Citrus Sinensis ID: 003053

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850--
MRSFSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDLKSAHSQSSSGRYSRGWKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKNDPVLPASKWALEDDESDDEQKRSSRGLGLSYSSSGSENAGDGPSKADDVDFTIDASIPVQPDSGMNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYGLADPNEDVSGNKRRDRRDEILDSRKRHRSQSQSESPPPRKSSIRDRERESDLDRDRERHRDRDRAHDFESERGRERREKSGSRERDDHDRDRGRDRDRDRRRRVK
ccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEEcccccHHHccccccEEEEEEccHHHHHHHHHHccccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHccccHHHHHHHHHccccccccccHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHcc
ccEEEEEEEHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHccccccEEEEEEccccHHHHccccccEEEEEccHHHHHHHHHHccccEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccHEEEEcccccccEEEEEEEEEEccccccccccccccEEcccccEccccccccccccccccccccccHccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccHHccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHccccccccHHHHHHHHcccccHcccccccccccccccccccccccccccHHHccccHcccccccccccccHHHHHHccccccccccccccccHHccccccccccccccccHccccccccccHHccccccccccccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccc
MRSFSFFLFSFFNAWHVIYVSnidgpvflwlnlfqpssrfdelpddfdpsgklpgsfddgdpqttnlyvgnlspqvdenfllrtfgrfgpiasvkimwprtEEERRRQRNcgfvafmnradgqaakdemQGVVVYEYELKigwgksvalpsqalpapppgqmairskegatvilsgpsgppvttvpsqnselvltpnvpdimvippedrhlrHVIDTLALYVLDGGCAFEQAImergrgnplFNFLFELGSKEHTYYVWRLYsfaqgdtlqrwrtepfimitgsgrwippalptskspehekesgttyaagrsrraepertltdsqRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTEsltlketpiptKVARLMLVSDVlhnssapvknasaYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFlrsgnsgvtpfhsicgdapeidkknnsedtcdlsktnQDTALAMGKGAAIKELMNLPLSELERRcrhnglslvgGREMMVARLLSLEDAEKqrgyeldddlksahsqsssgrysrgwketnMEAEsmglsgwngyeedeklsqavgsvplgtmlttpqpeikaftkkekndpvlpaskwaleddesddeqkrssrglglsysssgsenagdgpskaddvdftidasipvqpdsgmneEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLeseygladpnedvsgnkrrdrRDEILDsrkrhrsqsqsesppprkssirdreresdldrdrerhrdrdrahdfesergrerreksgsrerddhdrdrgrdrdrdrrrrvk
MRSFSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRtfgrfgpiasvkimwprtEEERRRQRNCGFVAFMNradgqaakdemQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPAlptskspehekesgttyaagrsrraepertltdsqrdeFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTesltlketpiPTKVARLMLVSDVLHnssapvknasayrTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIKELMNLPLSELERRCRHNglslvggrEMMVARLLSLEDAEKQRGYeldddlksahsqsssgrysrgwketNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKaftkkekndpvlpaskwaleddesddeqkrssrglglsysssgsenagdgpskADDVDFTIDAsipvqpdsgmneeqrQKLRRLEVSLIEYREsleergiksseeiEKKVAIHRkrleseygladpnedvsgnkrrdrrdeildsrkrhrsqsqsesppprkssirdreresdldrdrerhrdrdrahdfesergrerreksgsrerddhdrdrgrdrdrdrrrrvk
MRsfsfflfsffNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSValpsqalpapppGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDLKSAHSQSSSGRYSRGWKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKNDPVLPASKWALEDDESDDEQKrssrglglsysssgsENAGDGPSKADDVDFTIDASIPVQPDSGMNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYGLADPNEDVSGNKRRDRRDEILDSRKRHrsqsqsesppprkssirdreresdldrdrerhrdrdrAHDFesergrerreksgsrerddhdrdrgrdrdrdrrrrVK
***FSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQ******************************NLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTE****RQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSV********************************************LVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIP*****************************************************QIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICG*******************************AAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLL*****************************************************************************************************************************************************************************************************************************************************************************************************************
**SFSFFLFSFFNAWHVIYVSNID****************************************TNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPR******RQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVA****************************************************IMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYS***************************************************************RDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITG**T**ALKERVLKVLQVWSDWFLFSDAYVNGLRATFLR***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MRSFSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPALP*********************************RDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGY*********************WKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKNDPVLPASKWAL*********************************KADDVDFTIDASIPVQPDSGMNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYGLADPNEDVSGNKRRDRRDEIL************************************************************************************
*RSFSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDF**********D*GDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAI**************************ELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPALPT***************************LTDSQRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGN*****************************KTNQDTALAMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAE***************************************************************************************************************************************************EQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYG*********************************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSFSFFLFSFFNAWHVIYVSNIDGPVFLWLNLFQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQxxxxxxxxxxxxxxxxxxxxxMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDLKSAHSQSSSGRYSRGWKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKNDPVLPASKWALEDDESDDEQKRSSRGLGLSYSSSGSENAGDGPSKADDVDFTIDASIPVQPDSGMxxxxxxxxxxxxxxxxxxxxxLEERGIKSSEEIEKKVAIHRKRLESEYGLADPNEDVSGNKRRDRRDEILDSRKRHRSQSQSESPPPRKSSIRDRERESDLDRDRERHRDRDRAHDFESERGRERREKSGSRERDDHDRDRGRDRDRDRRRRVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query852 2.2.26 [Sep-21-2011]
Q6NV831029 U2 snRNP-associated SURP yes no 0.473 0.391 0.419 1e-94
O150421029 U2 snRNP-associated SURP yes no 0.473 0.391 0.419 1e-94
Q5R7X21028 U2 snRNP-associated SURP yes no 0.473 0.392 0.419 1e-94
P32831672 Negative growth regulator yes no 0.098 0.125 0.344 1e-08
Q9LEB3428 Polyadenylate-binding pro N/A no 0.123 0.245 0.321 6e-08
F4I3B3445 Polyadenylate-binding pro no no 0.097 0.186 0.326 5e-07
Q10200466 Uncharacterized protein C yes no 0.226 0.414 0.235 7e-07
Q9SX80434 Polyadenylate-binding pro no no 0.106 0.209 0.323 1e-06
Q9SX79432 Polyadenylate-binding pro no no 0.106 0.210 0.313 1e-06
Q15415496 RNA-binding motif protein no no 0.154 0.266 0.277 1e-06
>sp|Q6NV83|SR140_MOUSE U2 snRNP-associated SURP motif-containing protein OS=Mus musculus GN=U2surp PE=1 SV=3 Back     alignment and function desciption
 Score =  348 bits (893), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 177/422 (41%), Positives = 250/422 (59%), Gaps = 19/422 (4%)

Query: 54  PGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGF 113
           PGS D GDP TTNLY+GN++PQ++E  L + FGRFGP+ASVKIMWPRT+EER R+RNCGF
Sbjct: 263 PGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGF 322

Query: 114 VAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSV-----------ALPSQALPAPPPGQM 162
           VAFMNR D + A   + G ++  +E+K+GWGK+V           ++    LP PPP  +
Sbjct: 323 VAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLP-PPPSGL 381

Query: 163 AIRSKEGATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIPPEDRHLRHVIDTLALYV 222
              ++      L  P+  P+   P    +   T +   + V+ P +R+L  +I  +  +V
Sbjct: 382 PFNAQPRER--LKNPNA-PMLPPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFV 438

Query: 223 LDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMIT 282
           +  G  FE  IM R   NP+F FLFE  +  H YY W+LYS  QGD+  +WRTE F M  
Sbjct: 439 VREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFK 498

Query: 283 GSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQRDEFEDMLRALTLERS 342
               W PP L        E++    +    S++      L + QRD+ E++LR LT  ++
Sbjct: 499 NGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKG----ALKEEQRDKLEEILRGLTPRKN 554

Query: 343 QIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASA 402
            I +AM F L+NA+AA EIV+ +TESL++ +TP+P K+ARL LVSDVL+NSSA V NAS 
Sbjct: 555 DIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASY 614

Query: 403 YRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRAT 462
           YR  FE  L  I    N  YR+I G + +E  K+RV+   + W DW ++ + ++  L+  
Sbjct: 615 YRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNI 674

Query: 463 FL 464
           FL
Sbjct: 675 FL 676

Mus musculus (taxid: 10090)
>sp|O15042|SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens GN=U2SURP PE=1 SV=2 Back     alignment and function description
>sp|Q5R7X2|SR140_PONAB U2 snRNP-associated SURP motif-containing protein OS=Pongo abelii GN=U2SURP PE=2 SV=1 Back     alignment and function description
>sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 Back     alignment and function description
>sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 Back     alignment and function description
>sp|Q10200|YBY1_SCHPO Uncharacterized protein C11C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC11C11.01 PE=1 SV=2 Back     alignment and function description
>sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 Back     alignment and function description
>sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 Back     alignment and function description
>sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query852
224089390 988 predicted protein [Populus trichocarpa] 0.933 0.804 0.836 0.0
296082150941 unnamed protein product [Vitis vinifera] 0.886 0.802 0.821 0.0
224141985 955 predicted protein [Populus trichocarpa] 0.888 0.792 0.837 0.0
356526679 972 PREDICTED: U2 snRNP-associated SURP moti 0.919 0.805 0.800 0.0
147857263 1384 hypothetical protein VITISV_025939 [Viti 0.852 0.524 0.832 0.0
356560817 971 PREDICTED: U2 snRNP-associated SURP moti 0.924 0.811 0.805 0.0
255548712 979 RNA binding protein, putative [Ricinus c 0.931 0.811 0.815 0.0
449441850 961 PREDICTED: U2 snRNP-associated SURP moti 0.893 0.791 0.826 0.0
357517325 1139 U2-associated protein SR140 [Medicago tr 0.849 0.635 0.797 0.0
297812707948 RNA recognition motif-containing protein 0.926 0.832 0.735 0.0
>gi|224089390|ref|XP_002308714.1| predicted protein [Populus trichocarpa] gi|222854690|gb|EEE92237.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1291 bits (3341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/813 (83%), Positives = 734/813 (90%), Gaps = 18/813 (2%)

Query: 36  PSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVK 95
           PSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVK
Sbjct: 158 PSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVK 217

Query: 96  IMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALP 155
           IMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGV+VYEYELKIGWGKSVALPSQALP
Sbjct: 218 IMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVIVYEYELKIGWGKSVALPSQALP 277

Query: 156 APPPGQMAIRSKE----------GATVILSGPSGPPVTTVPSQNSELVLTPNVPDIMVIP 205
           APPPGQMAIRSKE          GATVILSGPSGPPVT+VP+QNSELVLTPNVPDIMV P
Sbjct: 278 APPPGQMAIRSKEVCYGFLPKPIGATVILSGPSGPPVTSVPNQNSELVLTPNVPDIMVAP 337

Query: 206 PEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFA 265
           PED HLRHVIDT+ALYVLDGGCAFEQAIM+RGRGNPLFNFLFELGSKEHTYYVWRLYSFA
Sbjct: 338 PEDDHLRHVIDTMALYVLDGGCAFEQAIMQRGRGNPLFNFLFELGSKEHTYYVWRLYSFA 397

Query: 266 QGDTLQRWRTEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDS 325
           QGDTLQRWRTEPFIMITGSGRW+PP+LPT+KSPEHEKESG+T+AAGRSRR +PERTLTD 
Sbjct: 398 QGDTLQRWRTEPFIMITGSGRWVPPSLPTAKSPEHEKESGSTHAAGRSRRVDPERTLTDP 457

Query: 326 QRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLML 385
           QRDEFEDMLRALTLERSQIK+AMGFALDN DAAGE+VEVLTESLTLKETPIPTKVARLML
Sbjct: 458 QRDEFEDMLRALTLERSQIKDAMGFALDNVDAAGEVVEVLTESLTLKETPIPTKVARLML 517

Query: 386 VSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVW 445
           VSD+LHNSSAPVKNASAYRTKFEA LPDIMESFNDLYRSITGRITAEALKERVLKVLQVW
Sbjct: 518 VSDILHNSSAPVKNASAYRTKFEAALPDIMESFNDLYRSITGRITAEALKERVLKVLQVW 577

Query: 446 SDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTAL 505
           SDWFLFSDAYVNGLRATFLRS NSGV PFHS+CGDAPEI+KKN++EDT D  KTNQD AL
Sbjct: 578 SDWFLFSDAYVNGLRATFLRSSNSGVIPFHSMCGDAPEIEKKNSTEDTVDGGKTNQDAAL 637

Query: 506 AMGKGAAIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDLK 565
           AMGKGAA KELM+LPL+ELERRCRHNGLSLVGGRE MVARLL+LE+AEKQRGYELD DLK
Sbjct: 638 AMGKGAATKELMDLPLAELERRCRHNGLSLVGGRETMVARLLNLEEAEKQRGYELDGDLK 697

Query: 566 SAHSQSSSGRYSRGWKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIK 625
            A S SSS RYS   +E N++   +GL+GWN Y ED+  SQ   SV L + L  PQPE+K
Sbjct: 698 IAQSNSSSSRYSSVHREVNVDPGPVGLTGWNIYGEDDTPSQNKRSVSLVSTLPIPQPELK 757

Query: 626 AFTKKEKNDPVLPASKWALEDDESDDEQKRSSRGLGLSYSSSGSENAGDGPSKADDVDFT 685
           AF KKEKNDPVLPASKWA +DDESDDEQKRS R LGLSYSSSGSENAGDG  K D+++F 
Sbjct: 758 AFAKKEKNDPVLPASKWARDDDESDDEQKRSVRDLGLSYSSSGSENAGDGQGKEDEMEFA 817

Query: 686 IDASIPVQPDSGMNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESE 745
            DASIP QP+SGMNEEQRQKLRRLEV+LIEYRESLEE+G+K+SEE E+KVA+HRKRLESE
Sbjct: 818 TDASIPTQPESGMNEEQRQKLRRLEVALIEYRESLEEQGMKNSEEFERKVAVHRKRLESE 877

Query: 746 YGLADPNEDVSGNK-----RRDRRDEILD-SRKRHRSQSQSESPPPRKSSIRDRERESDL 799
           YGL+  NEDV+GNK     RRDRRD+  + SRKRHRS+S+SES P RK S+RDRERE D 
Sbjct: 878 YGLSSSNEDVTGNKRISSERRDRRDDNHESSRKRHRSESRSES-PQRKLSLRDREREHDS 936

Query: 800 DRDRERHRDRDRAHDFESE-RGRERREKSGSRE 831
           D+DRERHR+RDR ++ ESE R R+ REKSGS+E
Sbjct: 937 DKDRERHRERDRGNNLESERRDRDYREKSGSKE 969

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296082150|emb|CBI21155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141985|ref|XP_002324341.1| predicted protein [Populus trichocarpa] gi|222865775|gb|EEF02906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356526679|ref|XP_003531944.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Glycine max] Back     alignment and taxonomy information
>gi|147857263|emb|CAN79213.1| hypothetical protein VITISV_025939 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356560817|ref|XP_003548683.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Glycine max] Back     alignment and taxonomy information
>gi|255548712|ref|XP_002515412.1| RNA binding protein, putative [Ricinus communis] gi|223545356|gb|EEF46861.1| RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449441850|ref|XP_004138695.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Cucumis sativus] gi|449493301|ref|XP_004159248.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357517325|ref|XP_003628951.1| U2-associated protein SR140 [Medicago truncatula] gi|355522973|gb|AET03427.1| U2-associated protein SR140 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297812707|ref|XP_002874237.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297320074|gb|EFH50496.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query852
TAIR|locus:2179295946 RRC1 "reduced red-light respon 0.708 0.638 0.777 2.7e-297
TAIR|locus:2183775947 AT5G10800 [Arabidopsis thalian 0.707 0.636 0.749 1.6e-244
UNIPROTKB|E1C0P9985 U2SURP "Uncharacterized protei 0.476 0.412 0.415 8.8e-93
UNIPROTKB|F1MHP11035 U2SURP "Uncharacterized protei 0.476 0.392 0.415 1.3e-90
UNIPROTKB|E2R1V31028 U2SURP "Uncharacterized protei 0.476 0.394 0.415 2.7e-90
UNIPROTKB|O150421029 U2SURP "U2 snRNP-associated SU 0.476 0.394 0.415 2.7e-90
UNIPROTKB|F1SKE61029 U2SURP "Uncharacterized protei 0.476 0.394 0.415 2.7e-90
RGD|1307882985 U2surp "U2 snRNP-associated SU 0.476 0.412 0.415 2.7e-90
MGI|MGI:19152081029 U2surp "U2 snRNP-associated SU 0.476 0.394 0.415 4.4e-90
UNIPROTKB|E7ET151028 U2SURP "U2 snRNP-associated SU 0.476 0.394 0.410 3.9e-89
TAIR|locus:2179295 RRC1 "reduced red-light responses in cry1cry2 background 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2471 (874.9 bits), Expect = 2.7e-297, Sum P(2) = 2.7e-297
 Identities = 482/620 (77%), Positives = 532/620 (85%)

Query:    36 PSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVK 95
             PSSRFDELPDDFDPSG+ PGSFDDGDPQTTNLYVGNLSP+VDENFLLRTFGRFGPIASVK
Sbjct:   151 PSSRFDELPDDFDPSGR-PGSFDDGDPQTTNLYVGNLSPKVDENFLLRTFGRFGPIASVK 209

Query:    96 IMWPRTEEERRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVXXXXXXXX 155
             IMWPRT+EE+RRQRNCGFV+FMNRADGQAAKDEMQG++VYEYELKIGWGK+V        
Sbjct:   210 IMWPRTDEEKRRQRNCGFVSFMNRADGQAAKDEMQGIIVYEYELKIGWGKAVSLPSQALP 269

Query:   156 XXXXGQMAIRSKEGATVILSGPSGPPV-TTVPSQNSELVLTPNVPDIMVIPPEDRHLRHV 214
                 G MAIRSKEG  ++ SG +GPP+ T+VP+QNSELVLTPNVPDI V+ PED HLRHV
Sbjct:   270 APPPGHMAIRSKEGCNLVFSGQTGPPIITSVPNQNSELVLTPNVPDITVVTPEDEHLRHV 329

Query:   215 IDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWR 274
             IDTLALYVLDG CAFEQAIMERGRGNPLF F+FELGSKEHTYYVWRLYSFAQGDTLQRWR
Sbjct:   330 IDTLALYVLDGECAFEQAIMERGRGNPLFKFMFELGSKEHTYYVWRLYSFAQGDTLQRWR 389

Query:   275 TEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQRDEFEDML 334
             TEP+IMITGSGRWIPP LP +++ EHEKES +TYAAGR+RRAE ERTLTD QRDEFEDML
Sbjct:   390 TEPYIMITGSGRWIPPPLPVTRTQEHEKESASTYAAGRTRRAEVERTLTDPQRDEFEDML 449

Query:   335 RALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSS 394
             RALTLERSQIKEAMGFALDNADAAGE+VEVLTESLTLKET IPTKVARLMLVSD+LHNSS
Sbjct:   450 RALTLERSQIKEAMGFALDNADAAGEVVEVLTESLTLKETSIPTKVARLMLVSDILHNSS 509

Query:   395 APVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDA 454
             A VKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVW+DWFLFSDA
Sbjct:   510 ARVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWADWFLFSDA 569

Query:   455 YVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDTCDLSKTNQDTALAMGKGAAIK 514
             Y+ GLR+TFLRSG SGVT FHSICGDAPEI+ K+ +++  D+ K N D ALA+GKGAA +
Sbjct:   570 YIYGLRSTFLRSGVSGVTSFHSICGDAPEIENKSYADNMSDIGKINPDAALAIGKGAARQ 629

Query:   515 ELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDLKSAHSQSSSG 574
             ELMNLP++ELERRCRHNGLSLVGGR MMV RLLSLED EKQRGYE  D++   H Q+ S 
Sbjct:   630 ELMNLPIAELERRCRHNGLSLVGGRVMMVTRLLSLEDTEKQRGYEAVDEIPK-HPQNHST 688

Query:   575 RYSRGWKETNMEAESMGLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKND 634
                  W+E   E E +     N Y E E + + V    L T +  PQPE+KAF  KEKN+
Sbjct:   689 -----WEEVKSEREHIK----NSYAEVE-MKEPVN---LPTTIPIPQPELKAFVGKEKNE 735

Query:   635 PVLPASKWALEDDESDDEQK 654
              +LPASKWA +DDE+DDEQK
Sbjct:   736 LILPASKWARDDDEADDEQK 755
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
TAIR|locus:2183775 AT5G10800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0P9 U2SURP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHP1 U2SURP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1V3 U2SURP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O15042 U2SURP "U2 snRNP-associated SURP motif-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKE6 U2SURP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307882 U2surp "U2 snRNP-associated SURP domain containing" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915208 U2surp "U2 snRNP-associated SURP domain containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET15 U2SURP "U2 snRNP-associated SURP motif-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VI1900
hypothetical protein (988 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query852
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-52
smart00582124 smart00582, RPR, domain present in proteins, which 2e-18
pfam0180554 pfam01805, Surp, Surp module 3e-16
smart0064854 smart00648, SWAP, Suppressor-of-White-APricot spli 4e-16
smart0036073 smart00360, RRM, RNA recognition motif 2e-15
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-13
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-12
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-11
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-11
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 6e-11
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 8e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-10
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 1e-10
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-10
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 7e-10
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 2e-09
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-09
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-09
pfam0831246 pfam08312, cwf21, cwf21 domain 8e-09
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-08
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-08
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 4e-08
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-08
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 5e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-08
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 5e-08
PRK12678 672 PRK12678, PRK12678, transcription termination fact 7e-08
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 2e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-07
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 2e-07
cd1252074 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA 2e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 6e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 6e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 7e-07
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 7e-07
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 7e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-06
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-06
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-06
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 2e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 3e-06
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 3e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 4e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-06
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 7e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 7e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 9e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 1e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-05
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 3e-05
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-05
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 3e-05
cd03562114 cd03562, CID, CID (CTD-Interacting Domain) domain 4e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 4e-05
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 4e-05
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 5e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-05
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 5e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 6e-05
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 7e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 7e-05
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-04
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 1e-04
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-04
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 1e-04
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 1e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-04
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-04
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 3e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-04
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-04
cd1246181 cd12461, RRM_SCAF4, RNA recognition motif found in 4e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 5e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 5e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 5e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 8e-04
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 8e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 9e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.001
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.001
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 0.001
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.001
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.001
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 0.001
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.002
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.002
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.002
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.002
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 0.003
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.003
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.003
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.004
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.004
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.004
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information 
 Score =  177 bits (451), Expect = 1e-52
 Identities = 62/84 (73%), Positives = 70/84 (83%)

Query: 64  TTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQ 123
           TTNLYVGNL+P+V E  L + FGRFGP+ASVKIMWPRTEEERRR RNCGFVAFMNRAD +
Sbjct: 1   TTNLYVGNLNPKVTEEVLCQEFGRFGPLASVKIMWPRTEEERRRNRNCGFVAFMNRADAE 60

Query: 124 AAKDEMQGVVVYEYELKIGWGKSV 147
            A DE+ G  V  YELK+GWGK+V
Sbjct: 61  RALDELDGKDVMGYELKLGWGKAV 84

This subgroup corresponds to the RRM of SR140 (also termed U2 snRNP-associated SURP motif-containing protein orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which is a putative splicing factor mainly found in higher eukaryotes. Although it is initially identified as one of the 17S U2 snRNP-associated proteins, the molecular and physiological function of SR140 remains unclear. SR140 contains an N-terminal RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), a SWAP/SURP domain that is found in a number of pre-mRNA splicing factors in the middle region, and a C-terminal arginine/serine-rich domain (RS domain). Length = 84
>gnl|CDD|214731 smart00582, RPR, domain present in proteins, which are involved in regulation of nuclear pre-mRNA Back     alignment and domain information
>gnl|CDD|216714 pfam01805, Surp, Surp module Back     alignment and domain information
>gnl|CDD|197818 smart00648, SWAP, Suppressor-of-White-APricot splicing regulator Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|203903 pfam08312, cwf21, cwf21 domain Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240964 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|239621 cd03562, CID, CID (CTD-Interacting Domain) domain family; CID is present in several RNA-processing factors such as Pcf11 and Nrd1 Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and CTD-associated factor 4 (SCAF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 852
KOG0151877 consensus Predicted splicing regulator, contains R 100.0
smart00582121 RPR domain present in proteins, which are involved 99.87
KOG4368 757 consensus Predicted RNA binding protein, contains 99.8
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.76
KOG2669325 consensus Regulator of nuclear mRNA [RNA processin 99.74
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.7
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.68
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.67
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.6
cd03562114 CID CID (CTD-Interacting Domain) domain family; CI 99.58
PF0180555 Surp: Surp module; InterPro: IPR000061 SWAP is der 99.55
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.54
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.53
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.49
smart0064854 SWAP Suppressor-of-White-APricot splicing regulato 99.48
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.47
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.42
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.4
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.4
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.39
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.39
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.38
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.38
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.38
KOG0122270 consensus Translation initiation factor 3, subunit 99.36
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.35
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.33
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.33
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.32
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.32
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.3
PF0481864 CTD_bind: RNA polymerase II-binding domain.; Inter 99.29
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.28
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.27
PLN03120260 nucleic acid binding protein; Provisional 99.26
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.26
PLN03213759 repressor of silencing 3; Provisional 99.24
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.24
KOG4207256 consensus Predicted splicing factor, SR protein su 99.24
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.23
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.23
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.21
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.19
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.19
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.18
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.18
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.18
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.17
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.14
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.1
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.1
smart0036272 RRM_2 RNA recognition motif. 99.09
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.06
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.06
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.06
PLN03121243 nucleic acid binding protein; Provisional 99.06
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.05
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 99.05
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.04
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.04
smart0036071 RRM RNA recognition motif. 99.01
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.0
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.99
PF12243139 CTK3: CTD kinase subunit gamma CTK3 98.98
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 98.97
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.95
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.94
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.94
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.93
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.89
KOG1847878 consensus mRNA splicing factor [RNA processing and 98.88
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.85
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.83
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.82
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.82
smart0036170 RRM_1 RNA recognition motif. 98.81
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.79
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.78
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.71
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.66
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.55
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.54
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.53
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.53
KOG0226290 consensus RNA-binding proteins [General function p 98.46
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.42
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.34
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.33
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.29
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.26
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.2
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.14
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.07
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.97
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.94
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.93
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.92
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 97.88
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.87
KOG4660549 consensus Protein Mei2, essential for commitment t 97.81
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.59
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.57
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.44
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.39
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.35
KOG0112975 consensus Large RNA-binding protein (RRM superfami 97.1
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.09
KOG4210285 consensus Nuclear localization sequence binding pr 97.06
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 96.97
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 96.94
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.6
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.59
KOG4368757 consensus Predicted RNA binding protein, contains 96.58
KOG1855484 consensus Predicted RNA-binding protein [General f 96.56
KOG0112975 consensus Large RNA-binding protein (RRM superfami 96.29
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 96.2
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 96.2
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 96.08
KOG0151877 consensus Predicted splicing regulator, contains R 96.07
COG0724306 RNA-binding proteins (RRM domain) [General functio 95.93
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.59
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 95.45
KOG2314698 consensus Translation initiation factor 3, subunit 95.4
KOG0129520 consensus Predicted RNA-binding protein (RRM super 95.28
KOG3152278 consensus TBP-binding protein, activator of basal 95.24
KOG1548382 consensus Transcription elongation factor TAT-SF1 95.23
PF0203735 SAP: SAP domain; InterPro: IPR003034 The SAP (afte 95.21
KOG0796319 consensus Spliceosome subunit [RNA processing and 95.13
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.12
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 95.08
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.86
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 94.6
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 94.51
smart0051335 SAP Putative DNA-binding (bihelical) motif predict 94.5
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 94.36
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 94.2
KOG2888453 consensus Putative RNA binding protein [General fu 93.48
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.43
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 93.42
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.04
KOG1996378 consensus mRNA splicing factor [RNA processing and 92.57
KOG1847878 consensus mRNA splicing factor [RNA processing and 92.44
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 92.39
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 92.37
KOG2068327 consensus MOT2 transcription factor [Transcription 91.89
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 91.38
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 91.34
KOG45741007 consensus RNA-binding protein (contains RRM and Pu 90.44
KOG4246 1194 consensus Predicted DNA-binding protein, contains 88.59
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 88.32
KOG0835367 consensus Cyclin L [General function prediction on 87.63
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 87.61
KOG2135526 consensus Proteins containing the RNA recognition 87.57
KOG4246 1194 consensus Predicted DNA-binding protein, contains 87.48
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 85.56
KOG0796319 consensus Spliceosome subunit [RNA processing and 85.37
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 83.17
KOG2548 653 consensus SWAP mRNA splicing regulator [RNA proces 83.14
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 82.75
KOG0835367 consensus Cyclin L [General function prediction on 82.57
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 81.93
smart0036170 RRM_1 RNA recognition motif. 80.59
KOG2071579 consensus mRNA cleavage and polyadenylation factor 80.38
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-115  Score=973.01  Aligned_cols=647  Identities=53%  Similarity=0.819  Sum_probs=581.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcceEEEcCCCCCCCHHHHHHHhccCCCeeEEEEeccCCccccCCcccEEE
Q 003053           34 FQPSSRFDELPDDFDPSGKLPGSFDDGDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEERRRQRNCGF  113 (852)
Q Consensus        34 ~~~~~r~~~~p~~~~~~~~~~~~~~~~~~~~~tLfVgnLp~~vte~~L~~~F~~fG~I~~vki~~pr~d~~tg~~rg~gF  113 (852)
                      +..++++..+|..+.+++. ++++++++|.+||||||||++.|+|+.|...|+.||+|.+|+|||||++.+..+.+.|||
T Consensus       145 ~~~s~r~~~~p~~~~~s~~-~gsfDdgDP~TTNlyv~Nlnpsv~E~~ll~tfGrfgPlasvKimwpRtEeEk~r~r~cgf  223 (877)
T KOG0151|consen  145 SAVSSRFDPLPSRFDPSGR-PGSFDDGDPQTTNLYVGNLNPSVDENFLLRTFGRFGPLASVKIMWPRTEEEKRRERNCGF  223 (877)
T ss_pred             cchhhccCCCccccCCCCC-CCcCCCCCCcccceeeecCCccccHHHHHHHhcccCcccceeeecccchhhhccccccce
Confidence            3456788899999888874 899999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCHHHHHHHHHHhCCceecCeEEEEeeccCCCCCCCCCCCCCCCCccccccCCCcccCCCCCCCCCCCCCCCCcccc
Q 003053          114 VAFMNRADGQAAKDEMQGVVVYEYELKIGWGKSVALPSQALPAPPPGQMAIRSKEGATVILSGPSGPPVTTVPSQNSELV  193 (852)
Q Consensus       114 V~F~~~~~A~~Ai~~lnG~~l~G~~l~V~~ak~~~~p~~~~~~~pp~~~~~~~~~~~~~~~~gp~~pp~~~~~~~~s~~~  193 (852)
                      |.|+++.+|++|+..|||..+.++.|+++|||++++|+.|.+.||++++...++.+....+.+-.+| +.++|+++++++
T Consensus       224 vafmnR~D~era~k~lqg~iv~~~e~K~gWgk~V~ip~~p~~ipp~~h~~~lp~p~s~Lpfnaqp~p-~~~~pn~N~e~~  302 (877)
T KOG0151|consen  224 VAFMNRADAERALKELQGIIVMEYEMKLGWGKAVPIPNIPIYIPPPLHEATLPPPPSNLPFNAQPGP-PKSLPNQNAELV  302 (877)
T ss_pred             eeehhhhhHHHHHHHhcceeeeeeeeeeccccccccCCccccCCChhhhccCCCCccCCcccCCCCc-cccCCCcccccc
Confidence            9999999999999999999999999999999999999999999999999999888888888776666 678999999999


Q ss_pred             cCCCCCcccccCCCCcchhhHHHHHHHHHHhCCHHHHHHHHHhcCCCCcccccccCCCCCccceeeeeeecccCCccccc
Q 003053          194 LTPNVPDIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRW  273 (852)
Q Consensus       194 ~~~~~~~v~v~~P~d~~~~~~Id~~a~~V~~~G~~FE~~~~~~~~~np~f~FL~d~~~~~h~YYrwkl~~~~~gd~~~~~  273 (852)
                      .+++++.+.|.+|+|..+..+||+||.||++.|+.||++||+++.+||+|+|||+.+++.|+||+||||+|+|||+++.|
T Consensus       303 ~~edv~~i~Vvip~d~~L~~vidrM~~fV~~egp~fea~im~re~~nplF~flfen~s~~htyyrwklySilQgdT~~ew  382 (877)
T KOG0151|consen  303 NTEDVEDILVVIPTDRHLLMVIDRMAEFVVREGPMFEAMIMERERGNPLFSFLFENGSPAHTYYRWKLYSILQGDTPQEW  382 (877)
T ss_pred             CcCCccceeEecCchHHHHHHHHHHHHHHhccCccHHHHHHHhhccChhHHHHHhcCchHHHHHHHHHHHHHcCCCHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCccccccCCccccCCCCCCCCCCchhhhcCcccccCcCcCcCCCCCCCHHHHHHHHHHHHhcccCHHHHHHHHHHHHh
Q 003053          274 RTEPFIMITGSGRWIPPALPTSKSPEHEKESGTTYAAGRSRRAEPERTLTDSQRDEFEDMLRALTLERSQIKEAMGFALD  353 (852)
Q Consensus       274 ~~~pf~m~~~~~~w~PP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~~l~~lL~~Lt~tr~sI~~~~~w~l~  353 (852)
                      +++||.||.+|++|+|||++......+..+..++|+.+.   ...++.|+..+|++|++||+.|||.|.+|+++|.|||+
T Consensus       383 r~e~frmfknggrwipppin~~~~~mp~ee~~~t~a~~e---~~~k~~Ltd~qRdklE~liR~LTpEk~sIg~aM~Fale  459 (877)
T KOG0151|consen  383 RTEPFRMFKNGGRWIPPPINNYRKGMPEEEERSTDAEGE---SEDKGALTDLQRDKLEDLIRGLTPEKSSIGDAMVFALE  459 (877)
T ss_pred             hhhhhhhcccCceecCCCCCcccccCchhhhcccccccc---hhhhcccchHHHHHHHHHHHhcCcccchHHHHHHHHHh
Confidence            999999999999999999998765555555555666543   34568899999999999999999999999999999999


Q ss_pred             ccccHHHHHHHHHHHhcccCCCccchhhhhhhhhhhhccCCCCCCCchhhHHHHHhhhHHHHHHHHHHHhhhccccchHH
Q 003053          354 NADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEA  433 (852)
Q Consensus       354 h~~~a~eiv~~l~~~l~~~~t~~~~KL~~LYLinDIL~ns~~~~~na~~yr~~fe~~Lp~if~~l~~~~~~~~~r~~a~~  433 (852)
                      |+++|.|||+||+++|+..+|++++||++|||||||||||.++|.|||.||..||..|+.||..|+.+|+++.|||+++.
T Consensus       460 nA~aa~EI~eci~eSlt~~~t~~~kKiarLyLvsDIL~N~sarv~nas~YR~~FEa~L~~Ifd~l~~~yr~I~gRIkaE~  539 (877)
T KOG0151|consen  460 NADAAGEIVECITESLTNKETPLPKKIARLYLVSDILHNSSARVANASAYRKSFEATLEDIFDDLNDLYRSIGGRIKAEA  539 (877)
T ss_pred             hhhhHHHHHHHHHHHHhccCCcchhHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhccchhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCccccHHHHHHHHHHhccCCCCCCcccccccCCCccccccCCCccc--cCccccchhHHHhhcchh
Q 003053          434 LKERVLKVLQVWSDWFLFSDAYVNGLRATFLRSGNSGVTPFHSICGDAPEIDKKNNSEDT--CDLSKTNQDTALAMGKGA  511 (852)
Q Consensus       434 ~k~kv~~vL~iWe~~~vf~~~~l~~L~~~f~~~~~~~~~~~~~~~~~~~~~e~~~~~~d~--~dg~~~~~~~~~~~~~~~  511 (852)
                      |+++|++||++|++|.|||.+||.+|+++||+ .+++..+++| |++.++++++....++  .||++++  +..      
T Consensus       540 fkqRV~kVirvWedW~ifpe~~l~~l~~~Flg-~~~~~~~~~s-e~~~~die~~~~a~~eedldgvple--~~~------  609 (877)
T KOG0151|consen  540 FKQRVMKVIRVWEDWAIFPEDFLIGLQNTFLG-LNNIVTEKES-EADAPDIENAPLAGNEEDLDGVPLE--DED------  609 (877)
T ss_pred             HHHHHHHHHHHHHHHHhCcHHHHHHHHHHHhc-CCCCcccccc-cccchhhccCcccCchhhccCCCch--hhh------
Confidence            99999999999999999999999999999999 4566788888 9999999999886544  4555543  221      


Q ss_pred             HHHHhhcCChHHHHHHHHHcCccccCChHHHHHHHHhhHHHhhhcccccchhh-hhcccCCCCCccccCccccccccccc
Q 003053          512 AIKELMNLPLSELERRCRHNGLSLVGGREMMVARLLSLEDAEKQRGYELDDDL-KSAHSQSSSGRYSRGWKETNMEAESM  590 (852)
Q Consensus       512 ~~~~~~~~~~~~l~~~c~~~gl~~~~~~~~~~~rl~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (852)
                      +-.+++..++++|+.+| ++++..-+++..+++++.+++.++.|..+|+.... +.+|+.+.     +-|..++...++.
T Consensus       610 agip~~n~pi~eld~~~-l~~dd~ldgipm~~e~~ss~s~~~~~sk~e~vd~~~~~~q~vst-----skwe~~~~~~~~~  683 (877)
T KOG0151|consen  610 AGIPLMNTPIDELDGRP-LNLDDDLDGIPMMVETKSSLSDPETPSKWEAVDESFKEGQAVST-----SKWEHVDDEFEPK  683 (877)
T ss_pred             cCCccccCchhhhcccc-ccccccccCceeeeeeccccCCCcccccccccCcccccccccch-----hhhhhcccccccc
Confidence            22367888999999999 88898889999999999999999999999998887 77777752     2377777777755


Q ss_pred             CCcCCCCccccccccCCCCCCCCCCCcCCCCchhhhhccccCCCCCCcccccccccCCChhHhhcccCCCccccCCCCCC
Q 003053          591 GLSGWNGYEEDEKLSQAVGSVPLGTMLTTPQPEIKAFTKKEKNDPVLPASKWALEDDESDDEQKRSSRGLGLSYSSSGSE  670 (852)
Q Consensus       591 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  670 (852)
                          .+.|...++--                            .||    ||   +||.+++++..       +|+ |+.
T Consensus       684 ----~~s~~~~e~ed----------------------------~~~----k~---~de~~~~~~~~-------~ss-~~~  716 (877)
T KOG0151|consen  684 ----KNSYDEVEEED----------------------------NPV----KY---DDEDRDKLRDI-------ESS-GSD  716 (877)
T ss_pred             ----cccccchhccc----------------------------ccc----cc---chhhhHHHhhh-------hhh-ccc
Confidence                67777776621                            123    88   77778887765       344 778


Q ss_pred             CCCCCCCCccccccccCCCcccCCCCCCcHHHHHHHHHhhhhhhhhhhhhhhhccCCcHHHHHHHHHHHhhhhhhcCCCC
Q 003053          671 NAGDGPSKADDVDFTIDASIPVQPDSGMNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYGLAD  750 (852)
Q Consensus       671 ~~~~~~~~~~~vef~~~~sv~~~~~~~~~~~~~~k~~~~~~ai~k~~~~~~e~~~k~~ee~~kr~~~~~~~~~~~~~~~~  750 (852)
                      +.|  ..+.+........||.++....++...++++++...|.++.+++.++++.++.++++.++.-.+++++..++.+.
T Consensus       717 ~~d--~l~sg~~~lk~~~sv~~qpe~~~d~~l~q~~r~~~~a~~e~~e~~~e~~~k~s~~~~rk~e~~~~r~e~~~g~S~  794 (877)
T KOG0151|consen  717 NQD--ELESGERDLKPGSSVREQPENERDRLLRQDVRVEAIALIEYREADEEQGMKRSEDKERKVEIERKRKERKRGHSG  794 (877)
T ss_pred             ccc--ccCCCCccCCCCCccccChhhHHHHHHHHHHHHHHHHhhhhhhhhhhhhccchhhhhhhcchhHHHHHhhhcccC
Confidence            877  467888888888999999999999999999999999999999999999999999999999988888887777664

>smart00582 RPR domain present in proteins, which are involved in regulation of nuclear pre-mRNA Back     alignment and domain information
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2669 consensus Regulator of nuclear mRNA [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>cd03562 CID CID (CTD-Interacting Domain) domain family; CID is present in several RNA-processing factors such as Pcf11 and Nrd1 Back     alignment and domain information
>PF01805 Surp: Surp module; InterPro: IPR000061 SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00648 SWAP Suppressor-of-White-APricot splicing regulator Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04818 CTD_bind: RNA polymerase II-binding domain Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF12243 CTK3: CTD kinase subunit gamma CTK3 Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1847 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF02037 SAP: SAP domain; InterPro: IPR003034 The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA binding domain found in diverse nuclear proteins involved in chromosomal organisation [], including in apoptosis [] Back     alignment and domain information
>KOG0796 consensus Spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>smart00513 SAP Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2888 consensus Putative RNA binding protein [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1847 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0796 consensus Spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query852
2e62_A61 Solution Structure Of The Cwf21 Domain In Protein A 2e-13
1ug0_A88 Solution Structure Of Surp Domain In Bab30904 Lengt 2e-06
2cqi_A103 Solution Structure Of The Rna Binding Domain Of Nuc 5e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 6e-06
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 7e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 3e-05
1x4o_A78 Solution Structure Of Surp Domain In Splicing Facto 6e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 6e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 7e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 9e-04
>pdb|2E62|A Chain A, Solution Structure Of The Cwf21 Domain In Protein Aak25922 Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 48/52 (92%)
Query: 698 MNEEQRQKLRRLEVSLIEYRESLEERGIKSSEEIEKKVAIHRKRLESEYGLA 749
           M+EEQRQK RR+EV+LIEYRE+LEE+G+K+ EEIE+KV I+RKRLE +YGL+
Sbjct: 10  MDEEQRQKRRRIEVALIEYRETLEEQGMKNPEEIERKVEINRKRLEVDYGLS 61
>pdb|1UG0|A Chain A, Solution Structure Of Surp Domain In Bab30904 Length = 88 Back     alignment and structure
>pdb|2CQI|A Chain A, Solution Structure Of The Rna Binding Domain Of Nucleolysin Tiar Length = 103 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1X4O|A Chain A, Solution Structure Of Surp Domain In Splicing Factor 4 Length = 78 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query852
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-26
2km4_A142 Regulator of TY1 transposition protein 103; CTD-in 3e-26
1ug0_A88 Splicing factor 4; SURP domain, structural genomic 6e-26
4flb_A132 Regulation of nuclear PRE-mRNA domain-containing; 3e-24
4fld_A135 Regulation of nuclear PRE-mRNA domain-containing 1 4e-23
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-23
1x4o_A78 Splicing factor 4; structural genomics, NPPSFA, na 7e-23
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-22
2e62_A61 Protein AT5G25060; CWF21 domain, structural genomi 9e-21
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-20
2e60_A101 SFRS8 protein, splicing factor, arginine/serine-ri 8e-20
2e5z_A90 SFRS8 protein, splicing factor, arginine/serine-ri 1e-19
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-19
2dt6_A64 Splicing factor 3 subunit 1; structure genomics, S 3e-18
1x5p_A97 Negative elongation factor E; structure genomics, 4e-18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-18
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 9e-18
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-17
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-15
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-14
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-14
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-16
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-15
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-15
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-15
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 6e-14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-15
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-11
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-15
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-15
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-15
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-15
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-15
2div_A99 TRNA selenocysteine associated protein; structural 8e-15
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-14
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-14
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-14
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-14
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-14
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-09
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-14
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-13
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-13
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-13
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-08
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-11
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-13
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-13
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-11
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-13
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-11
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-12
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-12
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-11
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-12
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-12
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-12
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-12
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-10
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 7e-12
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 9e-12
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 9e-12
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-10
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-11
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 6e-11
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 7e-11
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 8e-11
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 9e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 9e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-10
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-10
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-10
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 3e-10
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-10
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 8e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 8e-10
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 9e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-06
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-06
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-09
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 8e-09
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-08
3clj_A157 Protein NRD1; CTD-interacting domain, nucleus, pho 4e-08
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-08
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-08
3p5t_L90 Cleavage and polyadenylation specificity factor S; 7e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 8e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 9e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-07
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 8e-07
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 9e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-06
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 9e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-05
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-05
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 4e-05
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 6e-05
2dt7_B85 Splicing factor 3 subunit 1; structure genomics, S 7e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 8e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 6e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-04
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-04
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 7e-04
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
 Score =  103 bits (259), Expect = 1e-26
 Identities = 22/102 (21%), Positives = 33/102 (32%), Gaps = 13/102 (12%)

Query: 49  PSGKLPGSFDD----GDPQTTNLYVGNLSPQVDENFLLRTFGRFGPIASVKIMWPRTEEE 104
           P    P + D       P+ T  Y+GN+     E  L+  F  FG I   K         
Sbjct: 8   PPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHY------- 60

Query: 105 RRRQRNCGFVAFMNRADGQAAKDEMQGVVVYEYELKIGWGKS 146
              ++ C F+ +            +         L+ GWGK 
Sbjct: 61  --PEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 100
>2km4_A Regulator of TY1 transposition protein 103; CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein; NMR {Saccharomyces cerevisiae} PDB: 2l0i_A* Length = 142 Back     alignment and structure
>1ug0_A Splicing factor 4; SURP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: a.217.1.1 Length = 88 Back     alignment and structure
>4flb_A Regulation of nuclear PRE-mRNA domain-containing; structural genomics consortium, SGC, protein binding; 1.80A {Homo sapiens} Length = 132 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4o_A Splicing factor 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.217.1.1 Length = 78 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2e62_A Protein AT5G25060; CWF21 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Arabidopsis thaliana} Length = 61 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2e60_A SFRS8 protein, splicing factor, arginine/serine-rich 8; SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2e5z_A SFRS8 protein, splicing factor, arginine/serine-rich 8; SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2dt6_A Splicing factor 3 subunit 1; structure genomics, SF3A120, SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.217.1.1 Length = 64 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Length = 144 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3clj_A Protein NRD1; CTD-interacting domain, nucleus, phosphoprotein, RNA polymer binding protein, RNA binding protein; 2.10A {Saccharomyces cerevisiae} Length = 157 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dt7_B Splicing factor 3 subunit 1; structure genomics, SF3A120, SF3A60, SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.217.1.1 Length = 85 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query852
2km4_A142 Regulator of TY1 transposition protein 103; CTD-in 99.93
4fu3_A135 Regulation of nuclear PRE-mRNA domain-containing 1 99.91
4flb_A132 Regulation of nuclear PRE-mRNA domain-containing; 99.91
1x4o_A78 Splicing factor 4; structural genomics, NPPSFA, na 99.83
1ug0_A88 Splicing factor 4; SURP domain, structural genomic 99.8
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.75
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 99.74
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.73
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.72
2e5z_A90 SFRS8 protein, splicing factor, arginine/serine-ri 99.72
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.71
2e60_A101 SFRS8 protein, splicing factor, arginine/serine-ri 99.7
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.7
2dt6_A64 Splicing factor 3 subunit 1; structure genomics, S 99.68
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.68
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.68
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.67
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.67
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.66
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.66
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.66
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.65
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.65
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.65
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.65
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.65
3d9j_A145 RNA-binding protein 16; SCAF8, RNA polymerase II C 99.65
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.64
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.64
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.64
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.64
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.64
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.64
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.64
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.64
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.64
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.64
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.63
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.63
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.63
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.63
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.63
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.63
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.63
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.63
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.63
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.62
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.62
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.62
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.62
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.62
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.62
2div_A99 TRNA selenocysteine associated protein; structural 99.62
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.62
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.62
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.62
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.62
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.62
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.61
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.61
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.61
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.61
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.61
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.61
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.61
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.61
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.61
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.61
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.61
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.61
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.61
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.6
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.6
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.6
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.6
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.6
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.6
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.6
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.59
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.59
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.59
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.59
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.59
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.59
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.59
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.59
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.58
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.58
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.58
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.58
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.58
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.58
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.58
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.58
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.58
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.58
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.58
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.58
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.58
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.58
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.57
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.57
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.57
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.57
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.57
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.57
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.57
2dis_A109 Unnamed protein product; structural genomics, RRM 99.57
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.57
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.56
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.56
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.56
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.56
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.56
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.56
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.56
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.55
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.55
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.55
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.55
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.55
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.55
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.55
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.55
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.55
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.55
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.54
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.54
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.54
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.54
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.54
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.54
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.53
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.53
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.53
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.52
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.52
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.52
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.52
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.52
1x5p_A97 Negative elongation factor E; structure genomics, 99.52
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.51
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.51
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.51
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.5
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.5
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.5
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.5
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.5
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.49
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.49
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.49
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.49
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.49
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.48
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.48
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.48
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.48
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.48
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.47
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.21
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.47
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.47
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.47
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.47
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.47
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.47
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.46
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.46
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.45
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.45
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.45
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.44
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.44
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.43
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.43
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.42
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.42
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.41
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.41
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.4
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.39
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.39
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.38
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.38
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.36
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.36
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.36
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.36
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.35
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.34
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.31
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.3
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.3
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.28
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.25
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.24
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.23
2dt7_B85 Splicing factor 3 subunit 1; structure genomics, S 99.23
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.23
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.23
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.18
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.17
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.16
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.14
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.1
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.08
3clj_A157 Protein NRD1; CTD-interacting domain, nucleus, pho 98.98
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.87
1x4p_A66 Putative splicing factor, arginine/serine-rich 14; 98.76
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.69
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.64
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.4
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.36
4dgw_B152 PRE-mRNA-splicing factor PRP21; zinc finger; 3.11A 98.15
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.81
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.61
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.48
2e62_A61 Protein AT5G25060; CWF21 domain, structural genomi 97.46
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 96.11
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.1
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 94.86
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 94.77
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 94.68
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.65
1h1j_S51 THO1 protein; SAP domain, DNA binding; NMR {Saccha 94.36
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.35
2kvu_A75 MKL/myocardin-like protein 1; SAP motif, DNA/RNA b 94.21
2do1_A55 Nuclear protein HCC-1; SAP domain, structural geno 92.36
1zrj_A50 E1B-55KDA-associated protein 5 isoform C; SAP doma 91.96
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 91.81
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 91.41
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 91.1
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 90.79
2i2y_A150 Fusion protein consists of immunoglobin G- binding 90.69
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 90.65
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 90.56
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 90.0
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 89.75
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 89.67
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 89.36
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 89.2
3p5t_L90 Cleavage and polyadenylation specificity factor S; 89.18
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 89.14
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 89.13
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 88.9
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 88.54
2dit_A112 HIV TAT specific factor 1 variant; structural geno 88.47
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 88.44
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 88.39
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 88.03
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 87.97
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 87.89
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 87.81
1x5p_A97 Negative elongation factor E; structure genomics, 87.64
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 87.6
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 87.34
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 87.31
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 87.23
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 87.16
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 87.11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 87.09
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 86.99
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 86.97
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 86.96
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 86.95
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 86.94
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 86.78
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 86.67
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 86.61
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 86.58
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 86.58
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 86.52
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 86.41
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 86.28
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 86.25
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 86.21
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 86.18
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 86.14
2rnn_A114 E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA bind 85.99
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 85.98
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 85.75
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 85.69
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 85.67
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 85.59
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 85.54
2kt5_A124 RNA and export factor-binding protein 2; chaperone 85.41
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 85.37
2cph_A107 RNA binding motif protein 19; RNA recognition moti 85.34
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 85.19
2cpj_A99 Non-POU domain-containing octamer-binding protein; 85.09
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 85.07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 85.03
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 84.99
2dis_A109 Unnamed protein product; structural genomics, RRM 84.98
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 84.95
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 84.93
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 84.83
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 84.77
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 84.58
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 84.58
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 84.54
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 84.5
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 84.29
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 84.11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 83.91
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 83.86
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 83.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 83.71
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 83.59
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 83.42
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 83.34
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 83.29
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 83.19
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 83.01
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 82.93
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 82.9
2div_A99 TRNA selenocysteine associated protein; structural 82.75
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 82.67
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 82.61
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 82.25
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 82.22
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 82.0
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 81.68
2cqd_A116 RNA-binding region containing protein 1; RNA recog 81.54
3n9u_C156 Cleavage and polyadenylation specificity factor S; 80.87
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 80.84
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 80.71
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 80.29
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 80.18
>2km4_A Regulator of TY1 transposition protein 103; CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein; NMR {Saccharomyces cerevisiae} PDB: 2l0i_A* Back     alignment and structure
Probab=99.93  E-value=7.6e-26  Score=219.49  Aligned_cols=130  Identities=17%  Similarity=0.295  Sum_probs=118.6

Q ss_pred             HHHHHHHHHhcccCHHHHHHHHHHHHhccccHHHHHHHHHHHhcccCCCccchhhhhhhhhhhhccCCCCCCCchhhHHH
Q 003053          327 RDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASAYRTK  406 (852)
Q Consensus       327 ~~~l~~lL~~Lt~tr~sI~~~~~w~l~h~~~a~eiv~~l~~~l~~~~t~~~~KL~~LYLinDIL~ns~~~~~na~~yr~~  406 (852)
                      .+.|..+|+.|+.|+++|+.||.|||+|..+|.+||++|.++|....++..+||++|||+|||||||.  +++++.|+.+
T Consensus         5 ~~~l~~kL~~L~~sq~sIq~~s~W~l~h~~~a~~iv~~~~~~l~~~~~~~~kKL~~lYL~NDVlqnsk--~k~~~~f~~~   82 (142)
T 2km4_A            5 SEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAK--GQKIIQFQDS   82 (142)
T ss_dssp             HHHHHHHHHTCCSCHHHHHHHHHHHHTCGGGHHHHHHHHHHHHTSSSSCHHHHHHHHHHHHHHHHHHG--GGTCCHHHHH
T ss_pred             HHHHHHHHHhccccHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHhcCCCccceehhhhhHHHHHHHHh--hcCchHHHHH
Confidence            47899999999999999999999999999999999999999998887788999999999999999997  6677899999


Q ss_pred             HHhhhHHHHHHHHHHHhhhccccchHHHHHHHHHHHHHhccCccccHHHHHHHHHHhccC
Q 003053          407 FEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWFLFSDAYVNGLRATFLRS  466 (852)
Q Consensus       407 fe~~Lp~if~~l~~~~~~~~~r~~a~~~k~kv~~vL~iWe~~~vf~~~~l~~L~~~f~~~  466 (852)
                      |+++||.+|.++.   ..     .+++.+++|.+||++|++|+||+.++|.+|++.|.+.
T Consensus        83 F~~~L~~~~~~~~---~~-----~~~~~~~kv~rvl~iWeer~vf~~~~i~~L~~~l~~~  134 (142)
T 2km4_A           83 FGKVAAEVLGRIN---QE-----FPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAA  134 (142)
T ss_dssp             HHHTHHHHHHHHH---HH-----SCHHHHHHHHHHHHHHHHHTCSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH---Hc-----CCHHHHHHHHHHHHHhhccCCcCHHHHHHHHHHHHhH
Confidence            9999999996653   32     2478899999999999999999999999999998653
>4fu3_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, domain swapping, transc; HET: MSE; 1.90A {Homo sapiens} PDB: 4fld_A* Back     alignment and structure
>4flb_A Regulation of nuclear PRE-mRNA domain-containing; structural genomics consortium, SGC, protein binding; 1.80A {Homo sapiens} Back     alignment and structure
>1x4o_A Splicing factor 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.217.1.1 Back     alignment and structure
>1ug0_A Splicing factor 4; SURP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: a.217.1.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2e5z_A SFRS8 protein, splicing factor, arginine/serine-rich 8; SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2e60_A SFRS8 protein, splicing factor, arginine/serine-rich 8; SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2dt6_A Splicing factor 3 subunit 1; structure genomics, SF3A120, SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.217.1.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3d9j_A RNA-binding protein 16; SCAF8, RNA polymerase II CTD interacting domain, arm repeats phospho-CTD, phosphoprotein, transcription; 1.60A {Homo sapiens} PDB: 3d9k_A* 3d9l_A* 3d9m_A* 3d9n_A* 3d9p_A* 3d9i_A 3d9o_A* 2diw_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2dt7_B Splicing factor 3 subunit 1; structure genomics, SF3A120, SF3A60, SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.217.1.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3clj_A Protein NRD1; CTD-interacting domain, nucleus, phosphoprotein, RNA polymer binding protein, RNA binding protein; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1x4p_A Putative splicing factor, arginine/serine-rich 14; SURP domain, SFRS14 protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.217.1.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4dgw_B PRE-mRNA-splicing factor PRP21; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2e62_A Protein AT5G25060; CWF21 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Arabidopsis thaliana} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h1j_S THO1 protein; SAP domain, DNA binding; NMR {Saccharomyces cerevisiae} SCOP: a.140.2.1 PDB: 2wqg_A Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2kvu_A MKL/myocardin-like protein 1; SAP motif, DNA/RNA binding, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Homo sapiens} PDB: 2kw9_A Back     alignment and structure
>2do1_A Nuclear protein HCC-1; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1 Back     alignment and structure
>1zrj_A E1B-55KDA-associated protein 5 isoform C; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rnn_A E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA binding, sumoylation, metal-binding, nucLeu phosphoprotein, UBL conjugation pathway; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 852
d1ug0a_88 a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus muscu 8e-20
d1x4oa165 a.217.1.1 (A:8-72) Splicing factor 4 {Mouse (Mus m 2e-19
d2dt6a163 a.217.1.1 (A:48-110) Splicing factor 3 subunit 1, 4e-17
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-14
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-14
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-13
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-12
d2dt7b184 a.217.1.1 (B:134-217) Splicing factor 3 subunit 1, 2e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-12
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 4e-12
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 8e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-10
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 6e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 7e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 8e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 4e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-08
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-08
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-08
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-08
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 9e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-07
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-07
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 6e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 7e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-06
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-06
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 5e-05
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-04
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 3e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 4e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 0.001
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 0.001
>d1ug0a_ a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: Surp module (SWAP domain)
superfamily: Surp module (SWAP domain)
family: Surp module (SWAP domain)
domain: Splicing factor 4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 82.6 bits (204), Expect = 8e-20
 Identities = 25/70 (35%), Positives = 36/70 (51%)

Query: 200 DIMVIPPEDRHLRHVIDTLALYVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVW 259
           +I V PPE    R VI+ LA +V +GG   E+  ME  + NP F FL +  S+E  YY  
Sbjct: 16  EIKVSPPEGAETRRVIEKLARFVAEGGPELEKVAMEDYKDNPAFTFLHDKNSREFLYYRR 75

Query: 260 RLYSFAQGDT 269
           ++    +   
Sbjct: 76  KVAEIRKSGP 85
>d1x4oa1 a.217.1.1 (A:8-72) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 65 Back     information, alignment and structure
>d2dt6a1 a.217.1.1 (A:48-110) Splicing factor 3 subunit 1, SF3A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2dt7b1 a.217.1.1 (B:134-217) Splicing factor 3 subunit 1, SF3A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query852
d1szaa_144 PCF11 protein {Baker's yeast (Saccharomyces cerevi 99.82
d1x4oa165 Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10 99.76
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1ug0a_88 Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10 99.73
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.71
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.71
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.71
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.71
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.71
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.7
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.7
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.69
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.69
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.68
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.67
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.66
d2dt6a163 Splicing factor 3 subunit 1, SF3A1 {Human (Homo sa 99.66
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.65
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.64
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.64
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.64
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.63
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.63
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.63
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.63
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.62
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.62
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.62
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.62
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.61
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.61
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.61
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.6
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.6
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.6
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.59
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.59
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.59
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.59
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.59
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.58
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.58
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.57
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.57
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.57
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.56
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.56
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.56
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.55
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.55
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.55
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.55
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.54
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.54
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.54
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.54
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.54
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.53
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.53
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.51
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.49
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.47
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.44
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.44
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.44
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.37
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.35
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.29
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.26
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.23
d2dt7b184 Splicing factor 3 subunit 1, SF3A1 {Human (Homo sa 99.21
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.06
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.04
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.03
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.91
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.96
d2do1a142 Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId 95.62
d1h1js_44 S/mar DNA-binding protein Tho1 {Baker's yeast (Sac 95.56
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.76
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 94.63
d1zrja137 Heterogeneous nuclear ribonucleoprotein U-like pro 93.75
d1jeqa151 DNA binding C-terminal domain of ku70 {Human (Homo 92.83
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 92.52
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 91.93
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 91.77
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 91.48
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 91.47
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 91.35
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 91.14
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 91.02
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 90.83
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 90.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 90.76
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 90.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 90.71
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 90.59
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.56
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 90.5
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.48
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 90.42
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 90.4
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.24
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 90.07
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.98
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 89.84
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 89.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 89.67
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 89.6
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.31
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 89.06
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 89.03
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 88.76
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 88.57
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 88.56
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 88.15
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 87.89
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 87.88
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 87.84
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 87.64
d1x4pa153 Arginine/serine-rich-splicing factor 14 {Human (Ho 87.62
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 87.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 86.99
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 86.93
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 86.62
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 86.01
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 85.76
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 85.71
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 85.63
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 84.87
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 84.5
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 83.51
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 83.29
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 82.41
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 82.06
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 81.68
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 80.77
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 80.19
>d1szaa_ a.118.9.4 (A:) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ENTH/VHS domain
family: RPR domain (SMART 00582 )
domain: PCF11 protein
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.82  E-value=2.3e-20  Score=179.13  Aligned_cols=128  Identities=16%  Similarity=0.298  Sum_probs=112.7

Q ss_pred             HHHHHHHHHHHHhcc-cCHHHHHHHHHHHHhccccHHHHHHHHHHHhcccCCCccchhhhhhhhhhhhccCCCCCCCchh
Q 003053          324 DSQRDEFEDMLRALT-LERSQIKEAMGFALDNADAAGEIVEVLTESLTLKETPIPTKVARLMLVSDVLHNSSAPVKNASA  402 (852)
Q Consensus       324 ~~~~~~l~~lL~~Lt-~tr~sI~~~~~w~l~h~~~a~eiv~~l~~~l~~~~t~~~~KL~~LYLinDIL~ns~~~~~na~~  402 (852)
                      +...++|+.+|+.|+ .++..|++++.||++|+.+|.+||++|.+++..  ++..+||++|||+|||||||.      ..
T Consensus         6 ~~~~~~f~~~L~~L~~ns~~~I~~Lt~~a~~~~~~a~~Iv~~i~~~i~~--~~~~~KL~~LYLiddI~~n~~------~~   77 (144)
T d1szaa_           6 EVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEK--CMPKQKLYAFYALDSICKNVG------SP   77 (144)
T ss_dssp             HHHHHHHHHHHTTCSSCCHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHH--SCHHHHHHHHHHHHHHHHHTC------TT
T ss_pred             HHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc--cCcccchhhhhhHHHHHHHhH------HH
Confidence            467789999999997 699999999999999999999999999999864  557899999999999999995      35


Q ss_pred             hHHHHHhhhHHHHHHHHHHHhhhccccchHHHHHHHHHHHHHhccCc-----cccHHHHHHHHHHhccCC
Q 003053          403 YRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWSDWF-----LFSDAYVNGLRATFLRSG  467 (852)
Q Consensus       403 yr~~fe~~Lp~if~~l~~~~~~~~~r~~a~~~k~kv~~vL~iWe~~~-----vf~~~~l~~L~~~f~~~~  467 (852)
                      |+..|++.||.+|.+.   |..     ..+++++||.+||++|++++     |||+++|.+|++.|....
T Consensus        78 y~~~f~~~l~~~f~~~---y~~-----~~~~~r~kl~rll~iW~~r~~~~~~vFp~~~l~~ie~~L~~a~  139 (144)
T d1szaa_          78 YTIYFSRNLFNLYKRT---YLL-----VDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKAS  139 (144)
T ss_dssp             HHHHHHTTHHHHHHHH---HTT-----SCHHHHHHHHHHHHHHSSGGGCSSCSSCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHH---HHc-----CCHHHHHHHHHHHHHHhccCCCCcCCCCHHHHHHHHHHHHHhH
Confidence            9999999999999654   443     34689999999999998855     999999999999876544
>d1x4oa1 a.217.1.1 (A:8-72) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug0a_ a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt6a1 a.217.1.1 (A:48-110) Splicing factor 3 subunit 1, SF3A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt7b1 a.217.1.1 (B:134-217) Splicing factor 3 subunit 1, SF3A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2do1a1 a.140.2.1 (A:5-46) Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4pa1 a.217.1.1 (A:8-60) Arginine/serine-rich-splicing factor 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure