Citrus Sinensis ID: 002997

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------86

MANSGANKAGSCSVLSLDKGSKNKRKVAEPSQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPLSDAGSSRGTEVDKEAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDSKEFSGESSSSSSPSQLRSEDQGSGTFPPNTSKSNVPRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPERDSLVSMAESVEKSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRGHCASTRTPLAHPVSDSPSSLPTKGTTLALPVPNTELVASSSSKKNPDIKAVATTSPSPKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTLEMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGKLESQLSLLKYKSDSSKIAALRGSVDGGFMPDGKIENPAMKKGSKIPGLLMGGGSSSGSSLMGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEcccccccccccHHHHHHcccccccccccccccEEEEEEccc

cccccccccccccEccccccccccHHcccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccHHHHHcccccccHHccHccccccccccccccccccEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHcccccccccccHccccccccHccccccccHHccccccccccEEEEEccccEEEEEEEcccEEEEHHHHHHHHHHcccccccccccccEEEEEEEccc

mansgankagscsvlsldkgsknkrkvaepsqmnpvnlptsltefpryqqslekpqnplsypplsdagssrgtevdkeaecesgewddpIVCALGELLSSGLNTLFRNVIKQIsecgyseddatknIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISqactvegdilsfldskefsgesssssspsqlrsedqgsgtfppntsksnvprpskptepskfskpgakcsmsetlkfgsfpnmpnprnsfvtekmlperdSLVSMAESVEKSLSSLGEHAQnmsltlgsdersgngrkgrskKELAILRQKschvpteksyrtygkgafrsgklasmggfvlekrvrpasdlsavhpksgpskisadtgaaaasrdrghcastrtplahpvsdspsslptkgttlalpvpntelvasssskknpdikavattspspklpeyyagipfdetlgryipqngkdeliLKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAqverssstvhTLEMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGKLESQLSLLKYKSDSSKIAAlrgsvdggfmpdgkienpamkkgskipgllmgggsssgsslmgglkreRECVVCLaeeksvvflpcaHQVLCQKCNElhekqgmndcpscrspiQQRIQVRFAQP

mansgankagscsvlsldKGSKNkrkvaepsqmnpvnlptSLTEFPRYQQSLEKPQNPLSYPPLSDAGSSRGTEVDKEAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKvkgtnssrdeMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDSKEFsgesssssspsqlrsedqgsgtfppntsksnvprpskptepskfskpgakcSMSETLkfgsfpnmpnPRNSFVTEKMLPERDSLVSMAESVEKSLSSlgehaqnmsltlgsdersgngrkgrskkelailrqkschvpteksyrtygkgafrsgklasMGGFVLEKRVRPASdlsavhpksgpskisADTGAAAASRDRGHCAStrtplahpvsdspsslpTKGTTLALPVPNTELVasssskknpdikavattspspklpeyYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRHekqeveqcqkdkqileENTVKRLSEMEFALTnataqverssstvhTLEMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQeiskaenrhnqletrwrEERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGKLESQLSLLKYKSDSSKIAAlrgsvdggfmpdgKIENPAMKKGSKIPGLLMGGGSSSGSSLMGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

MANSGANKAGSCSVLSLDKGSKNKRKVAEPSQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPLSDAGSSRGTEVDKEAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDskefsgesssssspsqlrseDQGSGTFPPNTSKSNVPRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPERDSLVSMAESVEKSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRGHCASTRTPLAHPVSDSPSSLPTKGTTLALPVPNTELVASSSSKKNPDIKAVATTSPSPKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTLEMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQleaaakaeeemikleaekemSKLTEDIGKLEsqlsllkyksdsskIAALRGSVDGGFMPDGKIENPAMKKGSKIPgllmgggsssgsslmgglKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

************************************************************************************EWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEK**********MFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFL***************************************************************************************************************************************************YRTYGKGAFRSGKLASMGGFVL*************************************************************************************************EYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKV**************************************************************************************************************************************************************************************************************************************************************************RECVVCLAEEKSVVFLPCAHQVLCQKCNELH**************************

******************************************T*FPR**********************************ESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSA*************MFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQA**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************CLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFA**

***********CSVLSLD************SQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPL*******************GEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDSK****************************************************CSMSETLKFGSFPNMPNPRNSFVTEKMLPERDSLV***********SLGEHAQNMSLTLG***************ELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVRPAS********************************TRTP**************KGTTLALPVPNTE*******************SPSPKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKAL***********KDKQILEENTVKRLSEMEFALTN************HTLEMEHSVLKKEMEAAN**************EREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGKLESQLSLLKYKSDSSKIAALRGSVDGGFMPDGKIENPAMKKGSKIPGLLMGGG************RERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

**********************************P*NLPTSLTEFPRYQQSLEKPQNPL*Y**********************GEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDI*********************************************************************S****************************************************************ELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVR*****************S*****AA***************************************************************PKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTLEMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGKLESQLSLLKYKSDSSKIAALRGS*****************************************KRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MANSGANKAGSCSVLSLDKGSKNKRKVAEPSQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPLSDAGSSRGTEVDKEAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDSKEFSGESSSSSSPSQLRSEDQGSGTFPPNTSKSNVPRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPERDSLVSMAESVEKSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRGHCASTRTPLAHPVSDSPSSLPTKGTTLALPVPNTELVASSSSKKNPDIKAVATTSPSPKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVKRLSEMEFALTNATAQVERSSSTxxxxxxxxxxxxxxxxxxxxxAAKSAVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWREERMAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLLKYKSDSSKIAALRGSVDGGFMPDGKIENPAMKKGSKIPGLLMGGGSSSGSSLMGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		859	2.2.26 [Sep-21-2011]
Q0WPJ7		814	Putative E3 ubiquitin-pro	yes	no	0.920	0.971	0.466	0.0
Q9ZVT8		823	Putative E3 ubiquitin-pro	no	no	0.901	0.940	0.445	1e-179
Q8RX22		711	MND1-interacting protein	no	no	0.408	0.493	0.316	1e-38
Q84ME1		378	Probable E3 ubiquitin-pro	no	no	0.074	0.169	0.391	8e-07
Q7ZUL9		529	Probable E3 ubiquitin-pro	no	no	0.059	0.096	0.423	2e-06
Q3TEL6		685	RING finger protein 157 O	no	no	0.059	0.074	0.423	3e-06
Q96PX1		679	RING finger protein 157 O	yes	no	0.059	0.075	0.423	3e-06
Q13490		618	Baculoviral IAP repeat-co	no	no	0.067	0.093	0.424	6e-06
Q62210		612	Baculoviral IAP repeat-co	no	no	0.067	0.094	0.409	8e-06
Q9LFH6		299	Probable E3 ubiquitin-pro	no	no	0.081	0.234	0.323	8e-06

>sp\|Q0WPJ7\|RF298_ARATH Putative E3 ubiquitin-protein ligase RF298 OS=Arabidopsis thaliana GN=RF298 PE=2 SV=1	Back alignment and function desciption

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/856 (46%), Positives = 532/856 (62%), Gaps = 65/856 (7%)

Query: 8   KAGSCSVLS--LDKGSKNKRKVAEPSQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPLS 65
           K G+ S +S   DKG KNKRK+A+PS  N      SLTEFPRY+    K Q+PL     +
Sbjct: 18  KVGTSSSVSPPQDKGRKNKRKLADPSPQNAA----SLTEFPRYELHSFKSQSPLCE---N 70

Query: 66  DAGSSRGTEVDKEAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATK 125
           D+      E     E +S  WDDP  C L  LLSS L TLFR+ + QI +CGYSED   K
Sbjct: 71  DSNGQLKAE-----ESDSVGWDDPFACHLEGLLSSNLLTLFRSAMNQIMDCGYSEDVVLK 125

Query: 126 NIARHSIYCGGKDLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRD 185
            I+    YCGG DLVSNIVNDTLS L+  K    SRD +F++LQQ+V Y+++E I+++R+
Sbjct: 126 AISSSRFYCGGTDLVSNIVNDTLSFLKSGKKVAGSRDYVFEDLQQLVAYSLVEKISLVRE 185

Query: 186 VKTSLSIAEAMWWLLMCDLNISQACTVEGDILSFLDSKEFSGESSSSSSPSQLRSEDQGS 245
           V+ SLS  EAMW LL+CDLN+ +A  V+ D           G   SS S +   SE   +
Sbjct: 186 VRPSLSTDEAMWRLLICDLNVLKAFEVDAD-----------GLEGSSVSNASKSSESPVA 234

Query: 246 GTFPPNTSKSNVPRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPE 305
              PP +S ++ P+       SK S+P         +KFG+F N+ N +N        P 
Sbjct: 235 ECNPPKSSDADNPKAPVSNTQSKQSEP---------VKFGNFANVNNSKN--------PH 277

Query: 306 RDSLVSMAESVEKSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTE 365
                   E    S +S GE  ++ SLT  SDE+  + RKGR+KKE+A+LRQKSC    E
Sbjct: 278 ASGATPGKEVFSVSTAS-GEGTKSASLTSVSDEKLVSCRKGRTKKEMAMLRQKSC---VE 333

Query: 366 KSYRTYGKGAFRSGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRG 425
           K  RTY KG     K A  GGF++EKR + ASDL +   ++  SKI+ +         + 
Sbjct: 334 K-IRTYSKGG--GYKTAKFGGFLVEKRGKSASDLLSAQARNSSSKITTEVM-------KI 383

Query: 426 HCASTRTPLAHPV-SDSPSSLPTKGTTLALPVPNTELVASSSSKKN--PDIKAVATTSPS 482
             A + + L++   SDSP+ L  K    ALP  N     +S  K    P+ K   +T P+
Sbjct: 384 PLAESSSTLSNSTKSDSPA-LDVKEHVTALPANNAPAPVASEKKSGSEPEEKPSVSTKPA 442

Query: 483 PKLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARR 542
           P   +YYA IP+D TLG YIP+N +DELILKLVP + +LQ EL  WT+WANQKV QA  R
Sbjct: 443 P---DYYAAIPYDATLGIYIPRNKRDELILKLVPRMKDLQKELQDWTDWANQKVKQATVR 499

Query: 543 LSKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTL 602
           L KDQ ELKALR EK+E E+ +K+KQ+LEENT+KR SEME AL NAT Q+ER+++T+  L
Sbjct: 500 LLKDQPELKALRKEKEEAEEFRKEKQLLEENTIKRRSEMELALNNATNQLERTNNTIRRL 559

Query: 603 EMEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKV 662
           E+E S+LK+E EAAN+RA++SA SC+EA ER Q+ LKN+QS E Q+ LL+EEL +++ KV
Sbjct: 560 ELEQSLLKREREAANIRASESAESCREAKERVQRLLKNSQSWEGQKNLLQEELKSQRDKV 619

Query: 663 AVLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEA 722
           A LQQE++KA+ R NQ+E  W++E+ A   L AQAAA++ +R +LE   KAEEE IK +A
Sbjct: 620 AGLQQEVAKAKTRQNQIEATWKQEKSATGKLTAQAAALKKERGKLEELGKAEEERIKTKA 679

Query: 723 EKEMSKLTEDIGKLESQLSLLKYKSDSSKIAALRGSVDGGFMPDGKIENPAMKKGSKIPG 782
           E ++    E+I +L++++S LK KSDS KIAAL+  +DG    DG          +K   
Sbjct: 680 ENDVKYYIENIKRLDTEISKLKLKSDSLKIAALKKGIDGN--NDGNKSGMNHTTNTKANS 737

Query: 783 LLMGGGSSSGSSLMGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCP 842
           +       +       +KRERECV+CL+EE SV+FLPCAHQVLC KCN+LHEK+ M DCP
Sbjct: 738 MASAKVWENNQGAESKIKRERECVMCLSEEMSVIFLPCAHQVLCSKCNQLHEKEAMEDCP 797

Query: 843 SCRSPIQQRIQVRFAQ 858
           SCR+ IQ+RIQ RFA+
Sbjct: 798 SCRAKIQRRIQARFAR 813

Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q9ZVT8\|RF4_ARATH Putative E3 ubiquitin-protein ligase RF4 OS=Arabidopsis thaliana GN=RF4 PE=3 SV=1	Back alignment and function description

>sp\|Q8RX22\|MIP1_ARATH MND1-interacting protein 1 OS=Arabidopsis thaliana GN=MIP1 PE=1 SV=1	Back alignment and function description

>sp\|Q84ME1\|LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana GN=LUL3 PE=1 SV=1	Back alignment and function description

>sp\|Q7ZUL9\|MGRN1_DANRE Probable E3 ubiquitin-protein ligase MGRN1 OS=Danio rerio GN=mgrn1 PE=2 SV=1	Back alignment and function description

>sp\|Q3TEL6\|RN157_MOUSE RING finger protein 157 OS=Mus musculus GN=Rnf157 PE=2 SV=2	Back alignment and function description

>sp\|Q96PX1\|RN157_HUMAN RING finger protein 157 OS=Homo sapiens GN=RNF157 PE=1 SV=3	Back alignment and function description

>sp\|Q13490\|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens GN=BIRC2 PE=1 SV=2	Back alignment and function description

>sp\|Q62210\|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1	Back alignment and function description

>sp\|Q9LFH6\|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana GN=LUL2 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		859
297813999		802	protein binding protein [Arabidopsis lyr	0.908	0.972	0.475	0.0
42566260		814	putative E3 ubiquitin-protein ligase RF2	0.920	0.971	0.466	0.0
225432464		893	PREDICTED: putative E3 ubiquitin-protein	0.958	0.921	0.424	1e-180
3924605		864	putative inhibitor of apoptosis [Arabido	0.922	0.916	0.440	1e-179
334182266		823	zinc ion binding protein [Arabidopsis th	0.901	0.940	0.445	1e-178
297843150		1872	C2 domain-containing protein [Arabidopsi	0.899	0.412	0.442	1e-176
255551557		894	conserved hypothetical protein [Ricinus	0.935	0.899	0.407	1e-168
255567628		734	nutrient reservoir, putative [Ricinus co	0.791	0.926	0.475	1e-164
224102555		762	predicted protein [Populus trichocarpa]	0.868	0.979	0.413	1e-161
356549037		883	PREDICTED: putative E3 ubiquitin-protein	0.895	0.870	0.425	1e-157

>gi\|297813999\|ref\|XP_002874883.1\| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297320720\|gb\|EFH51142.1\| protein binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/843 (47%), Positives = 528/843 (62%), Gaps = 63/843 (7%)

Query: 18  DKGSKNKRKVAEPSQMNPVNLPTSLTEFPRYQQSLEKPQNPLSYPPLSDAGSSRGTEVDK 77
           +KG KNKRK+A+PS  N      SLTEFPRY+    K Q+PLS    +D+      E   
Sbjct: 20  EKGRKNKRKLADPSPQNAA----SLTEFPRYELHSLKSQSPLSE---NDSNGQLKAE--- 69

Query: 78  EAECESGEWDDPIVCALGELLSSGLNTLFRNVIKQISECGYSEDDATKNIARHSIYCGGK 137
             E +S  WDDP  C L +LLSS L TLFR+ + QI +CGYSED   K I+   +YCGG 
Sbjct: 70  --ESDSVGWDDPFACQLEQLLSSNLLTLFRSAMNQIMDCGYSEDVVLKAISSSRLYCGGN 127

Query: 138 DLVSNIVNDTLSALEKVKGTNSSRDEMFDNLQQMVDYTMLEMINVLRDVKTSLSIAEAMW 197
           DLVSNIVNDTLS L+  K    SRD +F++LQQ+V YT++E I+++R+V+ SLS  EAMW
Sbjct: 128 DLVSNIVNDTLSILKSGKNVAGSRDYVFEDLQQLVAYTLVEKISLVREVRPSLSTVEAMW 187

Query: 198 WLLMCDLNISQACTVEGDILSFLDSKEFSGESSSSSSPSQLRSEDQGSGTFPPNTSKSNV 257
            LLMCDLN+ QA  VEGD    L+    S  S S  SP    +  + SG+  P    SN 
Sbjct: 188 RLLMCDLNVLQAFEVEGD---GLEGSSGSNASKSLESPVSECNPSKSSGSDNPKAPISN- 243

Query: 258 PRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPERDSLVSMAESVE 317
                           A+ + SE +KFG+FPN+ N +N        P         E   
Sbjct: 244 ----------------AQSNQSEPVKFGNFPNVNNSKN--------PHASGATPGKEVFS 279

Query: 318 KSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTEKSYRTYGKGAFR 377
            S +S GE  ++ SLT  SDE+  + RKGR+KKE+A+LRQKSC    EK  RTY KG   
Sbjct: 280 VSTAS-GEGTKSASLTSVSDEKLVSCRKGRTKKEMAMLRQKSC---VEK-IRTYSKGG-- 332

Query: 378 SGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRGHCASTRTPLAHP 437
             K A  GGF++EKR + ASDL +   ++  SKI+ D      +       S+ T   + 
Sbjct: 333 GYKTAKFGGFLVEKRSKAASDLLSAQARNSSSKITTDVMKIPLAE------SSSTLSNNT 386

Query: 438 VSDSPSSLPTKGTTLALPVPNTELVASSSSKKN--PDIKAVATTSPSPKLPEYYAGIPFD 495
            SDSP+ L  K    ALP  N     +S  K    P+ KA  +T P+P   +Y A IP+D
Sbjct: 387 KSDSPA-LDVKEHVTALPANNAPATVASEKKSGSEPEEKASVSTKPAP---DYCAAIPYD 442

Query: 496 ETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRLSKDQAELKALRH 555
            +LG Y+P+N  DELILKLVP + +LQ EL  WT+WANQKV QA  RL KDQ ELKALR 
Sbjct: 443 ASLGIYVPRNKGDELILKLVPRMKDLQKELQDWTDWANQKVKQATVRLLKDQPELKALRK 502

Query: 556 EKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTLEMEHSVLKKEMEA 615
           EK+E E+ +K+KQ+LEENT+KR SEME AL NAT Q+ER+++T+  LE+E S+LK+E EA
Sbjct: 503 EKEEAEEFRKEKQLLEENTMKRRSEMELALNNATNQLERTNNTIRRLELEQSLLKREREA 562

Query: 616 ANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVAVLQQEISKAENR 675
           AN+RAA+SA SC+EA ER Q+ LKNAQS E Q+VLL+EEL ++K KVA LQQE++KA+ R
Sbjct: 563 ANIRAAESAESCREAKERVQRLLKNAQSWEGQKVLLQEELKSQKDKVAELQQEVAKAKTR 622

Query: 676 HNQLETRWREERMARENLLAQAAAIRNQREQLEAAAKAEEEMIKLEAEKEMSKLTEDIGK 735
            NQ+E  W++E+ A   L  QAAA++ +R +LE   KAEEE IK +AE ++    E+I +
Sbjct: 623 QNQIEATWKQEKAATGKLTTQAAALKKERGKLEELGKAEEERIKTKAENDVKYYIENIKR 682

Query: 736 LESQLSLLKYKSDSSKIAALRGSVDGGFMPDGKIENPAMKKGSKIPGLLMGGGSSSGSSL 795
           L++++S LK KSD  KIAAL+  +DG     G + +    K + +    +   +    S 
Sbjct: 683 LDTEISKLKLKSDCLKIAALKKGIDGSNDKSG-MNHTTTTKANPMAATKVWENNHRAES- 740

Query: 796 MGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVR 855
              +KRERECV+CL+EE SV+FLPCAHQVLC KCN+LHEK+ M DCPSCR+ IQ+RIQ R
Sbjct: 741 --KIKRERECVMCLSEEMSVIFLPCAHQVLCSKCNQLHEKEAMEDCPSCRAKIQRRIQAR 798

Query: 856 FAQ 858
           F+ 
Sbjct: 799 FSH 801

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|42566260|ref|NP_192209.2| putative E3 ubiquitin-protein ligase RF298 [Arabidopsis thaliana] gi|42572815|ref|NP_974504.1| putative E3 ubiquitin-protein ligase RF298 [Arabidopsis thaliana] gi|122229999|sp|Q0WPJ7.1|RF298_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase RF298; AltName: Full=RING finger protein 298 gi|110738035|dbj|BAF00952.1| hypothetical protein [Arabidopsis thaliana] gi|332656858|gb|AEE82258.1| putative E3 ubiquitin-protein ligase RF298 [Arabidopsis thaliana] gi|332656859|gb|AEE82259.1| putative E3 ubiquitin-protein ligase RF298 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|225432464\|ref\|XP_002277269.1\| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|3924605\|gb\|AAC79106.1\| putative inhibitor of apoptosis [Arabidopsis thaliana] gi\|7269785\|emb\|CAB77785.1\| putative protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334182266\|ref\|NP_001184899.1\| zinc ion binding protein [Arabidopsis thaliana] gi\|75217041\|sp\|Q9ZVT8.1\|RF4_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase RF4; AltName: Full=RING finger protein 4 gi\|3850566\|gb\|AAC72106.1\| F15K9.3 [Arabidopsis thaliana] gi\|332189443\|gb\|AEE27564.1\| zinc ion binding protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297843150\|ref\|XP_002889456.1\| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297335298\|gb\|EFH65715.1\| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|255551557\|ref\|XP_002516824.1\| conserved hypothetical protein [Ricinus communis] gi\|223543912\|gb\|EEF45438.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|255567628\|ref\|XP_002524793.1\| nutrient reservoir, putative [Ricinus communis] gi\|223535977\|gb\|EEF37636.1\| nutrient reservoir, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224102555\|ref\|XP_002312723.1\| predicted protein [Populus trichocarpa] gi\|222852543\|gb\|EEE90090.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356549037\|ref\|XP_003542905.1\| PREDICTED: putative E3 ubiquitin-protein ligase RF298-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		859
TAIR\|locus:2139310		814	AT4G03000 [Arabidopsis thalian	0.690	0.728	0.434	9.5e-163
TAIR\|locus:2062374		738	AT2G35330 [Arabidopsis thalian	0.253	0.295	0.347	3.3e-62
TAIR\|locus:2033765		711	AT1G32530 [Arabidopsis thalian	0.253	0.306	0.310	1.9e-52
WB\|WBGene00019649		400	K11D12.9 [Caenorhabditis elega	0.055	0.12	0.411	1.1e-07
UNIPROTKB\|E2RR59		728	LRSAM1 "Uncharacterized protei	0.053	0.063	0.431	3.3e-07
UNIPROTKB\|Q08E63		724	LRSAM1 "Uncharacterized protei	0.053	0.063	0.431	4e-07
UNIPROTKB\|J9P525		728	LRSAM1 "Uncharacterized protei	0.053	0.063	0.431	5.2e-07
RGD\|1564403		727	Lrsam1 "leucine rich repeat an	0.053	0.063	0.450	1e-06
ZFIN\|ZDB-GENE-060526-97		721	lrsam1 "leucine rich repeat an	0.053	0.063	0.431	1.2e-06
UNIPROTKB\|Q6UWE0		723	LRSAM1 "E3 ubiquitin-protein l	0.053	0.063	0.431	1.2e-06

TAIR\|locus:2139310 AT4G03000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1141 (406.7 bits), Expect = 9.5e-163, Sum P(2) = 9.5e-163
 Identities = 267/615 (43%), Positives = 354/615 (57%)

Query:   246 GTFPPNTSKSNVPRPSKPTEPSKFSKPGAKCSMSETLKFGSFPNMPNPRNSFVTEKMLPE 305
             G+   N SKS+    ++   P        K  +S T    S P +     + V     P 
Sbjct:   219 GSSVSNASKSSESPVAECNPPKSSDADNPKAPVSNTQSKQSEP-VKFGNFANVNNSKNPH 277

Query:   306 RDSLVSMAESVEKSLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTE 365
                     E    S +S GE  ++ SLT  SDE+  + RKGR+KKE+A+LRQKSC    E
Sbjct:   278 ASGATPGKEVFSVSTAS-GEGTKSASLTSVSDEKLVSCRKGRTKKEMAMLRQKSC---VE 333

Query:   366 KSYRTYGKGAFRSGKLASMGGFVLEKRVRPASDLSAVHPKSGPSKISADTGAAAASRDRG 425
             K  RTY KG     K A  GGF++EKR + ASDL +   ++  SKI+ +      +    
Sbjct:   334 K-IRTYSKGG--GYKTAKFGGFLVEKRGKSASDLLSAQARNSSSKITTEVMKIPLAE--- 387

Query:   426 HCASTRTPLAHPVSDSPSSLPTKGTTLALPVPNTELVASSSSKKN--PDIKAVATTSPSP 483
                S+ T      SDSP+ L  K    ALP  N     +S  K    P+ K   +T P+P
Sbjct:   388 ---SSSTLSNSTKSDSPA-LDVKEHVTALPANNAPAPVASEKKSGSEPEEKPSVSTKPAP 443

Query:   484 KLPEYYAGIPFDETLGRYIPQNGKDELILKLVPWVPELQNELNSWTEWANQKVMQAARRL 543
                +YYA IP+D TLG YIP+N +DELILKLVP + +LQ EL  WT+WANQKV QA  RL
Sbjct:   444 ---DYYAAIPYDATLGIYIPRNKRDELILKLVPRMKDLQKELQDWTDWANQKVKQATVRL 500

Query:   544 SKDQAELKALRHEKQEVEQCQKDKQILEENTVKRLSEMEFALTNATAQVERSSSTVHTLE 603
              KDQ ELKALR EK+E E+ +K+KQ+LEENT+KR SEME AL NAT Q+ER+++T+  LE
Sbjct:   501 LKDQPELKALRKEKEEAEEFRKEKQLLEENTIKRRSEMELALNNATNQLERTNNTIRRLE 560

Query:   604 MEHSVLKKEMEAANLRAAKSAVSCQEAFEREQKALKNAQSLEAQRVLLREELATEKQKVA 663
             +E S+LK+E EAAN+RA++SA SC+EA ER Q+ LKN+QS E Q+ LL+EEL +++ KVA
Sbjct:   561 LEQSLLKREREAANIRASESAESCREAKERVQRLLKNSQSWEGQKNLLQEELKSQRDKVA 620

Query:   664 VLQQEISKAENRHNQLETRWREERMARENLLAQAAAIRNQREQXXXXXXXXXXXXXXXXX 723
              LQQE++KA+ R NQ+E  W++E+ A   L AQAAA++ +R +                 
Sbjct:   621 GLQQEVAKAKTRQNQIEATWKQEKSATGKLTAQAAALKKERGKLEELGKAEEERIKTKAE 680

Query:   724 XXXSKLTEDIGKLEXXXXXXXXXXXXXXIAALRGSVDGGFMPDGKIENPAMKKGSKIPXX 783
                    E+I +L+              IAAL+  +DG    DG          +K    
Sbjct:   681 NDVKYYIENIKRLDTEISKLKLKSDSLKIAALKKGIDGN--NDGNKSGMNHTTNTKANSM 738

Query:   784 XXXXXXXXXXXXXXXXKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPS 843
                             KRERECV+CL+EE SV+FLPCAHQVLC KCN+LHEK+ M DCPS
Sbjct:   739 ASAKVWENNQGAESKIKRERECVMCLSEEMSVIFLPCAHQVLCSKCNQLHEKEAMEDCPS 798

Query:   844 CRSPIQQRIQVRFAQ 858
             CR+ IQ+RIQ RFA+
Sbjct:   799 CRAKIQRRIQARFAR 813

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0008270 "zinc ion binding" evidence=IEA

TAIR\|locus:2062374 AT2G35330 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033765 AT1G32530 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

WB\|WBGene00019649 K11D12.9 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RR59 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q08E63 LRSAM1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P525 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1564403 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060526-97 lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6UWE0 LRSAM1 "E3 ubiquitin-protein ligase LRSAM1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0WPJ7	RF298_ARATH	6, ., 3, ., 2, ., -	0.4661	0.9208	0.9717	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		859
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	5e-15
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	9e-14
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	3e-12
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	3e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-10
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-10
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-09
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	1e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-07
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	6e-07
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	1e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-06
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	6e-06
TIGR03345		852	TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp	8e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-05
PHA02562		562	PHA02562, 46, endonuclease subunit; Provisional	4e-05
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	5e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	7e-05
COG4372		499	COG4372, COG4372, Uncharacterized protein conserve	7e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	8e-05
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	9e-05
pfam00769		244	pfam00769, ERM, Ezrin/radixin/moesin family	9e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-04
smart00184		40	smart00184, RING, Ring finger	1e-04
TIGR02680		1353	TIGR02680, TIGR02680, TIGR02680 family protein	1e-04
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	2e-04
pfam13868		349	pfam13868, Trichoplein, Tumour suppressor, Mitosta	2e-04
COG2268		548	COG2268, COG2268, Uncharacterized protein conserve	2e-04
TIGR00618		1042	TIGR00618, sbcc, exonuclease SbcC	3e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	5e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-04
pfam12037		276	pfam12037, DUF3523, Domain of unknown function (DU	6e-04
TIGR00618		1042	TIGR00618, sbcc, exonuclease SbcC	7e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.001
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.001
COG1842		225	COG1842, PspA, Phage shock protein A (IM30), suppr	0.001
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	0.001
pfam05622		713	pfam05622, HOOK, HOOK protein	0.001
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.002
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	0.002
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	0.002
PRK09039		343	PRK09039, PRK09039, hypothetical protein; Validate	0.002
TIGR00414		418	TIGR00414, serS, seryl-tRNA synthetase	0.002
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	0.003
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.003
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.004
PRK06669		281	PRK06669, fliH, flagellar assembly protein H; Vali	0.004

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

 Score = 69.3 bits (170), Expect = 5e-15
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 801 RERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQR 851
            +  CV+CL   ++VVFLPC H  LC++C +    +    CP CR PI+  
Sbjct: 1   EDDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSK--KKCPICRQPIESV 49

Length = 49

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|222878 PHA02562, 46, endonuclease subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|216108 pfam00769, ERM, Ezrin/radixin/moesin family	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|233973 TIGR02680, TIGR02680, TIGR02680 family protein	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin	Back alignment and domain information

>gnl\|CDD\|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|129705 TIGR00618, sbcc, exonuclease SbcC	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523)	Back alignment and domain information

>gnl\|CDD\|129705 TIGR00618, sbcc, exonuclease SbcC	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

>gnl\|CDD\|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|218661 pfam05622, HOOK, HOOK protein	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|181619 PRK09039, PRK09039, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|232965 TIGR00414, serS, seryl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235850 PRK06669, fliH, flagellar assembly protein H; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		859
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	99.96
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	99.78
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.06
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	98.9
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.88
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	98.78
KOG0979		1072	consensus Structural maintenance of chromosome pro	98.75
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.74
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.73
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.69
PRK11637		428	AmiB activator; Provisional	98.58
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.58
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.54
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.52
PHA02929		238	N1R/p28-like protein; Provisional	98.52
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.47
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.45
PRK11637		428	AmiB activator; Provisional	98.44
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.41
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.39
PRK03918		880	chromosome segregation protein; Provisional	98.34
PHA02926		242	zinc finger-like protein; Provisional	98.34
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.31
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.28
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.26
PRK02224		880	chromosome segregation protein; Provisional	98.25
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	98.24
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.22
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.21
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.19
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.17
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.15
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.15
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.14
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.14
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.12
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.12
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	98.12
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.12
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.12
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.11
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.05
PRK02224		880	chromosome segregation protein; Provisional	98.03
COG4942		420	Membrane-bound metallopeptidase [Cell division and	98.03
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.03
PF14634		44	zf-RING_5: zinc-RING finger domain	98.02
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	98.01
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.01
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	97.98
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.97
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.95
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.92
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.87
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.87
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.87
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.86
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	97.86
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	97.86
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.83
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.81
PHA02562		562	46 endonuclease subunit; Provisional	97.78
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.77
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.76
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.72
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	97.67
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.67
COG4372		499	Uncharacterized protein conserved in bacteria with	97.67
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	97.66
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.63
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	97.63
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.6
PRK04863		1486	mukB cell division protein MukB; Provisional	97.59
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.59
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.59
KOG0996		1293	consensus Structural maintenance of chromosome pro	97.59
PRK03918		880	chromosome segregation protein; Provisional	97.57
KOG0979		1072	consensus Structural maintenance of chromosome pro	97.55
PRK04863		1486	mukB cell division protein MukB; Provisional	97.55
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.54
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.51
KOG0996		1293	consensus Structural maintenance of chromosome pro	97.5
KOG0971		1243	consensus Microtubule-associated protein dynactin	97.5
PRK04778		569	septation ring formation regulator EzrA; Provision	97.49
PHA02562		562	46 endonuclease subunit; Provisional	97.49
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.49
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.48
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.46
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	97.45
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.45
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.44
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.4
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.4
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.39
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.38
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.37
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.36
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.35
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	97.31
PRK01156		895	chromosome segregation protein; Provisional	97.31
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.29
PRK09039		343	hypothetical protein; Validated	97.29
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.27
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	97.26
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	97.26
COG4372		499	Uncharacterized protein conserved in bacteria with	97.23
KOG0964		1200	consensus Structural maintenance of chromosome pro	97.22
PF00038		312	Filament: Intermediate filament protein; InterPro:	97.22
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.21
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	97.19
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.18
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.18
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.18
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	97.18
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	97.17
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.16
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.14
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	97.13
PRK04778		569	septation ring formation regulator EzrA; Provision	97.12
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	97.12
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.11
PRK09039		343	hypothetical protein; Validated	97.1
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.07
COG5152		259	Uncharacterized conserved protein, contains RING a	97.07
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	97.07
KOG0964		1200	consensus Structural maintenance of chromosome pro	97.06
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.02
KOG4677		554	consensus Golgi integral membrane protein [Intrace	97.0
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.99
KOG0018		1141	consensus Structural maintenance of chromosome pro	96.95
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.93
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.92
PF00038		312	Filament: Intermediate filament protein; InterPro:	96.88
KOG0018		1141	consensus Structural maintenance of chromosome pro	96.88
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.88
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.87
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	96.85
PRK01156		895	chromosome segregation protein; Provisional	96.85
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	96.82
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	96.8
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.79
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	96.78
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	96.74
PRK11281		1113	hypothetical protein; Provisional	96.74
PTZ00121		2084	MAEBL; Provisional	96.71
PF14662		193	CCDC155: Coiled-coil region of CCDC155	96.65
PTZ00121		2084	MAEBL; Provisional	96.62
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.59
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	96.58
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	96.57
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	96.56
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.53
KOG0249		916	consensus LAR-interacting protein and related prot	96.46
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.35
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	96.35
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	96.34
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	96.28
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.27
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	96.25
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	96.19
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	96.17
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	96.16
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	96.15
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	96.15
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.14
KOG2660		331	consensus Locus-specific chromosome binding protei	96.05
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.03
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	96.03
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	96.03
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.02
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	95.99
KOG0825		1134	consensus PHD Zn-finger protein [General function	95.98
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	95.97
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	95.94
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	95.93
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	95.92
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.92
PRK10246		1047	exonuclease subunit SbcC; Provisional	95.9
PRK10246		1047	exonuclease subunit SbcC; Provisional	95.82
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	95.79
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	95.77
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	95.72
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	95.69
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	95.69
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.66
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	95.66
PLN03188		1320	kinesin-12 family protein; Provisional	95.61
PF13514		1111	AAA_27: AAA domain	95.61
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	95.58
KOG4807		593	consensus F-actin binding protein, regulates actin	95.56
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.56
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	95.54
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	95.51
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	95.48
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	95.46
PRK11281		1113	hypothetical protein; Provisional	95.44
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	95.39
KOG2991		330	consensus Splicing regulator [RNA processing and m	95.38
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	95.37
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	95.35
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	95.34
PRK10929		1109	putative mechanosensitive channel protein; Provisi	95.33
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	95.31
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	95.3
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	95.3
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	95.27
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	95.27
PRK10929		1109	putative mechanosensitive channel protein; Provisi	95.24
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.23
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	95.18
KOG0297		391	consensus TNF receptor-associated factor [Signal t	95.18
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	95.18
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	95.15
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	95.06
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.05
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	95.02
KOG4367		699	consensus Predicted Zn-finger protein [Function un	95.01
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	94.99
PRK10698		222	phage shock protein PspA; Provisional	94.98
COG5236		493	Uncharacterized conserved protein, contains RING Z	94.97
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	94.9
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.89
KOG4572		1424	consensus Predicted DNA-binding transcription fact	94.88
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	94.87
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	94.86
KOG4403		575	consensus Cell surface glycoprotein STIM, contains	94.8
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	94.76
PRK10698		222	phage shock protein PspA; Provisional	94.76
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.75
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	94.72
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	94.7
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.68
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	94.63
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	94.6
PF10186		302	Atg14: UV radiation resistance protein and autopha	94.59
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	94.58
KOG0249		916	consensus LAR-interacting protein and related prot	94.58
COG5185		622	HEC1 Protein involved in chromosome segregation, i	94.5
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	94.5
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	94.39
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	94.34
PRK00106		535	hypothetical protein; Provisional	94.3
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	94.23
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	94.15
KOG1001		674	consensus Helicase-like transcription factor HLTF/	93.93
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	93.9
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	93.89
COG5222		427	Uncharacterized conserved protein, contains RING Z	93.86
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	93.82
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	93.82
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	93.69
COG4717		984	Uncharacterized conserved protein [Function unknow	93.64
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	93.61
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	93.61
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	93.55
PF13514		1111	AAA_27: AAA domain	93.54
PRK12704		520	phosphodiesterase; Provisional	93.49
KOG1937		521	consensus Uncharacterized conserved protein [Funct	93.46
PF04641		260	Rtf2: Rtf2 RING-finger	93.46
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	93.43
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	93.41
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	93.35
PRK12704		520	phosphodiesterase; Provisional	93.34
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	93.32
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	93.27
PRK10869		553	recombination and repair protein; Provisional	93.27
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	93.23
COG2433		652	Uncharacterized conserved protein [Function unknow	93.22
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	93.16
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	93.05
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	93.03
KOG3039		303	consensus Uncharacterized conserved protein [Funct	93.03
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	93.01
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	92.99
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	92.95
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	92.92
KOG1103		561	consensus Predicted coiled-coil protein [Function	92.72
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	92.66
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	92.53
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	92.49
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	92.35
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	92.22
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	92.15
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	92.12
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	91.95
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	91.94
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	91.92
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	91.87
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	91.81
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	91.8
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	91.77
PLN03188		1320	kinesin-12 family protein; Provisional	91.76
KOG3002		299	consensus Zn finger protein [General function pred	91.75
PF05262		489	Borrelia_P83: Borrelia P83/100 protein; InterPro:	91.72
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	91.72
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	91.61
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	91.57
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	91.5
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	91.49
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	91.47
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	91.39
PRK00106		535	hypothetical protein; Provisional	91.38
PLN02939		977	transferase, transferring glycosyl groups	91.37
KOG2991		330	consensus Splicing regulator [RNA processing and m	91.27
PF14662		193	CCDC155: Coiled-coil region of CCDC155	91.2
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	91.19
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	91.14
KOG1937		521	consensus Uncharacterized conserved protein [Funct	91.12
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	90.95
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	90.95
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	90.91
PF06548		488	Kinesin-related: Kinesin-related; InterPro: IPR010	90.74
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	90.74
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	90.73
COG4477		570	EzrA Negative regulator of septation ring formatio	90.68
KOG0288		459	consensus WD40 repeat protein TipD [General functi	90.65
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	90.57
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	90.56
PF13166		712	AAA_13: AAA domain	90.46
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	90.33
PRK10361		475	DNA recombination protein RmuC; Provisional	90.3
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	90.04
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	89.76
KOG2751		447	consensus Beclin-like protein [Signal transduction	89.76
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	89.64
COG2433		652	Uncharacterized conserved protein [Function unknow	89.59
PRK10884		206	SH3 domain-containing protein; Provisional	89.58
PF14992		280	TMCO5: TMCO5 family	89.55
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	89.51
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	89.49
KOG2891		445	consensus Surface glycoprotein [General function p	89.42
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	89.35
KOG2113		394	consensus Predicted RNA binding protein, contains	89.32
KOG4722		672	consensus Zn-finger protein [General function pred	89.29
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	89.25
COG5175		480	MOT2 Transcriptional repressor [Transcription]	89.15
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	89.12
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	89.1
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	88.96
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	88.84
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	88.82
PF11570		136	E2R135: Coiled-coil receptor-binding R-domain of c	88.68
PF02845		42	CUE: CUE domain; InterPro: IPR003892 This domain m	88.31
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	88.23
smart00546		43	CUE Domain that may be involved in binding ubiquit	88.12
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	87.84
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	87.81
PF13863		126	DUF4200: Domain of unknown function (DUF4200)	87.71
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	87.67
KOG4364		811	consensus Chromatin assembly factor-I [Chromatin s	87.52
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	87.5
KOG4787		852	consensus Uncharacterized conserved protein [Funct	87.45
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	87.43
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	87.33
KOG2113		394	consensus Predicted RNA binding protein, contains	87.28
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	87.24
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	87.16
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	87.14
PRK10884		206	SH3 domain-containing protein; Provisional	87.11
smart00502		127	BBC B-Box C-terminal domain. Coiled coil region C-	86.93
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	86.75
PF15556		252	Zwint: ZW10 interactor	86.72
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	86.68
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	86.57
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	86.55
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	86.51
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	86.47
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	86.28
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	86.21
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	86.04
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	85.78
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	85.63
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	85.63
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	85.54
PF11180		192	DUF2968: Protein of unknown function (DUF2968); In	85.5
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	85.49
KOG2008		426	consensus BTK-associated SH3-domain binding protei	85.43
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	85.42
COG4717		984	Uncharacterized conserved protein [Function unknow	85.32
KOG1103		561	consensus Predicted coiled-coil protein [Function	85.19
PF11180		192	DUF2968: Protein of unknown function (DUF2968); In	85.08
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	84.91
PRK00409		782	recombination and DNA strand exchange inhibitor pr	84.89
cd00632		105	Prefoldin_beta Prefoldin beta; Prefoldin is a hexa	84.81
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	84.79
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	84.75
PRK10361		475	DNA recombination protein RmuC; Provisional	84.72
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	84.66
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	84.64
PRK10869		553	recombination and repair protein; Provisional	84.63
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	84.59
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	84.51
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	84.05
TIGR00998		334	8a0101 efflux pump membrane protein (multidrug res	83.81
PF05335		188	DUF745: Protein of unknown function (DUF745); Inte	83.59
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	83.58
KOG3799		169	consensus Rab3 effector RIM1 and related proteins,	83.51
PF09744		158	Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte	83.39
COG4477		570	EzrA Negative regulator of septation ring formatio	83.25
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	83.11
PF02841		297	GBP_C: Guanylate-binding protein, C-terminal domai	83.01
KOG4403		575	consensus Cell surface glycoprotein STIM, contains	82.91
KOG3842		429	consensus Adaptor protein Pellino [Signal transduc	82.81
PTZ00491		850	major vault protein; Provisional	82.74
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	82.71
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	82.61
PRK10476		346	multidrug resistance protein MdtN; Provisional	82.44
PF05103		131	DivIVA: DivIVA protein; InterPro: IPR007793 The Ba	82.39
TIGR00998		334	8a0101 efflux pump membrane protein (multidrug res	82.19
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	82.13
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	82.12
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	82.12
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	82.07
KOG2196		254	consensus Nuclear porin [Nuclear structure]	82.05
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	82.04
KOG3850		455	consensus Predicted membrane protein [Function unk	81.97
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	81.9
KOG2264		907	consensus Exostosin EXT1L [Signal transduction mec	81.89
KOG4445		368	consensus Uncharacterized conserved protein, conta	81.71
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	81.7
PTZ00266		1021	NIMA-related protein kinase; Provisional	81.42
KOG4807		593	consensus F-actin binding protein, regulates actin	81.27
PF06637		442	PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th	81.27
KOG4364		811	consensus Chromatin assembly factor-I [Chromatin s	81.23
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	81.2
PRK03598		331	putative efflux pump membrane fusion protein; Prov	80.99
PTZ00266		1021	NIMA-related protein kinase; Provisional	80.88
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	80.79
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	80.71
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	80.64
PF03915		424	AIP3: Actin interacting protein 3; InterPro: IPR02	80.55
CHL00019		184	atpF ATP synthase CF0 B subunit	80.08

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

Probab=99.96  E-value=5.1e-27  Score=279.14  Aligned_cols=188  Identities=12%  Similarity=0.125  Sum_probs=149.9

Q ss_pred             hhhccchhhcccccccccccCCCCCCCCCchhHHHHHHhhhcCccchhhhhhcCCCccccCCcccCCccccccccCCCCC
Q 002997          319 SLSSLGEHAQNMSLTLGSDERSGNGRKGRSKKELAILRQKSCHVPTEKSYRTYGKGAFRSGKLASMGGFVLEKRVRPASD  398 (859)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~r~~~~~~~~~k~~~~lG~kas~tnr~~sl~s~v~~K~g~~~s~  398 (859)
                      .|||-..    +--.+.+--..|.+.-|+-|--  +|         .+-.=.|||+||.||||+|||+||  |.|+.+|.
T Consensus        49 NFMCHsn----L~IeFg~~vNfI~G~NGSGKSA--Il---------tAl~lglG~rAs~tnRgsslK~lI--K~G~~~A~  111 (1074)
T KOG0250|consen   49 NFMCHSN----LLIEFGPRVNFIVGNNGSGKSA--IL---------TALTLGLGGRASATNRGSSLKDLI--KDGCSSAK  111 (1074)
T ss_pred             eeccccc----ceeccCCCceEeecCCCCcHHH--HH---------HHHHHhhccccccccchhhHHHHH--hCCCcceE
Confidence            4666543    2122333445666665555532  34         344446899999999999999999  99999999


Q ss_pred             ccccccCCCCCccc-------------------cccccc-cccCCCCcccccCCCCCCCCCCCCCCCCCCCCcCCCCCCc
Q 002997          399 LSAVHPKSGPSKIS-------------------ADTGAA-AASRDRGHCASTRTPLAHPVSDSPSSLPTKGTTLALPVPN  458 (859)
Q Consensus       399 ~~~v~ikn~~~~a~-------------------s~~~vk-~~~~~~~~~~~stk~~~~~~i~~~~~lq~~np~~~Lsqd~  458 (859)
                      |+ |+|+|+|.+||                   |.+-++ ++.|+    +||||+.|++.|+++|+|||+||+++||||.
T Consensus       112 Is-ItL~N~G~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~gr----vVStKk~dl~~vv~~f~I~veNP~~~lsQD~  186 (1074)
T KOG0250|consen  112 IS-ITLSNSGLDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGR----VVSTKKEDLDTVVDHFNIQVENPMFVLSQDA  186 (1074)
T ss_pred             EE-EEEecCCcccCChhhcCCeeEEEEeeccccchHHHHhhccCc----cccccHHHHHHHHHHhCcCCCCcchhhcHHH
Confidence            99 99999999999                   344444 78888    9999999999999999999999999999999


Q ss_pred             hhhhcccCCCCCCccccccCCCCCCCCcccccccc----------cc---cccccCCCCCchHHHHHhhcccHHHHHHHH
Q 002997          459 TELVASSSSKKNPDIKAVATTSPSPKLPEYYAGIP----------FD---ETLGRYIPQNGKDELILKLVPWVPELQNEL  525 (859)
Q Consensus       459 ar~fLss~~~~~~~~~~~~~~~~stp~~ky~~~i~----------yd---e~l~~~v~~D~k~e~i~~l~~~v~~L~~~~  525 (859)
                      ||+||.+                ++|..+|+||++          |-   +++      |...+.|..+.+.+..++++.
T Consensus       187 aR~FL~~----------------~~p~dkYklfmkaT~L~qi~~~~~~~~~~~------~~~~~~i~~~~e~i~~l~k~i  244 (1074)
T KOG0250|consen  187 ARSFLAN----------------SNPKDKYKLFMKATQLEQITESYSEIMESL------DHAKELIDLKEEEIKNLKKKI  244 (1074)
T ss_pred             HHHHHhc----------------CChHHHHHHHHHHhHHHHHHHHHHHHHHHH------HHHHHHHHHHHhhhHHHHHHH
Confidence            9999999                889999999999          33   777      888899999999999999999


Q ss_pred             hHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002997          526 NSWTEWANQKVMQAARRLSKDQAELKALRHEKQEVEQ  562 (859)
Q Consensus       526 ~e~~~wa~~k~~qaA~rL~ke~~eLk~LR~ekeelq~  562 (859)
                      ++            ++.+.+.+.+++.+.+..+.++.
T Consensus       245 ~e------------~~e~~~~~~~~e~~~~~l~~Lk~  269 (1074)
T KOG0250|consen  245 KE------------EEEKLDNLEQLEDLKENLEQLKA  269 (1074)
T ss_pred             HH------------HHHHHHHHHHHHHHHHHHHHHHH
Confidence            99            66666666666665555444443

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>KOG2891 consensus Surface glycoprotein [General function prediction only]	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>KOG4722 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species	Back alignment and domain information

>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF13863 DUF4200: Domain of unknown function (DUF4200)	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4787 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>smart00502 BBC B-Box C-terminal domain	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>PF15556 Zwint: ZW10 interactor	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms]	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A)	Back alignment and domain information

>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma	Back alignment and domain information

>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]	Back alignment and domain information

>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00491 major vault protein; Provisional	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK10476 multidrug resistance protein MdtN; Provisional	Back alignment and domain information

>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells []	Back alignment and domain information

>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A)	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>KOG2196 consensus Nuclear porin [Nuclear structure]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG3850 consensus Predicted membrane protein [Function unknown]	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals	Back alignment and domain information

>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>PRK03598 putative efflux pump membrane fusion protein; Provisional	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6	Back alignment and domain information

>CHL00019 atpF ATP synthase CF0 B subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		859
3t6p_A		345	Iap Antagonist-Induced Conformational Change In Cia		3e-06
3eb5_A		74	Structure Of The Ciap2 Ring Domain Length = 74		8e-06
4auq_B		62	Structure Of Birc7-Ubch5b-Ub Complex. Length = 62		1e-05

>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345

Back alignment and structure

Iteration: 1
 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
Query: 800 KRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQ 853
           + ER C VC+ +E SVVF+PC H V+CQ+C        +  CP CR  I+  ++
Sbjct: 293 QEERTCKVCMDKEVSVVFIPCGHLVVCQEC-----APSLRKCPICRGIIKGTVR 341

PyMOL of 3t6p

>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74

Back alignment and structure

>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		859
2ea5_A		68	Cell growth regulator with ring finger domain prot	1e-18
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	6e-16
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	9e-16
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	8e-14
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-12
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-07
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	9e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	5e-13
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	5e-13
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	1e-12
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-12
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-09
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	7e-05
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-10
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-08
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	3e-07
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	6e-05
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	3e-04
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	3e-08
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	6e-08
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-06
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	2e-06
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	3e-06
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	4e-06
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	2e-04
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	6e-06
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	8e-06
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	9e-06
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	9e-06
1qzv_F		154	Plant photosystem I: subunit PSAF; photosynthesis,	9e-06
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	2e-05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	2e-05
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	2e-05
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	4e-05
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	6e-05
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	7e-05
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	1e-04
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	1e-04
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	1e-04
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	2e-04
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	2e-04
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	2e-04
1z6u_A		150	NP95-like ring finger protein isoform B; structura	3e-04
2dq3_A		425	Seryl-tRNA synthetase; coiled-coil, homodimer, str	3e-04
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	4e-04
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	5e-04
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	5e-04
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	6e-04
2xs1_A		704	Programmed cell death 6-interacting protein; prote	6e-04
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	7e-04

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68	Back alignment and structure

 Score = 79.5 bits (196), Expect = 1e-18
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 788 GSSSGSSLMGGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSP 847
           GSS  S +    +  ++CVVC     + V LPC H  LC  C +         CP CR  
Sbjct: 1   GSSGSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKY-----FQQCPMCRQF 55

Query: 848 IQQRIQVR 855
           +Q+   + 
Sbjct: 56  VQESFALS 63

PyMOL of 2ea5

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Length = 425	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		859
2ea5_A		68	Cell growth regulator with ring finger domain prot	99.14
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	99.11
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	99.1
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	99.06
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.06
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	99.03
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.0
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.93
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.92
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.9
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.89
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.87
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.84
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.84
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.82
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.81
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.81
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.81
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.8
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.8
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.79
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.76
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.76
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.75
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.73
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.73
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.71
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.71
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.71
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.7
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.69
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.69
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.69
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.67
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.67
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.66
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.66
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.65
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.65
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.65
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.63
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.63
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.62
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.62
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.62
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.61
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.61
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.58
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.56
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.56
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.53
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.53
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.5
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.5
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.46
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.43
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.34
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.32
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.31
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	98.26
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	98.22
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.2
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	98.2
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.19
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.01
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	97.79
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.75
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	97.7
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	97.7
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.59
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.57
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.43
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	97.42
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.28
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	96.97
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.96
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	96.93
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	96.87
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	96.83
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	96.45
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.34
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.32
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	96.24
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	95.96
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	95.53
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	95.1
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	94.88
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	94.56
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	94.5
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	94.48
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	94.46
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	94.26
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	93.97
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	93.53
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	93.17
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	92.88
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	92.86
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	92.86
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	92.59
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	91.54
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	91.49
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	91.19
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	90.41
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	90.37
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	90.33
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	90.3
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	90.17
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	90.0
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	89.45
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	89.04
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	88.99
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	88.86
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	88.75
1otr_A		49	Protein CUE2; protein-protein complex, cell cycle;	88.74
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	88.53
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	88.37
3i00_A		120	HIP-I, huntingtin-interacting protein 1; transcrip	88.15
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	88.01
3s84_A		273	Apolipoprotein A-IV; four helix bundle, transport	87.72
3jsv_C		94	NF-kappa-B essential modulator; ubiquitin, coiled-	87.62
2xzr_A		114	Immunoglobulin-binding protein EIBD; cell adhesion	86.9
3mq7_A		121	Bone marrow stromal antigen 2; HIV, antiviral prot	86.76
2e7s_A		135	RAB guanine nucleotide exchange factor SEC2; coile	86.47
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	86.01
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	86.0
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	85.95
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	85.79
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	85.18
3mq7_A		121	Bone marrow stromal antigen 2; HIV, antiviral prot	84.79
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	84.54
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	84.51
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	84.24
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	83.87
1x79_B		112	RAB GTPase binding effector protein 1; rabaptin5,	83.65
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	82.6
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	82.5
3qh9_A		81	Liprin-beta-2; coiled-coil, dimerization, structur	81.86
1m1j_B		464	Fibrinogen beta chain; coiled coils, disulfide rin	81.58
2no2_A		107	HIP-I, huntingtin-interacting protein 1; clathrin	81.46
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	81.39
3jsv_C		94	NF-kappa-B essential modulator; ubiquitin, coiled-	81.29
3ghg_B		461	Fibrinogen beta chain; triple-stranded coiled coil	80.51
3k29_A		169	Putative uncharacterized protein; YSCO, type III s	80.5
3haj_A		486	Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR,	80.27
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	80.27

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

Probab=99.14  E-value=1.6e-11  Score=104.79  Aligned_cols=55  Identities=31%  Similarity=0.783  Sum_probs=49.3

Q ss_pred             CCccccccccccCcCcEEeCCCchhhhHHhHHHHhhcCCCCCCCccccccCceEEEecCC
Q 002997          800 KRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVRFAQP  859 (859)
Q Consensus       800 ~~~~~C~ICle~~~~~VllpCgH~vfC~~Ci~~~~~~~~~~CP~CR~~i~~~i~i~~~~~  859 (859)
                      .....|+||++.+++++++||||.+||..|+..     ...||+||.+|..++++|...|
T Consensus        13 ~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~-----~~~CP~CR~~i~~~~~i~~~~s   67 (68)
T 2ea5_A           13 ENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKY-----FQQCPMCRQFVQESFALSGPSS   67 (68)
T ss_dssp             CCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHH-----CSSCTTTCCCCCCEECCCSSCC
T ss_pred             CCCCCCCCcCcCCCCEEEECCCChhhhHHHHhc-----CCCCCCCCcchhceEEeecCCC
Confidence            346789999999999999999999999999983     4799999999999999987654

PyMOL of 2ea5

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A	Back alignment and structure

>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens}	Back alignment and structure

>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B	Back alignment and structure

>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd}	Back alignment and structure

>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A	Back alignment and structure

>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens}	Back alignment and structure

>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B*	Back alignment and structure

>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens}	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A	Back alignment and structure

>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B	Back alignment and structure

>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H*	Back alignment and structure

>3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis}	Back alignment and structure

>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens}	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		859
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-09
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	7e-08
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	1e-07
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	5e-07
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	3e-06
d1f5na1		300	a.114.1.1 (A:284-583) Interferon-induced guanylate	3e-06
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	4e-06
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-05
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	7e-05
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	8e-04
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	0.001
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	0.001

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.5 bits (128), Expect = 1e-09
 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 805 CVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQRIQVR 855
           C +C   +K V   PC H ++C  C    ++     CP CR  I+    + 
Sbjct: 26  CKICAENDKDVKIEPCGH-LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75

PyMOL of d1fbva4

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		859
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.96
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.95
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.75
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.69
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.69
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.67
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.67
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.65
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.62
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.54
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.49
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.43
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.39
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.24
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.11
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.88
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	97.28
d1f5na1		300	Interferon-induced guanylate-binding protein 1 (GB	93.91
d1f5na1		300	Interferon-induced guanylate-binding protein 1 (GB	92.87
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	82.86

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.96  E-value=9.4e-11  Score=102.54  Aligned_cols=53  Identities=26%  Similarity=0.458  Sum_probs=46.5

Q ss_pred             ccCCCccccccccccCcCcEEeCCCchhhhHHhHHHHhhcCCCCCCCccccccC
Q 002997          797 GGLKRERECVVCLAEEKSVVFLPCAHQVLCQKCNELHEKQGMNDCPSCRSPIQQ  850 (859)
Q Consensus       797 e~l~~~~~C~ICle~~~~~VllpCgH~vfC~~Ci~~~~~~~~~~CP~CR~~i~~  850 (859)
                      +++.....|+||++.+.++++++|||. ||..|+..|+..+.+.||.||.++..
T Consensus        18 ~d~~~~l~C~IC~~~~~~pv~~~CgH~-FC~~Ci~~~~~~~~~~CP~Cr~p~~~   70 (86)
T d1rmda2          18 AHFVKSISCQICEHILADPVETSCKHL-FCRICILRCLKVMGSYCPSCRYPCFP   70 (86)
T ss_dssp             HHHHHHTBCTTTCSBCSSEEECTTSCE-EEHHHHHHHHHHTCSBCTTTCCBCCG
T ss_pred             hhhccCcCCccCCcchhcceecCCCCh-hhHHHHHHHHhhCCCcCcccCCCCCh
Confidence            344566789999999999999999999 99999999987676789999999853

PyMOL of d1rmda2

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure