisional 99.81
PRK02362 737 ski2-like helicase; Provisional 99.8
PRK13767 876 ATP-dependent helicase; Provisional 99.79
PRK01172674 ski2-like helicase; Provisional 99.78
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.77
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.77
PRK00254 720 ski2-like helicase; Provisional 99.75
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.74
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.73
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.69
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.69
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.69
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.67
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.66
PRK05580679 primosome assembly protein PriA; Validated 99.66
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.66
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.64
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.64
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.62
COG4096 875 HsdR Type I site-specific restriction-modification 99.61
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.6
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.6
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.6
COG1204 766 Superfamily II helicase [General function predicti 99.6
PRK09401 1176 reverse gyrase; Reviewed 99.59
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.59
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.59
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.58
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.57
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.56
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.55
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.54
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.53
PF08797107 HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN 99.53
KOG4284 980 consensus DEAD box protein [Transcription] 99.51
PHA02653 675 RNA helicase NPH-II; Provisional 99.51
smart00487201 DEXDc DEAD-like helicases superfamily. 99.51
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.51
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.51
COG4889 1518 Predicted helicase [General function prediction on 99.5
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.49
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.48
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.47
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.46
COG1205 851 Distinct helicase family with a unique C-terminal 99.45
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 99.43
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.41
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 99.4
smart0049082 HELICc helicase superfamily c-terminal domain. 99.39
COG1202 830 Superfamily II helicase, archaea-specific [General 99.39
PRK09694 878 helicase Cas3; Provisional 99.38
PRK14701 1638 reverse gyrase; Provisional 99.38
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.37
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.36
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.35
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.35
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.33
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.29
KOG0347731 consensus RNA helicase [RNA processing and modific 99.29
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.28
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.27
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.25
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.21
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.2
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.2
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.2
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.18
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.17
KOG0346 569 consensus RNA helicase [RNA processing and modific 99.17
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.16
PRK05298652 excinuclease ABC subunit B; Provisional 99.15
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.15
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.07
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.04
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.96
KOG0327397 consensus Translation initiation factor 4F, helica 98.95
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.95
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.94
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 98.93
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.9
PF11496297 HDA2-3: Class II histone deacetylase complex subun 98.87
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.86
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.81
KOG0353 695 consensus ATP-dependent DNA helicase [General func 98.8
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.78
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.73
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.7
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 98.7
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 98.62
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.62
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.55
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.48
COG0610 962 Type I site-specific restriction-modification syst 98.45
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.42
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.34
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.34
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.29
PF13871 278 Helicase_C_4: Helicase_C-like 98.23
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.13
PRK15483 986 type III restriction-modification system StyLTI en 98.12
PRK14873665 primosome assembly protein PriA; Provisional 98.07
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.07
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.01
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.95
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.91
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.89
PHA02929238 N1R/p28-like protein; Provisional 97.87
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.87
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 97.82
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.81
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.79
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.79
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.78
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 97.77
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 97.74
PHA02926242 zinc finger-like protein; Provisional 97.7
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 97.69
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 97.67
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 97.58
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.55
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.49
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.48
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.48
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 97.33
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.3
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 97.28
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.28
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.28
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.28
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.22
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.18
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.17
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.17
PF1463444 zf-RING_5: zinc-RING finger domain 97.15
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.12
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.11
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.95
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.94
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 96.91
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.9
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 96.86
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 96.84
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 96.68
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.61
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.51
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.44
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.39
PRK10536262 hypothetical protein; Provisional 96.27
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.23
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.23
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 96.02
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 95.97
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.78
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 95.72
COG3587 985 Restriction endonuclease [Defense mechanisms] 95.67
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.62
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 95.61
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 95.39
KOG1803649 consensus DNA helicase [Replication, recombination 95.32
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 95.29
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 95.21
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 94.97
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.89
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 94.79
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 94.76
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 94.75
TIGR00376637 DNA helicase, putative. The gene product may repre 94.5
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.48
KOG2660331 consensus Locus-specific chromosome binding protei 94.43
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.4
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.38
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 94.21
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.1
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 94.08
COG5222427 Uncharacterized conserved protein, contains RING Z 93.95
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 93.91
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.88
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 93.79
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.61
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 93.13
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 93.06
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 92.94
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 92.46
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 92.13
smart00492141 HELICc3 helicase superfamily c-terminal domain. 91.87
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 91.79
KOG1131755 consensus RNA polymerase II transcription initiati 91.63
COG5152259 Uncharacterized conserved protein, contains RING a 91.54
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.52
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 91.21
KOG0297 391 consensus TNF receptor-associated factor [Signal t 91.16
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 91.13
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 90.67
smart00491142 HELICc2 helicase superfamily c-terminal domain. 90.56
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 90.45
KOG3039303 consensus Uncharacterized conserved protein [Funct 90.44
KOG18051100 consensus DNA replication helicase [Replication, r 90.27
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 90.25
PRK04296190 thymidine kinase; Provisional 90.2
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 90.03
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 89.73
PRK10875615 recD exonuclease V subunit alpha; Provisional 89.18
KOG4739233 consensus Uncharacterized protein involved in syna 89.17
PLN03025319 replication factor C subunit; Provisional 89.02
COG5175 480 MOT2 Transcriptional repressor [Transcription] 88.86
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 87.9
KOG0298 1394 consensus DEAD box-containing helicase-like transc 87.56
PF04641260 Rtf2: Rtf2 RING-finger 87.55
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 87.42
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 87.36
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 87.19
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 86.99
PHA02533534 17 large terminase protein; Provisional 86.38
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 86.17
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 85.48
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 84.63
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 83.74
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 81.95
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 81.53
COG52191525 Uncharacterized conserved protein, contains RING Z 81.03
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 80.96
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 80.74
KOG149384 consensus Anaphase-promoting complex (APC), subuni 80.1
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-113  Score=899.25  Aligned_cols=572  Identities=35%  Similarity=0.626  Sum_probs=498.1

Q ss_pred             ccHHHHHHHHhhhhhcccccccCCCCcccccccChHHHHHHHHHHHHhhcCCCCCCcccccCCceeeeccccccCCCCCC
Q 002901          168 KSVDEIFKLVDKNVKKKAKMEAMEPPKEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEP  247 (869)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~Q~~al~wm~~~e~~~~~~~~w~~~~~~y~n~~t~~~~~~~p~~  247 (869)
                      ..++.+|..+.+.   ..-.....++|..+..+|+|||+++|+|+...|.+                            .
T Consensus       155 pE~~~v~~dlde~---~p~i~e~aeqP~dlii~LL~fQkE~l~Wl~~QE~S----------------------------s  203 (791)
T KOG1002|consen  155 PELRNVFTDLDEA---NPVIAERAEQPDDLIIPLLPFQKEGLAWLTSQEES----------------------------S  203 (791)
T ss_pred             chhhhhhhhhhhc---CchhhhcccCcccceecchhhhHHHHHHHHHhhhh----------------------------h
Confidence            4456677777652   22233345677889999999999999999998874                            2


Q ss_pred             CCCcceecCcCCChhHHHHHHHHhccCCCCCCCCCCCCCCCCchhhhhhhhhccccccccCccccCCccccccccccccc
Q 002901          248 LRGGIFADDMGLGKTLTLLSLIALDKCAGVAPGLTGTNSLDLNEVEDEEMSASSSKKRKRGKMSNKGSARGKKHKTVNTK  327 (869)
Q Consensus       248 ~~GgILAD~mGLGKTl~~lali~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  327 (869)
                      +.||||||+||+|||+|+|||++...                                                      
T Consensus       204 ~~GGiLADEMGMGKTIQtIaLllae~------------------------------------------------------  229 (791)
T KOG1002|consen  204 VAGGILADEMGMGKTIQTIALLLAEV------------------------------------------------------  229 (791)
T ss_pred             hccceehhhhccchHHHHHHHHHhcc------------------------------------------------------
Confidence            47999999999999999999998743                                                      


Q ss_pred             ccccccCcccccccCCccccccceEEEecChhHHHHHHHHHHHhcCCCCeEEEEEeC-CCCCChhhhccccEEEEechhh
Q 002901          328 MDDNVKGKSVGMLNKSSSFMGKKITLIVCPPSVFSTWITQLEEHTVPGMLKTYMYYG-DRTQDVEELKMYDLVLTTYSTL  406 (869)
Q Consensus       328 ~~~~~~~~~~~~~~~~~~~~~~~~tLIV~P~sll~qW~~Ei~~~~~~~~l~v~~y~G-~r~~~~~~l~~~dVVItTY~~l  406 (869)
                                          ...|||||||.-.+.||.+||.+|+. +.+++|+||| .|.++.+.|..||||+|||.++
T Consensus       230 --------------------~ra~tLVvaP~VAlmQW~nEI~~~T~-gslkv~~YhG~~R~~nikel~~YDvVLTty~vv  288 (791)
T KOG1002|consen  230 --------------------DRAPTLVVAPTVALMQWKNEIERHTS-GSLKVYIYHGAKRDKNIKELMNYDVVLTTYAVV  288 (791)
T ss_pred             --------------------ccCCeeEEccHHHHHHHHHHHHHhcc-CceEEEEEecccccCCHHHhhcCcEEEEecHHH
Confidence                                34569999999999999999999995 8999999999 9999999999999999999999


Q ss_pred             Hhhhcc-------------cCCCcceeeeeEEEEcCccccCCcChHHHHHHhhcccCeEEEEecccccCChhhhHhhhhh
Q 002901          407 AIEESW-------------LESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAF  473 (869)
Q Consensus       407 ~~~~~~-------------~~~~l~~~~w~rVIlDEaH~ikn~~s~~~ka~~~L~a~~r~~LTGTPi~N~l~DL~sll~f  473 (869)
                      .+.+..             ..+.|+++.|.||||||||.||++.|.+++|+++|.+.+||||||||+||++.+||||++|
T Consensus       289 Es~yRk~~~GfrrKngv~ke~SlLHsi~~~RiIlDEAH~IK~R~snTArAV~~L~tt~rw~LSGTPLQNrigElySLiRF  368 (791)
T KOG1002|consen  289 ESVYRKQDYGFRRKNGVDKEKSLLHSIKFYRIILDEAHNIKDRQSNTARAVFALETTYRWCLSGTPLQNRIGELYSLIRF  368 (791)
T ss_pred             HHHHHhccccccccCCcccccchhhhceeeeeehhhhcccccccccHHHHHHhhHhhhhhhccCCcchhhHHHHHHHHHH
Confidence            988753             2488999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCCc-------------------------------hHHHHHHhccccccCC-----hhhHHHHHHHHhhhhhhccC
Q 002901          474 LQFEPFSV-------------------------------KSYWQSLIQRPLAQGN-----RKGLSRLQVLMSTISLRRTK  517 (869)
Q Consensus       474 L~~~~~~~-------------------------------~~~f~~~~~~p~~~~~-----~~~~~~L~~ll~~~~lRRtk  517 (869)
                      |+..||..                               ..+|+.+..+|+....     ..++...+.++..+||||||
T Consensus       369 L~i~Pfsyyfc~~cdc~~~~~~ftdr~~c~~c~h~~m~h~~~~n~~mlk~IqkfG~eGpGk~af~~~h~llk~ImlrrTk  448 (791)
T KOG1002|consen  369 LNINPFSYYFCTKCDCASLDWKFTDRMHCDHCSHNIMQHTCFFNHFMLKPIQKFGVEGPGKEAFNNIHTLLKNIMLRRTK  448 (791)
T ss_pred             HccCcchhhhhhhccccccceeecccccCCcccchhhhhhhhhcccccccchhhcccCchHHHHHHHHHHHHHHHHHHhh
Confidence            99999852                               2567777778876432     35567889999999999999


Q ss_pred             CC--CCcCCCCceEEEEEEeCCHHHHHHHHHHHHHHHHHHHHHHhcCCcccchHHHHHHHHHHHHhhcccCCCccccccc
Q 002901          518 DK--GLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSI  595 (869)
Q Consensus       518 ~~--~~~~LP~k~~~~v~v~ls~~e~~~Y~~l~~~~~~~~~~~~~~~~~~~~~~~il~~llrLRq~c~h~~l~~~~~~~~  595 (869)
                      -.  ..+.|||+.+.+..--|+.+|..+|+.+...++..|..|++.|.++.+|++|+..|.||||+++||+|+......-
T Consensus       449 l~RAdDLgLPPRiv~vRrD~fn~eE~D~YeSLY~dSkrkfntyieeGvvlNNYAnIF~LitRmRQ~aDHP~LVl~S~~~n  528 (791)
T KOG1002|consen  449 LERADDLGLPPRIVTVRRDFFNEEEKDLYESLYKDSKRKFNTYIEEGVVLNNYANIFTLITRMRQAADHPDLVLYSANAN  528 (791)
T ss_pred             cccccccCCCccceeeehhhhhhHHHHHHHHHHHhhHHhhhhHHhhhhhhhhHHHHHHHHHHHHHhccCcceeeehhhcC
Confidence            73  3368999999999999999999999999999999999999999999999999999999999999999986532111


Q ss_pred             CCCCCccccCCChHHHHHHHHHHhcCCCCCCCccCCCCCcceecccCCccchhHHHHhhhcc----CCCCCCCCCCccCC
Q 002901          596 IPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHT----KPCCPLCRHPLLQS  671 (869)
Q Consensus       596 ~~~~~~~~~~~~~e~~~~~~~~l~~~~~~~c~~c~~~~~~~~~t~c~h~~c~~ci~~~~~~~----~~~cp~c~~~~~~~  671 (869)
                      +..                    ...+..+|.+|.++.++++.+.|.|.||+-|+..++...    ...||.|...++-.
T Consensus       529 ~~~--------------------enk~~~~C~lc~d~aed~i~s~ChH~FCrlCi~eyv~~f~~~~nvtCP~C~i~LsiD  588 (791)
T KOG1002|consen  529 LPD--------------------ENKGEVECGLCHDPAEDYIESSCHHKFCRLCIKEYVESFMENNNVTCPVCHIGLSID  588 (791)
T ss_pred             CCc--------------------cccCceeecccCChhhhhHhhhhhHHHHHHHHHHHHHhhhcccCCCCcccccccccc
Confidence            111                    123456899999999999999999999999999887653    58999999988754


Q ss_pred             CcccCCCCCCCcc---cc-----cccccccCcchHHHHHHHHHHhhhcCCCCeEEEEeccHHHHHHHHHHHHHcCCcEEE
Q 002901          672 DLFSSPPESSDMD---IA-----GKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLR  743 (869)
Q Consensus       672 ~~~~~~~~~~~~~---~~-----~~~~~~~~s~K~~~L~~~L~~~~~~~~~~K~lVFsq~~~~ld~l~~~L~~~gi~~~r  743 (869)
                      .- ....+.....   .+     ..-.++.+|+|++||.+.|..+++.+...|+|||||||+|||+|+-.|.+.|+..+.
T Consensus       589 ls-e~alek~~l~~Fk~sSIlnRinm~~~qsSTKIEAL~EEl~~l~~rd~t~KsIVFSQFTSmLDLi~~rL~kaGfscVk  667 (791)
T KOG1002|consen  589 LS-EPALEKTDLKGFKASSILNRINMDDWQSSTKIEALVEELYFLRERDRTAKSIVFSQFTSMLDLIEWRLGKAGFSCVK  667 (791)
T ss_pred             cc-chhhhhcchhhhhhHHHhhhcchhhhcchhHHHHHHHHHHHHHHcccchhhhhHHHHHHHHHHHHHHhhccCceEEE
Confidence            21 1111111110   00     111257789999999999999998888999999999999999999999999999999


Q ss_pred             EeCCCCHHHHHHHHHHhCCCCCCCCEEEEEecCCccccccccccCEEEEEcCCCCcchHHHHhhhhhhcCCcccEEEEEE
Q 002901          744 LDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRL  823 (869)
Q Consensus       744 ldG~~~~~~R~~~i~~F~~~~~~~~~VlL~S~~agg~GLNLt~A~~Vi~~dp~wnp~~e~QaigRvhRiGQ~k~V~V~rl  823 (869)
                      ++|+|+++.|.+.|+.|.+ ++++ +|||+|++|||+.||||.|++||+|||||||++|.||.||+|||||.|||.|+||
T Consensus       668 L~GsMs~~ardatik~F~n-d~~c-~vfLvSLkAGGVALNLteASqVFmmDPWWNpaVe~Qa~DRiHRIGQ~rPvkvvrf  745 (791)
T KOG1002|consen  668 LVGSMSPAARDATIKYFKN-DIDC-RVFLVSLKAGGVALNLTEASQVFMMDPWWNPAVEWQAQDRIHRIGQYRPVKVVRF  745 (791)
T ss_pred             eccCCChHHHHHHHHHhcc-CCCe-EEEEEEeccCceEeeechhceeEeecccccHHHHhhhhhhHHhhcCccceeEEEe
Confidence            9999999999999999999 7755 9999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCHHHHHHHHHHHHHHHHHHHHhccccccccCCHHHHHHhhC
Q 002901          824 IVRNSIEERILELQDRKKKLAREAFRRKGKDQREVSTDDLRILMS  868 (869)
Q Consensus       824 i~~~siEe~i~~~q~~K~~l~~~~~~~~~~~~~~~~~~dl~~lf~  868 (869)
                      ++++|||++|+++|++|.+++.+.++.+.....+++.+|+++||.
T Consensus       746 ~iEnsiE~kIieLQeKKa~mihaTi~qde~Ai~kLt~eDmqfLF~  790 (791)
T KOG1002|consen  746 CIENSIEEKIIELQEKKANMIHATIGQDEEAISKLTEEDMQFLFN  790 (791)
T ss_pred             ehhccHHHHHHHHHHHHhhhhhhhcCCcHHHHHhcCHHHHHHHhc
Confidence            999999999999999999999999999887778999999999995

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF08797 HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query869
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 3e-24
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 9e-24
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 2e-18
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 8e-23
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 3e-18
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 3e-19
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 2e-18
2l1i_A122 Nmr Structure Of The Hltf Hiran Domain Length = 122 3e-17
1rmd_A116 Rag1 Dimerization Domain Length = 116 5e-05
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 93/156 (59%), Gaps = 1/156 (0%)
Query: 714 TTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLA 773
           + K V+ S + + L L E+  +   +  +RLDG+M+ KKRA+++E F NP       +L+
Sbjct: 416 SDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLS 475
Query: 774 SLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERI 833
           S KA G G+NL  A+R+ + +P WNPA +EQAM RV R GQK+   I RL+   +IEE+I
Sbjct: 476 S-KAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKI 534
Query: 834 LELQDRKKKLAREAFRRKGKDQREVSTDDLRILMSL 869
           L+ Q  KK L+      +   +R  S  +LR L SL
Sbjct: 535 LQRQAHKKALSSCVVDEEQDVERHFSLGELRELFSL 570
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure
>pdb|2L1I|A Chain A, Nmr Structure Of The Hltf Hiran Domain Length = 122 Back     alignment and structure
>pdb|1RMD|A Chain A, Rag1 Dimerization Domain Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query869
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 5e-73
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 1e-06
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 5e-58
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 2e-10
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 7e-57
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 4e-47
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 3e-07
2l1i_A122 HLTF protein; hiran domain, transcription factor, 2e-41
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-34
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 6e-16
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-30
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-21
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 2e-27
3k2y_A109 Uncharacterized protein LP_0118; nucleic acid bind 2e-22
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-19
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-19
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-19
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-18
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-17
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-17
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-16
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-16
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-15
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-15
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-15
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 9e-15
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-14
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-12
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-12
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-12
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-12
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-12
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-12
2ecw_A85 Tripartite motif-containing protein 30; metal bind 9e-12
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-11
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-11
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-11
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-11
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-11
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-10
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-10
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-10
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-10
2ysj_A63 Tripartite motif-containing protein 31; ring-type 4e-10
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 9e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-05
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-09
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-09
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-09
2ecm_A55 Ring finger and CHY zinc finger domain- containing 5e-08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 4e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 4e-07
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-07
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 9e-07
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-06
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-06
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 5e-06
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 6e-06
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 6e-06
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 7e-06
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 8e-06
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 2e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 4e-05
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 7e-05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-04
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 3e-04
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 3e-04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 3e-04
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 4e-04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-04
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 7e-04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 8e-04
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 9e-04
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
 Score =  251 bits (643), Expect = 5e-73
 Identities = 129/544 (23%), Positives = 227/544 (41%), Gaps = 112/544 (20%)

Query: 350 KITLIVCPPSVFSTWITQLEEHT-VPGMLKTYMYYGDRTQDVEELKM-----------YD 397
              ++V P S+   W    E    + G ++     G    +++   +             
Sbjct: 115 DKVIVVSPSSLVRNW--YNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTP 172

Query: 398 LVLTTYSTLAIEESWLESPVKKIEWWRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTG 457
           +++ +Y T  +    L     K +   VI DE H +KN++ Q    + ++NA+RR +++G
Sbjct: 173 ILIISYETFRLHAEVL----HKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISG 228

Query: 458 TPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQG---------NRKGLSRLQVLM 508
           TPIQN   + FSL+ F+          ++   + P+ +G            G  +LQ L+
Sbjct: 229 TPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKLQELI 288

Query: 509 STIS---LRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLM 565
           S ++   +RRT D     L  K  +     L+  +++LY       +    + +  G   
Sbjct: 289 SIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLF--LKQAKPVESLQTG--- 343

Query: 566 RNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFD 625
           +   + LS +  L+++C                       N+P L+ +  + L   E FD
Sbjct: 344 KISVSSLSSITSLKKLC-----------------------NHPALIYE--KCLTGEEGFD 378

Query: 626 CPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDI 685
             + + P                                          +   ++ +  +
Sbjct: 379 GALDLFPQ-----------------------------------------NYSTKAVEPQL 397

Query: 686 AGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLD 745
           +GK L          +L  +L +     + K V+ S + + L L E+  +   +  +RLD
Sbjct: 398 SGKML----------VLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLD 447

Query: 746 GSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQA 805
           G+M+ KKRA+++E F NP      + + S KA G G+NL  A+R+ + +P WNPA +EQA
Sbjct: 448 GTMSIKKRAKIVERFNNPS-SPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQA 506

Query: 806 MDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGKDQREVSTDDLRI 865
           M RV R GQK+   I RL+   +IEE+IL+ Q  KK L+      +   +R  S  +LR 
Sbjct: 507 MARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRE 566

Query: 866 LMSL 869
           L SL
Sbjct: 567 LFSL 570
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>2l1i_A HLTF protein; hiran domain, transcription factor, DNA repair, transc regulation, transcription, structural genomics, structural consortium, SGC; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>3k2y_A Uncharacterized protein LP_0118; nucleic acid binding,zinc ION binding, structural genomics, PSI-2, protein structure initiative; 2.40A {Lactobacillus plantarum} Length = 109 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query869
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
3h1t_A590 Type I site-specific restriction-modification syst 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.96
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.96
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.96
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.95
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.95
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.95
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.94
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.94
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.93
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.92
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.92
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.91
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.91
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.91
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.91
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.9
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.89
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.89
2l1i_A122 HLTF protein; hiran domain, transcription factor, 99.87
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.87
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.86
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.86
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.85
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.84
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.83
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.82
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.8
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.79
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.76
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.7
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.7
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.69
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.69
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.67
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.65
3k2y_A109 Uncharacterized protein LP_0118; nucleic acid bind 99.64
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.64
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.62
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.6
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.59
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.38
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.58
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.58
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.58
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.56
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.56
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.56
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.55
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.55
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.55
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.54
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.54
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.54
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.53
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.52
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.51
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.5
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.5
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.49
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.49
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.49
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.48
3bor_A237 Human initiation factor 4A-II; translation initiat 99.46
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.44
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.42
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.41
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.38
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.34
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.31
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.27
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.26
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.13
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.96
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.94
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.66
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.41
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.34
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.32
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.3
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.21
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.2
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.19
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.17
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.14
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.13
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.1
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.09
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.01
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.99
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.98
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.98
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.98
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.96
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.95
2ect_A78 Ring finger protein 126; metal binding protein, st 97.95
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.94
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.93
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.93
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.91
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.88
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.88
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.88
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.87
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.85
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.85
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.84
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.81
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.8
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.79
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.79
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.76
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.76
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.74
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.64
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.62
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.6
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.57
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.53
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.51
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.48
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.48
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.45
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.42
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.41
2ea5_A68 Cell growth regulator with ring finger domain prot 97.4
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.37
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.34
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.23
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.12
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.09
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.86
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.79
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.71
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.54
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 96.2
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.96
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.8
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.56
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.87
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 93.55
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 93.52
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 93.43
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 93.2
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 93.11
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 92.9
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.79
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.36
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 90.77
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 90.06
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 89.92
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 88.59
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 88.16
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 87.8
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 84.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 83.2
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 83.12
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 81.96
2chg_A226 Replication factor C small subunit; DNA-binding pr 80.28
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
Probab=100.00  E-value=3.1e-79  Score=730.96  Aligned_cols=499  Identities=29%  Similarity=0.410  Sum_probs=402.2

Q ss_pred             cccccccChHHHHHHHHHHHHhhcCCCCCCcccccCCceeeeccccccCCCCCCCCCcceecCcCCChhHHHHHHHHhcc
Q 002901          194 KEVIKSELFVHQKEGLGWLVRRENSEELPPFWEEKGGGFVNVLTNYHTDKRPEPLRGGIFADDMGLGKTLTLLSLIALDK  273 (869)
Q Consensus       194 ~~~~~~~L~p~Q~~al~wm~~~e~~~~~~~~w~~~~~~y~n~~t~~~~~~~p~~~~GgILAD~mGLGKTl~~lali~~~~  273 (869)
                      ++.+...|||||++|+.||.....+.                        +....+||||||+||||||+++|++|....
T Consensus        49 ~p~l~~~LrpyQ~~gv~~l~~~~~~~------------------------~~~~~~g~ILad~mGlGKT~~~i~~i~~l~  104 (644)
T 1z3i_X           49 DPVLSKVLRPHQREGVKFLWDCVTGR------------------------RIENSYGCIMADEMGLGKTLQCITLIWTLL  104 (644)
T ss_dssp             CHHHHTTCCHHHHHHHHHHHHHHTTS------------------------SSTTCCEEEECCCTTSCHHHHHHHHHHHHH
T ss_pred             ChhhhhcccHHHHHHHHHHHHhhhcc------------------------cccCCCCeEeeeCCCchHHHHHHHHHHHHH
Confidence            45688899999999999998754310                        011236899999999999999999998765


Q ss_pred             CCCCCCCCCCCCCCCCchhhhhhhhhccccccccCccccCCcccccccccccccccccccCcccccccCCccccccceEE
Q 002901          274 CAGVAPGLTGTNSLDLNEVEDEEMSASSSKKRKRGKMSNKGSARGKKHKTVNTKMDDNVKGKSVGMLNKSSSFMGKKITL  353 (869)
Q Consensus       274 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tL  353 (869)
                      ...+                              .                                    .....+++|
T Consensus       105 ~~~~------------------------------~------------------------------------~~p~~~~~L  118 (644)
T 1z3i_X          105 KQSP------------------------------D------------------------------------CKPEIDKVI  118 (644)
T ss_dssp             HCCT------------------------------T------------------------------------SSCSCSCEE
T ss_pred             HhCc------------------------------c------------------------------------ccCCCCcEE
Confidence            3220                              0                                    001346799


Q ss_pred             EecChhHHHHHHHHHHHhcCCCCeEEEEEeC-CCCCChhhh----------ccccEEEEechhhHhhhcccCCCcceeee
Q 002901          354 IVCPPSVFSTWITQLEEHTVPGMLKTYMYYG-DRTQDVEEL----------KMYDLVLTTYSTLAIEESWLESPVKKIEW  422 (869)
Q Consensus       354 IV~P~sll~qW~~Ei~~~~~~~~l~v~~y~G-~r~~~~~~l----------~~~dVVItTY~~l~~~~~~~~~~l~~~~w  422 (869)
                      ||||.+++.||.+||.+|+.. .+.++.++| .+......+          ..++|+||||+++..+.    ..+....|
T Consensus       119 iV~P~sll~qW~~E~~~~~~~-~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~vvi~ty~~l~~~~----~~l~~~~~  193 (644)
T 1z3i_X          119 VVSPSSLVRNWYNEVGKWLGG-RVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHA----EVLHKGKV  193 (644)
T ss_dssp             EEECHHHHHHHHHHHHHHHGG-GCCEEEECSSCHHHHHHHHHHHHCCCSSCCSCCEEEEEHHHHHHHT----TTTTTSCC
T ss_pred             EEecHHHHHHHHHHHHHHcCC-CeeEEEEeCCCHHHHHHHHHHHHHhcCCCCCCcEEEeeHHHHHhhH----HHhhcCCc
Confidence            999999999999999999843 466666665 322111111          24799999999999876    34667899


Q ss_pred             eEEEEcCccccCCcChHHHHHHhhcccCeEEEEecccccCChhhhHhhhhhhccCCCCchHHHHHHhccccccCC-----
Q 002901          423 WRVILDEAHVIKNANAQQSRTVTNLNAKRRWVVTGTPIQNGSFDLFSLMAFLQFEPFSVKSYWQSLIQRPLAQGN-----  497 (869)
Q Consensus       423 ~rVIlDEaH~ikn~~s~~~ka~~~L~a~~r~~LTGTPi~N~l~DL~sll~fL~~~~~~~~~~f~~~~~~p~~~~~-----  497 (869)
                      ++||+||||++||+.++.++++..+.+.+||+|||||++|++.|||++++||+|++|++...|.+.|..|+..+.     
T Consensus       194 ~~vI~DEaH~ikn~~~~~~~al~~l~~~~rl~LTgTPiqN~l~El~sll~fl~p~~l~~~~~F~~~f~~pi~~~~~~~~~  273 (644)
T 1z3i_X          194 GLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADAS  273 (644)
T ss_dssp             CEEEETTGGGCCTTCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHHHHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCC
T ss_pred             cEEEEECceecCChhhHHHHHHHhcccCcEEEEecCcccCCHHHHHHHHHhhCCCcCCCHHHHHHhhcchhhhcCCcCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999998876321     


Q ss_pred             -------hhhHHHHHHHHhhhhhhccCCCCCcCCCCceEEEEEEeCCHHHHHHHHHHHHHHHHHHHHHHhcCCcccchHH
Q 002901          498 -------RKGLSRLQVLMSTISLRRTKDKGLIGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYST  570 (869)
Q Consensus       498 -------~~~~~~L~~ll~~~~lRRtk~~~~~~LP~k~~~~v~v~ls~~e~~~Y~~l~~~~~~~~~~~~~~~~~~~~~~~  570 (869)
                             ...+..|+.++.++++||+|+.+...||++.+.+++++|++.|+++|+.+....+..     ...........
T Consensus       274 ~~~~~~~~~~~~~L~~~l~~~~lRR~k~~v~~~LP~k~~~~v~~~ls~~q~~lY~~~~~~~~~~-----~~~~~g~~~~~  348 (644)
T 1z3i_X          274 DKDRAAGEQKLQELISIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPV-----ESLQTGKISVS  348 (644)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHEECCCGGGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHHCGG-----GSSCTTCCCHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhHHhHhhhCCCceEEEEEeCCCHHHHHHHHHHHHHHHHH-----HHHhcCccchh
Confidence                   234667889999999999999888899999999999999999999999887654321     11111234577


Q ss_pred             HHHHHHHHHHhhcccCCCcccccccCCCCCccccCCChHHHHHHHHHHhcCCCCCCCccCCCCCcceecccCCccchhHH
Q 002901          571 VLSILLRLRQICTNLALCPSDVRSIIPSNTIEDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCI  650 (869)
Q Consensus       571 il~~llrLRq~c~h~~l~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~l~~~~~~~c~~c~~~~~~~~~t~c~h~~c~~ci  650 (869)
                      ++..+++||++|+||.++......                         ..+...  .+.+.                  
T Consensus       349 ~l~~l~~Lrk~c~hp~l~~~~~~~-------------------------~~~~~~--~~~~~------------------  383 (644)
T 1z3i_X          349 SLSSITSLKKLCNHPALIYEKCLT-------------------------GEEGFD--GALDL------------------  383 (644)
T ss_dssp             HHHHHHHHHHHHHCTHHHHHHHHH-------------------------TCTTCT--TGGGT------------------
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHhc-------------------------ccchhh--hHHhh------------------
Confidence            899999999999999886422100                         000000  00000                  


Q ss_pred             HHhhhccCCCCCCCCCCccCCCcccCCCCCCCcccccccccccCcchHHHHHHHHHHhhhcCCCCeEEEEeccHHHHHHH
Q 002901          651 LKTLQHTKPCCPLCRHPLLQSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILL  730 (869)
Q Consensus       651 ~~~~~~~~~~cp~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~K~~~L~~~L~~~~~~~~~~K~lVFsq~~~~ld~l  730 (869)
                                +               +...     .........|+|+..|..++..... .++.|+||||+|+.++++|
T Consensus       384 ----------~---------------~~~~-----~~~~~~~~~s~K~~~l~~ll~~~~~-~~~~k~lIFs~~~~~~~~l  432 (644)
T 1z3i_X          384 ----------F---------------PQNY-----STKAVEPQLSGKMLVLDYILAMTRT-TTSDKVVLVSNYTQTLDLF  432 (644)
T ss_dssp             ----------S---------------CSSC-----CSSSCCGGGSHHHHHHHHHHHHHHH-HCCCEEEEEESCHHHHHHH
T ss_pred             ----------c---------------cccc-----cccccCcccChHHHHHHHHHHHHhh-cCCCEEEEEEccHHHHHHH
Confidence                      0               0000     0001123458999998888887653 3478999999999999999


Q ss_pred             HHHHHHcCCcEEEEeCCCCHHHHHHHHHHhCCCCCCCCEEEEEecCCccccccccccCEEEEEcCCCCcchHHHHhhhhh
Q 002901          731 EEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVH  810 (869)
Q Consensus       731 ~~~L~~~gi~~~rldG~~~~~~R~~~i~~F~~~~~~~~~VlL~S~~agg~GLNLt~A~~Vi~~dp~wnp~~e~QaigRvh  810 (869)
                      +..|...|+.+.+++|+|+.++|++++++|++++. ...|+|+|+++||+||||++|++||++||||||+.+.||+||+|
T Consensus       433 ~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~-~~~v~L~st~a~g~Glnl~~a~~Vi~~d~~wnp~~~~Qa~gR~~  511 (644)
T 1z3i_X          433 EKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSS-PEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVW  511 (644)
T ss_dssp             HHHHHHHTCCEEEECSSCCHHHHHHHHHHHHSTTC-CCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSS
T ss_pred             HHHHHHCCCCEEEEeCCCCHHHHHHHHHHhcCCCC-CcEEEEEecccccCCcccccCCEEEEECCCCCccHHHHHHHhhh
Confidence            99999999999999999999999999999999533 33689999999999999999999999999999999999999999


Q ss_pred             hcCCcccEEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhccccccccCCHHHHHHhhCC
Q 002901          811 RIGQKEDVKIVRLIVRNSIEERILELQDRKKKLAREAFRRKGKDQREVSTDDLRILMSL  869 (869)
Q Consensus       811 RiGQ~k~V~V~rli~~~siEe~i~~~q~~K~~l~~~~~~~~~~~~~~~~~~dl~~lf~~  869 (869)
                      |+||+++|+||+|++++|+||+|+++|..|+.|++.+++++....+.++.+||+.||++
T Consensus       512 R~Gq~~~v~v~~lv~~~tiEe~i~~~~~~K~~l~~~v~~~~~~~~~~~~~~~l~~Lf~~  570 (644)
T 1z3i_X          512 RDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELFSL  570 (644)
T ss_dssp             STTCCSCEEEEEEEETTSHHHHHHHHHHHHHHTSCCCCSCSSSCCCSSCHHHHHHHTCC
T ss_pred             hcCCCCceEEEEEEECCCHHHHHHHHHHHHHHHHHHHhcCcchhhcCCCHHHHHHHhCC
Confidence            99999999999999999999999999999999999999887666678999999999975
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2l1i_A HLTF protein; hiran domain, transcription factor, DNA repair, transc regulation, transcription, structural genomics, structural consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3k2y_A Uncharacterized protein LP_0118; nucleic acid binding,zinc ION binding, structural genomics, PSI-2, protein structure initiative; 2.40A {Lactobacillus plantarum} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 869
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-27
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 8e-07
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 4e-23
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 3e-04
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 1e-20
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 2e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-19
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 8e-16
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-15
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 5e-14
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-13
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-13
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-13
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-12
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 6e-12
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 7e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-11
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-10
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 0.004
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 9e-10
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-09
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 6e-09
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 7e-09
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 1e-08
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-08
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 5e-08
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 4e-04
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 5e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.003
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score =  112 bits (280), Expect = 2e-27
 Identities = 75/214 (35%), Positives = 112/214 (52%), Gaps = 9/214 (4%)

Query: 663 LCRHPLL-------QSDLFSSPPESSDMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTT 715
           LC HP L         + F    +    + + K ++   S K+  L  +L   R    + 
Sbjct: 61  LCNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTR-TTTSD 119

Query: 716 KSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFGNPGPGGPTVLLASL 775
           K V+ S + + L L E+  +   +  +RLDG+M+ KKRA+++E F NP       +L S 
Sbjct: 120 KVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFML-SS 178

Query: 776 KASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILE 835
           KA G G+NL  A+R+ + +P WNPA +EQAM RV R GQK+   I RL+   +IEE+IL+
Sbjct: 179 KAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQ 238

Query: 836 LQDRKKKLAREAFRRKGKDQREVSTDDLRILMSL 869
            Q  KK L+      +   +R  S  +LR L SL
Sbjct: 239 RQAHKKALSSCVVDEEQDVERHFSLGELRELFSL 272
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query869
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.87
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.8
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.76
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.75
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.72
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.7
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.67
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.64
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.56
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.54
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.49
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.47
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.45
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.33
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.26
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.2
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.16
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.16
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.11
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.04
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.98
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 98.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.84
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.83
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.81
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.77
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.77
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.76
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.71
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.68
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.64
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.59
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.58
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.52
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.39
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.39
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.33
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.28
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.27
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.25
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.11
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.04
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.01
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.98
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.93
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.86
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.79
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.76
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.67
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.13
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.13
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 96.54
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.97
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 94.88
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 94.75
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.69
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.01
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 87.8
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 84.04
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 82.27
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=7.6e-46  Score=403.20  Aligned_cols=266  Identities=32%  Similarity=0.439  Sum_probs=215.0

Q ss_pred             cCCCCceEEEEEEeCCHHHHHHHHHHHHHHHHHHHHHHhcCCcccchHHHHHHHHHHHHhhcccCCCcccccccCCCCCc
Q 002901          522 IGLQPKTIEKYYVELSLEERKLYDELEGKAKGVVQDYINAGSLMRNYSTVLSILLRLRQICTNLALCPSDVRSIIPSNTI  601 (869)
Q Consensus       522 ~~LP~k~~~~v~v~ls~~e~~~Y~~l~~~~~~~~~~~~~~~~~~~~~~~il~~llrLRq~c~h~~l~~~~~~~~~~~~~~  601 (869)
                      ..||||++.+++|+||+.|+++|+.+....+.     ...........++|..+++|||+||||.|+.......      
T Consensus         7 k~LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~-----~~~~~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~~~------   75 (346)
T d1z3ix1           7 KYLPVKIEQVVCCNLTPLQKELYKLFLKQAKP-----VESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTG------   75 (346)
T ss_dssp             GTSCCEEEEEEEECCCHHHHHHHHHHHHHHCG-----GGSSCTTCCCHHHHHHHHHHHHHHHCTHHHHHHHHHT------
T ss_pred             ccCCCCEEEEEEeCCCHHHHHHHHHHHHHHHH-----HHhhhcCCchHHHHHHHHHHHHHhCCHHHhhhhhccc------
Confidence            37999999999999999999999988765432     1122223445678999999999999999864321100      


Q ss_pred             cccCCChHHHHHHHHHHhcCCCCCCCccCCCCCcceecccCCccchhHHHHhhhccCCCCCCCCCCccCCCcccCCCCCC
Q 002901          602 EDVSNNPDLLKKLVEVLQDGEDFDCPICISPPSDIIITCCAHIFCRSCILKTLQHTKPCCPLCRHPLLQSDLFSSPPESS  681 (869)
Q Consensus       602 ~~~~~~~e~~~~~~~~l~~~~~~~c~~c~~~~~~~~~t~c~h~~c~~ci~~~~~~~~~~cp~c~~~~~~~~~~~~~~~~~  681 (869)
                                         .........                                             ..+.   
T Consensus        76 -------------------~~~~~~~~~---------------------------------------------~~~~---   88 (346)
T d1z3ix1          76 -------------------EEGFDGALD---------------------------------------------LFPQ---   88 (346)
T ss_dssp             -------------------CTTCTTGGG---------------------------------------------TSCS---
T ss_pred             -------------------cccccchhh---------------------------------------------hccc---
Confidence                               000000000                                             0000   


Q ss_pred             CcccccccccccCcchHHHHHHHHHHhhhcCCCCeEEEEeccHHHHHHHHHHHHHcCCcEEEEeCCCCHHHHHHHHHHhC
Q 002901          682 DMDIAGKTLKNFTSSKVSALLTLLLQLRDKKPTTKSVVFSQFRKMLILLEEPLQAAGFKLLRLDGSMNAKKRAQVIEEFG  761 (869)
Q Consensus       682 ~~~~~~~~~~~~~s~K~~~L~~~L~~~~~~~~~~K~lVFsq~~~~ld~l~~~L~~~gi~~~rldG~~~~~~R~~~i~~F~  761 (869)
                        ...........|+|+..|.++|..... .+++|+||||+|+.++++|+..|...|++|.+++|+++.++|.+++++|+
T Consensus        89 --~~~~~~~~~~~S~Kl~~L~~ll~~~~~-~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~  165 (346)
T d1z3ix1          89 --NYSTKAVEPQLSGKMLVLDYILAMTRT-TTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFN  165 (346)
T ss_dssp             --SCCSSSCCGGGSHHHHHHHHHHHHHHH-HCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHHHHH
T ss_pred             --cccccccccccCHHHHHHHHHHHHHHH-hcCCceeEEeehhhhhHHHHHHHhhhhccccccccchhHHHHHHHHHhhh
Confidence              000001123459999999999987653 35899999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCEEEEEecCCccccccccccCEEEEEcCCCCcchHHHHhhhhhhcCCcccEEEEEEEeCCCHHHHHHHHHHHHH
Q 002901          762 NPGPGGPTVLLASLKASGAGVNLTAASRVFLLEPWWNPAVEEQAMDRVHRIGQKEDVKIVRLIVRNSIEERILELQDRKK  841 (869)
Q Consensus       762 ~~~~~~~~VlL~S~~agg~GLNLt~A~~Vi~~dp~wnp~~e~QaigRvhRiGQ~k~V~V~rli~~~siEe~i~~~q~~K~  841 (869)
                      +++. ...|||+|+++||+||||+.|++||+|||||||+.+.||+||+||+||+++|+||||+++|||||+|+++|..|+
T Consensus       166 ~~~~-~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~rli~~~TiEe~i~~~~~~K~  244 (346)
T d1z3ix1         166 NPSS-PEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKK  244 (346)
T ss_dssp             STTC-CCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEEEEETTSHHHHHHHHHHHHH
T ss_pred             cccc-cceeeeecchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEEEEEeCCCHHHHHHHHHHHHH
Confidence            8543 337999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhccccccccCCHHHHHHhhCC
Q 002901          842 KLAREAFRRKGKDQREVSTDDLRILMSL  869 (869)
Q Consensus       842 ~l~~~~~~~~~~~~~~~~~~dl~~lf~~  869 (869)
                      .+++.++++.....+..+.+||+.||++
T Consensus       245 ~l~~~v~~~~~~~~~~~~~~~l~~lf~~  272 (346)
T d1z3ix1         245 ALSSCVVDEEQDVERHFSLGELRELFSL  272 (346)
T ss_dssp             HTSCCCCSCSSSCCCSSCHHHHHHHTCC
T ss_pred             HHHHHHhCCchhhhhcCCHHHHHHHhcC
Confidence            9999999987656667899999999975
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure