Citrus Sinensis ID: 003070

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850
MREAGFSSTTIKNHIEDSSASSVFQCYTSSGGGVFSSPCSPSSSEAHHFINPNTFWQNHALFSSQKPASVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVGGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSISFAESAMKPHNSSNSVAKFRRQQSCSTIEFNFGNCTRKPQGVEPRLDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGDSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD
cccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHccccccHHHHHccEEEEcccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHcHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccEEEEEEEEccccccccccccHHHHHccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccEEEEEcc
ccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHcccccHHHcccEEEEEccHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEccHHHHHHHHHccccHHHHHccEEEEccccccccccccccccHHHcccccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHcHcccHHHHHHcccHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccccccccccccHHHcccccccccHHHHHHHHcccccccccHHcccccccccccHcccccccccccccccccccccccccEcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccHHcccccccHHHHHHHHcccccEEEEEccHHcccHHHHHHccccccccccccEEEEEEcccccccEEccccccccccHEEEEEEccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccEEEEEEcc
mreagfssttiknhiedssassVFQCytssgggvfsspcspssseahhfinpntfwqnhalfssqkpasvskeDIKLVFEVFLRkkrrntvivGDCLSITDALVFDfmgrvergdvpqelkqTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDsltsvgggaiiytgdlkwtvdqqesnnnnnfngeiascynpINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMkcqmrqpplEIQWALQAvsipsgglglslhsssvhesrltfsqnpsqvwetkpfaikeeedhklnccaecTSNYEEEAQLFKSgqkkllppwlqphsssnanqKDELVEMRRKWnrschslhqgrhtqsqfssnlynnqsltgkscsyastypwwpsqssifldsnsisfaesamkphnssnsvaKFRRQQscstiefnfgnctrkpqgveprldslksnegkeVKITLALgnselsdsaklQRSDLYKVLqenvpwqfdSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAEsvfgstdlLFHIDmrkrndgvsshsEMLMGTLKNYEKLVVLVEDIDLADPQFIKILAdgfetenfGKVIFVLTkgdssnyeerieNQDSVINMTLKVNernqnfdhKRKAEWEFAnktkspridekedatsvtidnvssgnkkdfsrqssfntldlnmkaddeddegeqkpgelspissdltrenitnpalsngfLDLIQNRFvfnrnssndgkiTGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCfgckndkvfanygfgdsclpkkiQIALLD
mreagfssttiknhiedssasSVFQCYTSSGGGVFSSPCSPSSSEAHHFINPNTFWQNHALFSSqkpasvskeDIKLVFEvflrkkrrntvivgdclsITDALVFDFMGRVERGDvpqelkqthvikFHFAPVTLRFMKKEEVEMNLTELKrkvdsltsvgGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESrltfsqnpsqvWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPpwlqphsssnanQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSISFAESAMKPHNSSNSVAKFRRQQSCSTIefnfgnctrkpqgveprldslksnegKEVKITLalgnselsdsaKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLtkgdssnyeERIENQDSVINMTLKVNernqnfdhkrkaewefanktkspridekedatsvtidnvssgnkkdfsrqssfntldlnmkaddeddegeqkpgelspissdltrENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFAnygfgdsclpkkiqialld
MREAGFSSTTIKNHIEDSSASSVFQCYTssgggvfsspcspsssEAHHFINPNTFWQNHALFSSQKPASVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVGGGAIIYTGDLKWTVDQQESnnnnnfnGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPsgglglslhsssVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSISFAESAMKPHNSSNSVAKFRRQQSCSTIEFNFGNCTRKPQGVEPRLDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGDSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVkiggkgggiEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD
***********************FQCY********************HFINPNTFWQNHALFS********KEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVGGGAIIYTGDLKWTV**************IASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLS*******************VWETKPFAIKEEEDHKLNCCAECTSNYE*****************************************************************LTGKSCSYASTYPWWPSQSSIFLD******************************TIEFNFGNC*****************************************SDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKR********EMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKG******************************************************************************************************************ALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIAL**
MREAGFSSTTIKNHI**********************************************************DIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVT*********EMNLTELKRKVDSLTSVGGGAIIYTGDLKWTVDQQ**************CYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIP*******************************************NCCAECTSNYEE**************************************************************************************************************************************************************************LYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHI**************MLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGD***********DSVINMTLK********************************************************TLDLNMKADDEDD************************ALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDK*****GFGDSCLPKKIQIALLD
*********TIKNHIEDSSASSVFQCYTSSG**************AHHFINPNTFWQNHALFS********KEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVGGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSISFAE*****************QQSCSTIEFNFGNCTRKPQGVEPRLDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGDSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSSFNTLDLNMKA*************LSPISSDLTRENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD
*******************************************************************ASVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVGGGAIIYTGDLKWTVDQQESNN********ASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQG*************************************************************************************************************SELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRN***SSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGDSSNYEERIENQDSVINMTLKVNERNQ*************************************************************************************NPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREAGFSSTTIKNHIEDSSASSVFQCYTSSGGGVFSSPCSPSSSEAHHFINPNTFWQNHALFSSQKPASVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKxxxxxxxxxxxxxxxxxxxxxGGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSISFAESAMKPHNSSNSVAKFRRQQSCSTIEFNFGNCTRKPQGVEPRLDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVIFVLTKGDSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query850 2.2.26 [Sep-21-2011]
Q5XCL7699 Probable ATP-dependent Cl N/A no 0.102 0.124 0.318 0.0009
>sp|Q5XCL7|CLPC_STRP6 Probable ATP-dependent Clp protease ATP-binding subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=clpC PE=1 SV=1 Back     alignment and function desciption
 Score = 46.6 bits (109), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 23/110 (20%)

Query: 512 FLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNY----- 566
           FL  G   +GK  LA  +A  +FGS D +  +DM + ND  +     L+GT   Y     
Sbjct: 448 FLFVGPTGVGKTELAKQLALDLFGSKDAIIRLDMSEYNDRTAVSK--LIGTTAGYVGYDD 505

Query: 567 ------EKL------VVLVEDIDLADPQFI----KILADGFETENFGKVI 600
                 E++      +VL+++I+ ADPQ I    ++L DG  T+  G  I
Sbjct: 506 NNNTLTERVRRNPYAIVLLDEIEKADPQIITLLLQVLDDGRLTDGQGNTI 555

Streptococcus pyogenes serotype M6 (taxid: 301450)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
147803027 1032 hypothetical protein VITISV_000145 [Viti 0.983 0.810 0.595 0.0
224090507896 predicted protein [Populus trichocarpa] 0.938 0.890 0.609 0.0
359485128 1045 PREDICTED: uncharacterized protein LOC10 0.982 0.799 0.588 0.0
224144311899 predicted protein [Populus trichocarpa] 0.944 0.893 0.605 0.0
255556741 1008 conserved hypothetical protein [Ricinus 0.958 0.808 0.570 0.0
297735465 974 unnamed protein product [Vitis vinifera] 0.915 0.798 0.559 0.0
356532692 1051 PREDICTED: uncharacterized protein LOC10 0.950 0.768 0.519 0.0
356564815 1010 PREDICTED: chaperone protein ClpB1-like 0.927 0.780 0.507 0.0
356550720 1008 PREDICTED: uncharacterized protein LOC10 0.937 0.790 0.507 0.0
357449635 1020 hypothetical protein MTR_2g038200 [Medic 0.944 0.787 0.479 0.0
>gi|147803027|emb|CAN66169.1| hypothetical protein VITISV_000145 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/897 (59%), Positives = 665/897 (74%), Gaps = 61/897 (6%)

Query: 1    MREAGFSSTTIKNHIEDSSASSVFQCYTSSGGGVFSSPCSPSSSEAHH-FINPNTFWQNH 59
            MREAGFSST +KN++EDSSASSVFQCY+SSGG VFSSPCSPS +E H   INP+TFWQ H
Sbjct: 150  MREAGFSSTAVKNNLEDSSASSVFQCYSSSGG-VFSSPCSPSPTETHRDIINPSTFWQTH 208

Query: 60   AL----------FSSQKPASVS--------KEDIKLVFEVFLRKKRRNTVIVGDCLSITD 101
             L          FS QK  S +        KED+KLV EV LRKKRRNTVIVGD +S T+
Sbjct: 209  ILAYSSEQNPLLFSPQKKLSSNTITDSTSVKEDLKLVLEVLLRKKRRNTVIVGDSVSTTE 268

Query: 102  ALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVG 161
             LV + MGR+ERG+VP+ELK  H +KF F+PVTLRFMK+EEVEMNL++LKRKVDSL S G
Sbjct: 269  GLVAELMGRIERGEVPEELKSAHFVKFQFSPVTLRFMKREEVEMNLSDLKRKVDSLASGG 328

Query: 162  GGAIIYTG-DLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVW 220
            GG  I    DLKWTV+   S+ +  F    AS YNPI+HLV+E+G+L+SD  + S+TRVW
Sbjct: 329  GGGAIIYAGDLKWTVEAAVSDRDGGFPSGEASAYNPIDHLVAEIGRLLSD-YTTSNTRVW 387

Query: 221  LMATASYQTYMKCQMRQPPLEIQWALQAVSIPSGGLGLSLHSSSVHESRLTFSQNPSQ-V 279
            LMATASYQTYM+CQM+QP LEIQWALQAVS+PSGGLGLSLH+SSVH+SR   SQN +  V
Sbjct: 388  LMATASYQTYMRCQMKQPSLEIQWALQAVSVPSGGLGLSLHASSVHDSR---SQNQAHHV 444

Query: 280  WETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNANQKDELV 339
             ETKPFA KEE D KL+CCAECT+NYE+E  LFKSGQ+KLLP WLQ H    A QKD+LV
Sbjct: 445  LETKPFAAKEEHD-KLSCCAECTANYEKEVGLFKSGQQKLLPSWLQAHGV-EARQKDDLV 502

Query: 340  EMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSI 399
            E+RRKWNR CHSLHQGR  Q+  SS++++NQ+L GKS SY S+YPWWP+Q+SIF D NSI
Sbjct: 503  ELRRKWNRLCHSLHQGRSNQNHLSSSMFSNQNLLGKSYSYTSSYPWWPNQNSIFPDLNSI 562

Query: 400  SFAESAMKPHNSSNSVAKFRRQQSCSTIEFNFGNCTRKPQGVEPRLDSLKSNEGKEVKIT 459
            SF  SA+KP+++S+ V +FRRQQSC  IEF+FGN   K Q VEP LD LK  EGK+VKIT
Sbjct: 563  SFTNSALKPNHASSLVPRFRRQQSCH-IEFSFGNVMHKQQSVEPSLDCLKKTEGKDVKIT 621

Query: 460  LALGNSELSDSAKL---------QRSDLYKVLQENVPWQFDSIHSIVEVLVECKSAKKAT 510
            LALG S  SDS KL         +  D+ K+L+ENVPWQ ++I  I E L++ KS+KK T
Sbjct: 622  LALGTSVYSDSGKLPELKGEKTIRLRDICKLLEENVPWQSEAISPIAEALIDSKSSKKET 681

Query: 511  WFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLV 570
            W LLQGND+IGKRRLA +IAESVFGS DL+F ++MRK ++GV+  SE+L   L+ ++KLV
Sbjct: 682  WLLLQGNDSIGKRRLAHAIAESVFGSADLVFRMNMRKLDNGVTPCSEILTEALRAHQKLV 741

Query: 571  VLVEDIDLADPQFIKILADGFET----------ENFGKVIFVLTKGDSSNYEERIENQDS 620
            V+VED+D A+PQF+K LADG ET           +FG+ IF+LT GDSS+Y+ER  N+ S
Sbjct: 742  VMVEDVDFAEPQFMKFLADGCETGEFRDSSKREGSFGQAIFILTTGDSSSYQERKGNKSS 801

Query: 621  VINMTLKVNER-----NQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKK- 674
            VI+M L++N         N DHKRKAEW+ +N+TKSPR DE+E +  ++++    GN K 
Sbjct: 802  VIHMKLQINLTIPTLGTPNMDHKRKAEWDLSNRTKSPRTDEEEGSCLISVE---PGNSKI 858

Query: 675  -DFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNR 733
             +F+RQ SFNTLDLN++A DEDDE + KP ELSPISSDLTRE  T+    +GFL+ I+NR
Sbjct: 859  LEFTRQLSFNTLDLNIRA-DEDDESKDKPRELSPISSDLTRETATDIQNPHGFLESIENR 917

Query: 734  FVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFE 793
            F F R +  D ++   FL+K+K SF+  +  +N V+FSVE+++LEEVL G   F NSLFE
Sbjct: 918  FTFKRKADQDREMREAFLSKIKGSFEVGYDSENTVSFSVEQKLLEEVLAGCDSFLNSLFE 977

Query: 794  KWLKEVFQTSLEAVKIGGKGGGIEIRLCFGCKNDKVFANYGFGDSCLPKKIQIALLD 850
            KWLKEVFQTS++ VKIGGK  G+E+RLC   K +K   + GF  S LPKKIQ++ +D
Sbjct: 978  KWLKEVFQTSVKTVKIGGK-EGMEVRLCLVGKGEKGLED-GFMGSSLPKKIQVSFMD 1032

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224090507|ref|XP_002309005.1| predicted protein [Populus trichocarpa] gi|222854981|gb|EEE92528.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485128|ref|XP_002263442.2| PREDICTED: uncharacterized protein LOC100247938 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224144311|ref|XP_002325256.1| predicted protein [Populus trichocarpa] gi|222866690|gb|EEF03821.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556741|ref|XP_002519404.1| conserved hypothetical protein [Ricinus communis] gi|223541471|gb|EEF43021.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297735465|emb|CBI17905.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532692|ref|XP_003534905.1| PREDICTED: uncharacterized protein LOC100785754 [Glycine max] Back     alignment and taxonomy information
>gi|356564815|ref|XP_003550643.1| PREDICTED: chaperone protein ClpB1-like [Glycine max] Back     alignment and taxonomy information
>gi|356550720|ref|XP_003543732.1| PREDICTED: uncharacterized protein LOC100814376 [Glycine max] Back     alignment and taxonomy information
>gi|357449635|ref|XP_003595094.1| hypothetical protein MTR_2g038200 [Medicago truncatula] gi|124359320|gb|ABD28470.2| ATP binding , related [Medicago truncatula] gi|355484142|gb|AES65345.1| hypothetical protein MTR_2g038200 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query850
TAIR|locus:21239441017 AT4G29920 [Arabidopsis thalian 0.889 0.743 0.385 4.2e-130
TAIR|locus:21755891028 AT5G57130 "AT5G57130" [Arabido 0.707 0.584 0.385 1.3e-105
TAIR|locus:2079904815 AT3G52490 [Arabidopsis thalian 0.658 0.687 0.266 8.5e-40
TAIR|locus:2172585990 AT5G57710 [Arabidopsis thalian 0.876 0.752 0.239 2.2e-26
TAIR|locus:2118806924 AT4G30350 "AT4G30350" [Arabido 0.187 0.172 0.239 2.4e-25
TAIR|locus:2007412979 AT1G07200 "AT1G07200" [Arabido 0.574 0.498 0.214 3.4e-08
GENEDB_PFALCIPARUM|PF11_0175906 PF11_0175 "heat shock protein 0.112 0.105 0.272 0.00042
UNIPROTKB|Q8IIJ8906 PF11_0175 "Heat shock protein 0.112 0.105 0.272 0.00042
TAIR|locus:2123944 AT4G29920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1231 (438.4 bits), Expect = 4.2e-130, Sum P(2) = 4.2e-130
 Identities = 323/838 (38%), Positives = 454/838 (54%)

Query:    47 HHFINPNTFWQ--NHALFSSQKPASVSKEDIKLVFEVFLRKK---RRNTVIVGDCLSITD 101
             HH    N F+       F+  +   V +ED   V EV L KK   +RNTVIVGD +S+T+
Sbjct:   228 HHSFEQNPFFHFPKGKTFTPDQAFPV-REDANPVIEVLLGKKNNKKRNTVIVGDSVSLTE 286

Query:   102 ALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVG 161
              +V   MGR+ERG+VP +LKQTH IKF F+ V L FMKKE++E  + ELKRK+DS TS G
Sbjct:   287 GVVAKLMGRIERGEVPDDLKQTHFIKFQFSQVGLNFMKKEDIEGQVRELKRKIDSFTSWG 346

Query:   162 G-GAIIYTGDLKWTVDQQESXXXXXXXGEIASCYNPINHLVSEVGKLVSDCNSASSTRVW 220
             G G I+  GDL W V    +          +S Y+  +HLV E+G+LV D ++  + +VW
Sbjct:   347 GKGVIVCLGDLDWAVWGGGNSAS-------SSNYSAADHLVEEIGRLVYDYSNTGA-KVW 398

Query:   221 LMATASYQTYMKCQMRQPPLEIQWALQAVSIPXXXXXXXXXXXXVHESRLTFSQNPSQVW 280
             L+ TASYQTYM+CQM+QPPL++ WALQAVSIP               +       P +V 
Sbjct:   399 LLGTASYQTYMRCQMKQPPLDVHWALQAVSIPSGGLSLTLHASSSEMASQVMEMKPFRVK 458

Query:   281 ETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHS-SSNANQKDELV 339
             E +  A +EEE+ KLN C EC  NYE+EA+ F S Q K+LPPWLQPH  ++N NQKDEL 
Sbjct:   459 EEEEGAREEEEEDKLNFCGECAFNYEKEAKAFISAQHKILPPWLQPHGDNNNINQKDELS 518

Query:   340 EMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIFLDSNSI 399
              +R+KWNR C +LH  + + + + +     QS        +S  P     SS+  +S + 
Sbjct:   519 GLRKKWNRFCQALHHKKPSMTAWRAE----QS--------SSVLPGSLMDSSLKQNSRAS 566

Query:   400 SFAESAMKPHNSSNSVAKF--RRQQSCS-TIEFNF-GNCTRKPQGVEPRLDSLKSNEGKE 455
             S + +  +  NS      F   RQ+    T E +  G  +   +GV+ ++     +    
Sbjct:   567 S-SVAKFRRQNSCTIEFSFGSNRQEGLKKTDELSLDGFKSNNDEGVKTKITLALGHS--- 622

Query:   456 VKITLALGNSELSDSAK-LQRSDLYKVLQENVPWQFDSIHSIVEVLVEC--KSAKKATWF 512
                     NSE  +  K ++ S L + L EN+PWQ D + SIVE + E   +S +K  W 
Sbjct:   623 -PFPSDSENSEEEEPEKAIKMSKLLEKLHENIPWQKDVLPSIVEAMEESVKRSKRKDAWM 681

Query:   513 LLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVVL 572
             L+ GND   KRRLA+++  S+FGS + +  I++R      S   E L   LK  E++V+L
Sbjct:   682 LVSGNDVTAKRRLAITLTTSLFGSHENMLKINLRTSK--ASEACEELKNALKKKEEVVIL 739

Query:   573 VEDIDLADPQFIKILADGFET---ENF-GK---VIFVLTKGDSSNYEERIENQDSVINMT 625
             +E +DLAD QF+ IL D FE    + F GK   +IF+LT+ D    +E +EN+  VI M 
Sbjct:   740 IERVDLADAQFMNILVDRFEAGDLDGFQGKKSQIIFLLTRED----DECVENEHFVIPMV 795

Query:   626 LKVNERNQNF-DHKRKAEWEFAN---KTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSS 681
             L  N+      ++KRK E++ A    K K+PRI+E +D ++V  D   S  KK+FSRQ  
Sbjct:   796 LNCNKSGSGLVNNKRKPEYDAAPTMIKKKNPRIEEDDDESNVACD--ISNIKKEFSRQLK 853

Query:   682 F--NTLDLNMKAD-DEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNRFVFNR 738
             F  N LDLN++ D DED+E E KP   + ISS               FLD IQNRF F  
Sbjct:   854 FESNALDLNLRVDADEDEEEEAKPA--TEISSGFEER----------FLDSIQNRFDFTV 901

Query:   739 NSSND-GKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGFFHNSLFEKWLK 797
              S  D  K     +    E    + +R+ +  F+V+  ++E+   G GFF N LFE+W+K
Sbjct:   902 LSDEDITKFFVTKIKDSCEEI--LGQREERFGFTVDAELIEKFYKGCGFFANGLFEEWVK 959

Query:   798 EVFQTSLEAVXXXXXXXXXEIRLCFG----CKNDKVFANY-GFGDSCLPKKIQIALLD 850
             EVFQ  L  V          I LC G        +V+    GF  +CLP +I ++ +D
Sbjct:   960 EVFQRGLVTVKNGGKEGISVINLCLGGIDMIDQGEVYEEEEGFMGTCLPNRIHVSFVD 1017
GO:0005737 "cytoplasm" evidence=ISM
GO:0019538 "protein metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2175589 AT5G57130 "AT5G57130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079904 AT3G52490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172585 AT5G57710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118806 AT4G30350 "AT4G30350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007412 AT1G07200 "AT1G07200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0175 PF11_0175 "heat shock protein 101, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IIJ8 PF11_0175 "Heat shock protein 101, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VI.1255.1
hypothetical protein (896 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 3e-05
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 47.7 bits (114), Expect = 3e-05
 Identities = 42/181 (23%), Positives = 69/181 (38%), Gaps = 45/181 (24%)

Query: 507 KKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHS-EMLMGTLKN 565
           +    FL  G   +GK  LA ++AE++FG    L  IDM   ++ +  HS   L+G    
Sbjct: 519 RPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDM---SEYMEKHSVSRLIGAPPG 575

Query: 566 Y----------EKL------VVLVEDIDLADPQFIKILADGFE----------TENFGKV 599
           Y          E +      V+L+++I+ A P    +L    +          T +F   
Sbjct: 576 YVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNT 635

Query: 600 IFVLTKGDSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSP----RID 655
           I ++T    SN         S   +     +   + +  ++A  E   K   P    RID
Sbjct: 636 IIIMT----SNAG-------SEEILRDADGDDFADKEALKEAVMEELKKHFRPEFLNRID 684

Query: 656 E 656
           E
Sbjct: 685 E 685

Length = 786

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 850
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.94
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.92
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.88
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.67
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.59
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.47
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.41
CHL00181287 cbbX CbbX; Provisional 99.33
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.29
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.22
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.22
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.21
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.18
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.1
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.04
PLN03025319 replication factor C subunit; Provisional 99.04
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.02
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.02
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.96
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.96
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.94
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.94
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.94
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.94
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.93
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.93
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.93
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.93
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.92
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.89
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.89
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 98.89
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 98.88
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.87
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.87
PHA02544316 44 clamp loader, small subunit; Provisional 98.87
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.86
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.86
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.84
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.84
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.83
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.82
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.82
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.81
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.81
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.81
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.8
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.8
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.8
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.8
PRK13342413 recombination factor protein RarA; Reviewed 98.78
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.77
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.77
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.76
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.75
PF00004132 AAA: ATPase family associated with various cellula 98.75
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.73
PRK13341 725 recombination factor protein RarA/unknown domain f 98.73
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.71
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.71
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.71
PRK13531498 regulatory ATPase RavA; Provisional 98.71
PRK06893229 DNA replication initiation factor; Validated 98.71
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.7
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.69
PRK11608326 pspF phage shock protein operon transcriptional ac 98.69
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.68
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.67
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.67
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.67
PRK12402337 replication factor C small subunit 2; Reviewed 98.65
PRK07940394 DNA polymerase III subunit delta'; Validated 98.64
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.63
COG0714329 MoxR-like ATPases [General function prediction onl 98.63
PRK04195482 replication factor C large subunit; Provisional 98.63
PRK08084235 DNA replication initiation factor; Provisional 98.6
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.6
PRK07471365 DNA polymerase III subunit delta'; Validated 98.58
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.57
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.56
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.55
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.55
CHL00195489 ycf46 Ycf46; Provisional 98.53
PRK08727233 hypothetical protein; Validated 98.53
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.5
PRK05564313 DNA polymerase III subunit delta'; Validated 98.49
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.48
PRK00440319 rfc replication factor C small subunit; Reviewed 98.48
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.45
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.45
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.45
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK05642234 DNA replication initiation factor; Validated 98.44
smart00382148 AAA ATPases associated with a variety of cellular 98.44
PF00004132 AAA: ATPase family associated with various cellula 98.44
PRK07399314 DNA polymerase III subunit delta'; Validated 98.42
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK03992389 proteasome-activating nucleotidase; Provisional 98.41
PRK05707328 DNA polymerase III subunit delta'; Validated 98.38
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.35
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 98.34
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.34
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.32
PRK03992389 proteasome-activating nucleotidase; Provisional 98.32
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.31
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.31
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.31
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.3
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.29
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.29
PRK08699325 DNA polymerase III subunit delta'; Validated 98.29
PHA02244383 ATPase-like protein 98.28
PRK08058329 DNA polymerase III subunit delta'; Validated 98.28
PF07726131 AAA_3: ATPase family associated with various cellu 98.28
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 98.27
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.26
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.25
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.24
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.23
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.23
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.21
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.2
PRK00149450 dnaA chromosomal replication initiation protein; R 98.2
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.19
PRK09112351 DNA polymerase III subunit delta'; Validated 98.18
PRK08769319 DNA polymerase III subunit delta'; Validated 98.16
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.16
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.16
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.14
PRK06871325 DNA polymerase III subunit delta'; Validated 98.14
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.14
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.13
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.12
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.12
PRK15115444 response regulator GlrR; Provisional 98.11
PRK06090319 DNA polymerase III subunit delta'; Validated 98.11
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.09
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.09
PRK08116268 hypothetical protein; Validated 98.09
PTZ001121164 origin recognition complex 1 protein; Provisional 98.06
CHL00095 821 clpC Clp protease ATP binding subunit 98.06
PRK07993334 DNA polymerase III subunit delta'; Validated 98.05
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.03
CHL00176638 ftsH cell division protein; Validated 98.03
PF13173128 AAA_14: AAA domain 98.02
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.02
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.01
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.0
PRK12377248 putative replication protein; Provisional 97.99
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.99
CHL00176638 ftsH cell division protein; Validated 97.99
PRK04132846 replication factor C small subunit; Provisional 97.96
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 97.96
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.96
PRK12422445 chromosomal replication initiation protein; Provis 97.96
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.95
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 97.92
PRK07952244 DNA replication protein DnaC; Validated 97.91
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.91
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 97.89
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.88
PRK06964342 DNA polymerase III subunit delta'; Validated 97.88
CHL00181287 cbbX CbbX; Provisional 97.87
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.87
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.87
PRK14087450 dnaA chromosomal replication initiation protein; P 97.86
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.85
PRK09087226 hypothetical protein; Validated 97.84
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.84
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.84
CHL00195489 ycf46 Ycf46; Provisional 97.83
PRK14086617 dnaA chromosomal replication initiation protein; P 97.83
PRK14088440 dnaA chromosomal replication initiation protein; P 97.83
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.83
PRK06620214 hypothetical protein; Validated 97.82
PRK15424538 propionate catabolism operon regulatory protein Pr 97.8
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 97.79
PRK06526254 transposase; Provisional 97.79
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 97.79
smart00350509 MCM minichromosome maintenance proteins. 97.77
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.77
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.76
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 97.74
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.72
PRK10865 857 protein disaggregation chaperone; Provisional 97.71
COG2204464 AtoC Response regulator containing CheY-like recei 97.69
PRK08939306 primosomal protein DnaI; Reviewed 97.67
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.67
PRK06835329 DNA replication protein DnaC; Validated 97.63
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.62
PTZ00111915 DNA replication licensing factor MCM4; Provisional 97.62
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.61
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 97.61
PRK06921266 hypothetical protein; Provisional 97.59
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.58
PRK05917290 DNA polymerase III subunit delta'; Validated 97.55
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.54
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.54
PRK08181269 transposase; Validated 97.54
KOG2028554 consensus ATPase related to the helicase subunit o 97.53
COG1221403 PspF Transcriptional regulators containing an AAA- 97.53
PRK09862506 putative ATP-dependent protease; Provisional 97.53
PRK13342413 recombination factor protein RarA; Reviewed 97.52
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 97.5
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.48
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.46
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.45
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.42
COG0606490 Predicted ATPase with chaperone activity [Posttran 97.4
PRK13765 637 ATP-dependent protease Lon; Provisional 97.4
PRK09183259 transposase/IS protein; Provisional 97.38
PRK05818261 DNA polymerase III subunit delta'; Validated 97.36
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.35
PTZ001121164 origin recognition complex 1 protein; Provisional 97.31
KOG0736953 consensus Peroxisome assembly factor 2 containing 97.29
CHL00206 2281 ycf2 Ycf2; Provisional 97.28
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 97.26
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.24
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.24
PRK07276290 DNA polymerase III subunit delta'; Validated 97.24
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.24
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.22
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.19
COG3829560 RocR Transcriptional regulator containing PAS, AAA 97.18
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.15
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.15
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.13
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.1
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.1
KOG0734752 consensus AAA+-type ATPase containing the peptidas 97.06
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 97.05
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.04
PRK07132299 DNA polymerase III subunit delta'; Validated 97.04
KOG0734752 consensus AAA+-type ATPase containing the peptidas 96.94
COG0593408 DnaA ATPase involved in DNA replication initiation 96.93
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.93
CHL002062281 ycf2 Ycf2; Provisional 96.92
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.89
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 96.87
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.87
PF05729166 NACHT: NACHT domain 96.86
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.85
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.8
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.79
PRK13341725 recombination factor protein RarA/unknown domain f 96.79
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 96.73
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.73
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.72
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 96.72
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.71
KOG0736953 consensus Peroxisome assembly factor 2 containing 96.67
KOG0731774 consensus AAA+-type ATPase containing the peptidas 96.67
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 96.63
PRK10436462 hypothetical protein; Provisional 96.62
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.59
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.59
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.58
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 96.58
TIGR02533486 type_II_gspE general secretory pathway protein E. 96.56
PHA02544316 44 clamp loader, small subunit; Provisional 96.54
PRK15455 644 PrkA family serine protein kinase; Provisional 96.54
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.53
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.48
smart00382148 AAA ATPases associated with a variety of cellular 96.48
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.48
KOG2028554 consensus ATPase related to the helicase subunit o 96.47
cd01128249 rho_factor Transcription termination factor rho is 96.41
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.4
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.4
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.39
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.39
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 96.38
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 96.37
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.33
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 96.31
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.23
PRK13833323 conjugal transfer protein TrbB; Provisional 96.2
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 96.19
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.18
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.17
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.14
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.09
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 96.08
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 96.07
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.01
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.0
COG4650531 RtcR Sigma54-dependent transcription regulator con 95.97
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 95.97
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.97
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.91
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.88
PRK12608380 transcription termination factor Rho; Provisional 95.87
TIGR00064272 ftsY signal recognition particle-docking protein F 95.86
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.86
PRK08084235 DNA replication initiation factor; Provisional 95.85
TIGR02688449 conserved hypothetical protein TIGR02688. Members 95.8
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.78
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.77
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.76
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 95.76
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.75
PRK13531498 regulatory ATPase RavA; Provisional 95.71
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.68
PRK09376416 rho transcription termination factor Rho; Provisio 95.67
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.61
COG3283511 TyrR Transcriptional regulator of aromatic amino a 95.6
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.57
PRK14974336 cell division protein FtsY; Provisional 95.55
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.53
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.52
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.47
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.47
PRK00771437 signal recognition particle protein Srp54; Provisi 95.45
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.39
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.37
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.37
COG3899849 Predicted ATPase [General function prediction only 95.37
PRK10867433 signal recognition particle protein; Provisional 95.32
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.32
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.28
PHA00729226 NTP-binding motif containing protein 95.27
KOG1969 877 consensus DNA replication checkpoint protein CHL12 95.26
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 95.2
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 95.17
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 95.16
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 95.16
PRK05642234 DNA replication initiation factor; Validated 95.16
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 95.11
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.07
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 95.06
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.03
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.01
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 95.0
PRK06696223 uridine kinase; Validated 94.97
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.96
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.92
PRK13851344 type IV secretion system protein VirB11; Provision 94.92
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 94.92
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.89
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.81
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.67
PF04851184 ResIII: Type III restriction enzyme, res subunit; 94.66
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.6
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.57
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.57
PRK12402337 replication factor C small subunit 2; Reviewed 94.54
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.52
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.52
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 94.44
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 94.43
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.41
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.39
PRK00440319 rfc replication factor C small subunit; Reviewed 94.37
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.34
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.33
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.33
PHA02774613 E1; Provisional 94.32
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.3
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 94.26
smart00487201 DEXDc DEAD-like helicases superfamily. 94.24
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.21
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.2
PRK05541176 adenylylsulfate kinase; Provisional 94.18
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.16
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.15
PRK06067234 flagellar accessory protein FlaH; Validated 94.13
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 94.12
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 94.09
PRK06581263 DNA polymerase III subunit delta'; Validated 94.07
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 94.03
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.03
PRK10416318 signal recognition particle-docking protein FtsY; 94.02
PRK08181269 transposase; Validated 94.02
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.01
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 93.99
PRK04195482 replication factor C large subunit; Provisional 93.99
TIGR00767415 rho transcription termination factor Rho. Members 93.93
PLN03025319 replication factor C subunit; Provisional 93.92
cd03115173 SRP The signal recognition particle (SRP) mediates 93.92
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 93.88
PRK13764602 ATPase; Provisional 93.8
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 93.78
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 93.74
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 93.72
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 93.7
PRK10536262 hypothetical protein; Provisional 93.69
PRK04296190 thymidine kinase; Provisional 93.67
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 93.67
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 93.62
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 93.61
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.6
TIGR00959428 ffh signal recognition particle protein. This mode 93.58
cd03246173 ABCC_Protease_Secretion This family represents the 93.58
PRK08727233 hypothetical protein; Validated 93.55
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.54
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 93.46
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.45
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 93.45
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 93.44
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 93.44
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 93.42
PF13173128 AAA_14: AAA domain 93.4
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.37
TIGR00763775 lon ATP-dependent protease La. This protein is ind 93.26
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.24
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 93.12
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.1
PRK07940394 DNA polymerase III subunit delta'; Validated 93.06
PRK11823446 DNA repair protein RadA; Provisional 93.04
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 93.03
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 92.98
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 92.93
COG4178604 ABC-type uncharacterized transport system, permeas 92.91
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 92.9
PRK00131175 aroK shikimate kinase; Reviewed 92.84
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.81
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 92.77
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 92.72
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.69
PHA02244383 ATPase-like protein 92.66
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 92.66
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 92.58
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 92.54
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 92.49
PRK08118167 topology modulation protein; Reviewed 92.48
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 92.47
PRK06526254 transposase; Provisional 92.45
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 92.42
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 92.42
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 92.37
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.36
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.31
PRK14086617 dnaA chromosomal replication initiation protein; P 92.29
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 92.2
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 92.18
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.17
TIGR00362405 DnaA chromosomal replication initiator protein Dna 92.14
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 92.13
KOG0745564 consensus Putative ATP-dependent Clp-type protease 92.09
PRK08233182 hypothetical protein; Provisional 92.08
PRK10875615 recD exonuclease V subunit alpha; Provisional 92.07
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 92.06
PF13479213 AAA_24: AAA domain 92.06
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 92.05
PRK14527191 adenylate kinase; Provisional 92.04
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 92.04
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.02
cd03239178 ABC_SMC_head The structural maintenance of chromos 91.93
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.89
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 91.85
TIGR02974329 phageshock_pspF psp operon transcriptional activat 91.84
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 91.79
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 91.78
PRK11608326 pspF phage shock protein operon transcriptional ac 91.76
PRK03846198 adenylylsulfate kinase; Provisional 91.73
PRK13947171 shikimate kinase; Provisional 91.71
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 91.7
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.69
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.65
PRK04220301 2-phosphoglycerate kinase; Provisional 91.56
PRK07667193 uridine kinase; Provisional 91.54
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 91.44
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 91.43
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 91.41
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 91.39
PRK09183259 transposase/IS protein; Provisional 91.37
PRK13695174 putative NTPase; Provisional 91.37
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 91.25
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 91.24
PRK06762166 hypothetical protein; Provisional 91.23
PRK08154309 anaerobic benzoate catabolism transcriptional regu 91.14
PRK14532188 adenylate kinase; Provisional 91.13
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 91.12
PRK07261171 topology modulation protein; Provisional 91.11
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 91.1
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 91.1
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 91.08
PRK06921266 hypothetical protein; Provisional 91.06
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 91.03
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.03
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 90.96
PRK00889175 adenylylsulfate kinase; Provisional 90.96
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 90.95
PRK04841 903 transcriptional regulator MalT; Provisional 90.93
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 90.9
PF05729166 NACHT: NACHT domain 90.89
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 90.88
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-112  Score=1005.87  Aligned_cols=668  Identities=25%  Similarity=0.401  Sum_probs=476.6

Q ss_pred             CCcCCCChHHHHHhhhcccCCCccccccCCCCCCccCCCCCCCcC----cc--ccCCCCcccccccccCCCCCCCCc-HH
Q 003070            1 MREAGFSSTTIKNHIEDSSASSVFQCYTSSGGGVFSSPCSPSSSE----AH--HFINPNTFWQNHALFSSQKPASVS-KE   73 (850)
Q Consensus         1 MrEAGFsS~~VK~~ie~~~~~~~f~c~~~~~~~~~~~p~~~~~~~----~~--~~~np~~~~~~~~~~~~~~~~~gR-de   73 (850)
                      ||||||+|++||++||+++             |.|++|+..+-..    .+  .++||+... +  ..   .+..|| |+
T Consensus       134 ~reag~~s~~vK~~ve~~~-------------g~~~~~~~~~~~~~~~L~~~~~dl~p~a~~-g--kl---dPvigr~de  194 (898)
T KOG1051|consen  134 MREAGFSSSAVKSAVEQPV-------------GQFRSPSRGPLWPLLFLENYGTDLTPRARQ-G--KL---DPVIGRHDE  194 (898)
T ss_pred             HHHhcCChHHHHHHHHhhc-------------cccCCCCcCCccchhHHHhcccccChhhhc-c--CC---CCccCCchH
Confidence            8999999999999999987             3344444211000    11  144554432 0  01   122377 99


Q ss_pred             HHHHHHHHHhcCCCCCeEEEcCCCchHHHHHHHHHHhHHhCCCCcccCCcEEEEeecccccccccChhHHHHHHHHHHHH
Q 003070           74 DIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRK  153 (850)
Q Consensus        74 eirrVieIL~Rr~K~NPVLVGe~gvgktAvVegla~rI~~G~VP~~Lkg~~visLdl~~l~~~~~~RgefE~RlkeL~~~  153 (850)
                      ||||||+||+||+||||||||+|||||||||+|+|+||++|+||+.|++++++.||+++++++.+.|||||+||++|+++
T Consensus       195 eirRvi~iL~Rrtk~NPvLVG~~gvgktaiv~gla~ri~~G~vp~~l~~~~l~~l~~g~l~aGa~~rge~E~rlk~l~k~  274 (898)
T KOG1051|consen  195 EIRRVIEILSRKTKNNPVLVGEPGVGKTAIVEGLAQRIATGDVPETLKDKKLIALDFGSLVAGAKRRGEFEERLKELLKE  274 (898)
T ss_pred             HHHHHHHHHhccCCCCceEEecCCCCchhHHHHHHHHhhcCCCCccccccceEEEEhhhcccCcccchHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999877677799999999999999


Q ss_pred             HhccccCCCCeEEEecchhhhhcCCccCCCCCCCCCccccCCchhhhhHHhhhhcccccCCCCCeEEEEecccHHHHHhh
Q 003070          154 VDSLTSVGGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQTYMKC  233 (850)
Q Consensus       154 V~~~~~~~~gvILfIdELh~lvgag~~~g~~~~~~g~~~~~~a~~~~V~El~nLLkp~l~~arG~lwlIGatT~eeY~K~  233 (850)
                      |++   +++|||||||||||++|+|++             |++     ++++|+|||++  +||+||||||||++||+||
T Consensus       275 v~~---~~~gvILfigelh~lvg~g~~-------------~~~-----~d~~nlLkp~L--~rg~l~~IGatT~e~Y~k~  331 (898)
T KOG1051|consen  275 VES---GGGGVILFLGELHWLVGSGSN-------------YGA-----IDAANLLKPLL--ARGGLWCIGATTLETYRKC  331 (898)
T ss_pred             Hhc---CCCcEEEEecceeeeecCCCc-------------chH-----HHHHHhhHHHH--hcCCeEEEecccHHHHHHH
Confidence            997   488999999999999998853             334     45679999987  8999999999999999999


Q ss_pred             hhcCCcccccccceeeecCCCC-cccccccc---cccccccccccCCCccccCCCCCCcccccchhhcchHhhhhHHHHH
Q 003070          234 QMRQPPLEIQWALQAVSIPSGG-LGLSLHSS---SVHESRLTFSQNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEA  309 (850)
Q Consensus       234 iekdPaLEr~W~LQ~V~Vps~~-~~l~l~~~---s~~~~~~~~s~~~s~v~~~~~l~~~~~~~~~~~~c~~c~~~ye~E~  309 (850)
                      |+|||||||||++|.|+||+.+ +...|++.   ...++.+.+++. +.+ ....++..   ..+..||++|+.+|++|+
T Consensus       332 iekdPalErrw~l~~v~~pS~~~~~~iL~~l~~~~e~~hg~~~s~~-a~~-~a~~~s~~---~~t~r~lpd~aidl~dEa  406 (898)
T KOG1051|consen  332 IEKDPALERRWQLVLVPIPSVENLSLILPGLSERYEVHHGVRISDE-SLF-SAAQLSAR---YITLSFLPDCAIDLEDEA  406 (898)
T ss_pred             HhhCcchhhCcceeEeccCcccchhhhhhhhhhhhccccCCccccc-ccc-cccchhhh---hcccCcCchhcccHHHHH
Confidence            9999999999999999999876 22222221   112222222221 111 11222222   245679999999999999


Q ss_pred             HHHhccccccCCCCcCcCcccchhhHHHHHHHHHHHHHHhhhhccccccccccccccccccccccccccccccCCCCccc
Q 003070          310 QLFKSGQKKLLPPWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQ  389 (850)
Q Consensus       310 ~~~~~~~~~~lP~wLq~~~~~~~~~~~~~~~L~kkW~~~c~~lh~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  389 (850)
                      ++....+..++|+|||+++....+.++++.+|++||+   +.+|+....     ..+.......   .+.+  ..|-+ .
T Consensus       407 ~a~~~~~~~~lP~wL~~~~~~~~~~~~e~~~L~kk~d---~~~h~r~~~-----~~~~~~~~~~---~~l~--~~~~~-~  472 (898)
T KOG1051|consen  407 AALVKSQAESLPPWLQNLERVDIKLQDEISELQKKWN---QALHKRPSL-----ESLAPSKPTQ---QPLS--ASVDS-E  472 (898)
T ss_pred             HHHHhhhhhhCCHHHHhhhhhhhhhHHHHHHHHHhhh---hhhcccccc-----cccccccccc---ccch--hhhcc-c
Confidence            9987777889999999995444556788999999999   556654221     1110000000   0000  00000 0


Q ss_pred             cccccccCchhhhhcccCCCC-Cchh-hHHHhhccccc-ccccccCcCCCCC------CCCccc-cc-ccccCCCcceee
Q 003070          390 SSIFLDSNSISFAESAMKPHN-SSNS-VAKFRRQQSCS-TIEFNFGNCTRKP------QGVEPR-LD-SLKSNEGKEVKI  458 (850)
Q Consensus       390 ~~~~~~~~~~~~~~~~~~p~~-~~~~-i~~~~r~~s~~-t~e~~~~~~~~~~------~~v~~~-~~-~~~~~~gi~v~t  458 (850)
                      .++.        ......++. .... +++..|+.+++ .+++..+......      ...++. +. ..+.|+|+|++ 
T Consensus       473 ~s~~--------~~l~~~~~~~~~~~~~~k~~r~~d~~~~~~l~~~~~p~~~~~~~~~~~~~~~~i~~~~s~~tgip~~-  543 (898)
T KOG1051|consen  473 RSVI--------EELKLKKNSLDRNSLLAKAHRPNDYTRETDLRYGRIPDELSEKSNDNQGGESDISEVVSRWTGIPVD-  543 (898)
T ss_pred             hhHH--------hhhccccCCcccchhhhcccCCCCcchhhhccccccchhhhhhcccccCCccchhhhhhhhcCCchh-
Confidence            0110        001111111 1111 44555555551 2333322221100      000111 22 34778888884 


Q ss_pred             ecccCCCcCChhHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHhhhC--C--CCeEEEEecCCchHHHHHHHHHHHHhc
Q 003070          459 TLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSA--K--KATWFLLQGNDTIGKRRLALSIAESVF  534 (850)
Q Consensus       459 ~l~lg~s~~~~~~~~~l~~L~~~L~~~V~gQ~eai~~Ia~av~~~r~g--k--~~~~~lf~Gp~gvGKt~lA~~LA~~lf  534 (850)
                             .+...++++|+.|++.|+++|+||++||++||+||++||+|  +  |++||||+||||||||+||++||++||
T Consensus       544 -------~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~aIa~AI~~sr~gl~~~~~~awflflGpdgvGKt~lAkaLA~~~F  616 (898)
T KOG1051|consen  544 -------RLAEAEAERLKKLEERLHERVIGQDEAVAAIAAAIRRSRAGLKDPNPDAWFLFLGPDGVGKTELAKALAEYVF  616 (898)
T ss_pred             -------hhhhhHHHHHHHHHHHHHhhccchHHHHHHHHHHHHhhhcccCCCCCCeEEEEECCCchhHHHHHHHHHHHHc
Confidence                   44667789999999999999999999999999999999987  4  899999999999999999999999999


Q ss_pred             CCCCceEEecCccccC------CCCCchh-----hHHHHhhhCCCEEEeeccccccCHHHHHHHHhhhccCcc-------
Q 003070          535 GSTDLLFHIDMRKRND------GVSSHSE-----MLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENF-------  596 (850)
Q Consensus       535 gs~~~~i~idms~~~~------~~~~~~~-----~l~e~vr~~P~sVvlldeiekA~~~v~~~l~q~~d~G~l-------  596 (850)
                      |++++|||||||+|++      +||||+|     +|||+||++||+|||||||||||++|++.|+|+||+||+       
T Consensus       617 gse~~~IriDmse~~evskligsp~gyvG~e~gg~LteavrrrP~sVVLfdeIEkAh~~v~n~llq~lD~GrltDs~Gr~  696 (898)
T KOG1051|consen  617 GSEENFIRLDMSEFQEVSKLIGSPPGYVGKEEGGQLTEAVKRRPYSVVLFEEIEKAHPDVLNILLQLLDRGRLTDSHGRE  696 (898)
T ss_pred             CCccceEEechhhhhhhhhccCCCcccccchhHHHHHHHHhcCCceEEEEechhhcCHHHHHHHHHHHhcCccccCCCcE
Confidence            9999999999999754      6889986     899999999999999999999999999999999999996       


Q ss_pred             ---CceEEEEecCC-CchhhhhhhhcccccchhheecccCcccccchhhhhhhhccCCCCCccccccccccccccccCCC
Q 003070          597 ---GKVIFVLTKGD-SSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGN  672 (850)
Q Consensus       597 ---~n~Iii~Tsn~-~~~~~e~~~~~~~~~~l~l~~~~~~~~~~~krk~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  672 (850)
                         +|||||||||. +....    +... ....+..        .+.+. +...                       ..+
T Consensus       697 Vd~kN~I~IMTsn~~~~~i~----~~~~-~~~~l~~--------~~~~~-~~~~-----------------------~~k  739 (898)
T KOG1051|consen  697 VDFKNAIFIMTSNVGSSAIA----NDAS-LEEKLLD--------MDEKR-GSYR-----------------------LKK  739 (898)
T ss_pred             eeccceEEEEecccchHhhh----cccc-ccccccc--------chhhh-hhhh-----------------------hhh
Confidence               49999999994 32221    1011 1111110        00000 0000                       000


Q ss_pred             cccccccCcccccccccccCCcCccCCCCCCCCCCCcccch-hhcccCCCCCchhhhcccceEeccCCCCCchhHHHHHH
Q 003070          673 KKDFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLT-RENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFL  751 (850)
Q Consensus       673 kr~~~~~~s~~~lDLNl~a~e~e~~~~~~~~~~~~~~sd~~-~e~~~~~~~~~efLnriD~~vvF~~l~~~~~~l~~~i~  751 (850)
                      ++.     +                             +.. .++  +..|.|||+||+|++++|+|+++  +++.+++.
T Consensus       740 ~~v-----~-----------------------------~~~~~~~--~~~~r~Ef~nrid~i~lf~~l~~--~~~~~i~~  781 (898)
T KOG1051|consen  740 VQV-----S-----------------------------DAVRIYN--KQFFRKEFLNRIDELDLNLPLDR--DELIEIVN  781 (898)
T ss_pred             hhh-----h-----------------------------hhhhccc--ccccChHHhcccceeeeecccch--hhHhhhhh
Confidence            000     0                             000 011  16899999999999999999999  46777776


Q ss_pred             HHHHHHHHHHH-ccCCceEEEeCHHHHHHHHhccC--CcchhHHHHHHHHHHhhHHHHHHhCCCC-CCceEEEeecc
Q 003070          752 AKMKESFDEIF-KRQNKVNFSVEERVLEEVLIGSG--FFHNSLFEKWLKEVFQTSLEAVKIGGKG-GGIEIRLCFGC  824 (850)
Q Consensus       752 ~~~~~~~~~~l-~~~~~~~l~vd~~~~e~l~~~~~--~~~~r~le~wie~vl~~~l~~~~~~g~~-~~~~v~L~~~~  824 (850)
                      ..+.+ .++++ +.+  +.+.|++++.++++..++  .+|+|+++++|++.|...++.... +.. ...++++..++
T Consensus       782 ~~~~e-~~~r~~~~~--~~~~v~~~~~~~v~~~~~d~~ygAr~ikr~i~~~~~~~la~~~l-~ei~~~~~~~i~~~~  854 (898)
T KOG1051|consen  782 KQLTE-IEKRLEERE--LLLLVTDRVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALL-GEVEDGLTERILVAD  854 (898)
T ss_pred             hHHHH-HHHHhhhhH--HHHHHHHHHHhhhhhcCcChHHHhhHHHHHHHHHHHHHHhhhhe-eeecCCceEEEEecc
Confidence            66654 44444 333  889999999999988863  369999999999999999999988 544 45567776444

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
3pxi_A758 Structure Of Meca108:clpc Length = 758 5e-04
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
Query: 512 FLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEMLMGTLKNYEKLVV 571
           F+  G   +GK  LA ++AES+FG  + +  IDM +  +  S+    L   ++     VV
Sbjct: 524 FIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEYMEKHSTSGGQLTEKVRRKPYSVV 583
Query: 572 LVEDIDLADPQ----FIKILADGFETENFGKVI 600
           L++ I+ A P      +++L DG  T++ G+ +
Sbjct: 584 LLDAIEKAHPDVFNILLQVLEDGRLTDSKGRTV 616

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query850
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 73.0 bits (178), Expect = 3e-13
 Identities = 108/772 (13%), Positives = 220/772 (28%), Gaps = 242/772 (31%)

Query: 47  HHFINPNTFWQNHALFSSQKPASVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDAL--V 104
           HH ++  T    +             +DI     VF      N     DC  + D    +
Sbjct: 4   HHHMDFETGEHQY-----------QYKDI---LSVFEDAFVDNF----DCKDVQDMPKSI 45

Query: 105 FDFMGRVERGDV---PQELKQTHVIKFHFAPVTLRFMKKEEVEMNLTELKRKVDSLTSVG 161
                + E   +      +  T  +   F   TL   ++E V+  + E+ R         
Sbjct: 46  LS---KEEIDHIIMSKDAVSGTLRL---F--WTLLSKQEEMVQKFVEEVLRI-------- 89

Query: 162 GGAIIYTGDLKWTVDQ-QESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVW 220
                   + K+ +   +      +    +   Y      + +  +L +D    +   V 
Sbjct: 90  --------NYKFLMSPIKTEQRQPSMMTRM---Y------IEQRDRLYNDNQVFAKYNVS 132

Query: 221 LMATASYQTYMKCQMRQPP-LEIQWALQAVSIPSGGLGLSLHSSSVH------ESRLTFS 273
                          R  P L+++ AL  +  P+  +        +       ++ +   
Sbjct: 133 ---------------RLQPYLKLRQALLELR-PAKNVL-------IDGVLGSGKTWV--- 166

Query: 274 QNPSQVWETKPFAIKEEEDHKLNCCAECTSNYEEEAQLFKSGQKKLLPPWLQPHSSSNAN 333
                       A+     +K+ C  +         ++F          WL   +  N N
Sbjct: 167 ------------ALDVCLSYKVQCKMDF--------KIF----------WL---NLKNCN 193

Query: 334 QKDELVEMRRKWNRSCHSLHQGRHTQSQFSSNLYNNQSLTGKSCSYASTYPWWPSQSSIF 393
             + ++EM     +  + +     ++S  SSN+                     ++    
Sbjct: 194 SPETVLEML---QKLLYQIDPNWTSRSDHSSNIKLRIH-------------SIQAELRRL 237

Query: 394 LDSNSISFAESAMKPHNSS----NSVAKFRRQQSCSTIE-FNFGNC-----TRKPQGVEP 443
           L S          KP+ +      +V      Q+      FN   C     TR  + V  
Sbjct: 238 LKS----------KPYENCLLVLLNV------QNAKAWNAFNLS-CKILLTTRF-KQV-- 277

Query: 444 RLDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENV---PWQFDSIHS-IVEV 499
             D L +     + +          +   L    L K L       P +  + +   + +
Sbjct: 278 -TDFLSAATTTHISLDHHSMTLTPDEVKSL----LLKYLDCRPQDLPREVLTTNPRRLSI 332

Query: 500 LVECKSAKKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHSEML 559
           + E      ATW        +   +L   I  S+    ++L   + RK            
Sbjct: 333 IAESIRDGLATW---DNWKHVNCDKLTTIIESSL----NVLEPAEYRKM----------- 374

Query: 560 MGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENFGKVI-----FVLTKGDSSNYEER 614
                 +++L V      +     + ++       +   V+     + L +         
Sbjct: 375 ------FDRLSVFPPSAHIP-TILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTIS 427

Query: 615 IENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDN------- 667
           I +    I + LKV   N+   H+        +    P+  + +D     +D        
Sbjct: 428 IPS----IYLELKVKLENEYALHRS-----IVDHYNIPKTFDSDDLIPPYLDQYFYSHIG 478

Query: 668 --VSSGNKKDFSRQSSFNT--LDLN-MKAD-DEDDEGEQKPGELSPISSDLT--RENIT- 718
             + +    +  R + F    LD   ++     D       G +      L   +  I  
Sbjct: 479 HHLKNIEHPE--RMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICD 536

Query: 719 NPALSNGFLDLIQNRFVFNRNSS-NDGKITGLF-LAKMKESFDEIFK---RQ 765
           N       ++ I + F+     +    K T L  +A M E  + IF+   +Q
Sbjct: 537 NDPKYERLVNAILD-FLPKIEENLICSKYTDLLRIALMAED-EAIFEEAHKQ 586
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.92
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.81
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.79
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.79
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.68
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.53
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.51
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.51
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.5
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.5
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.44
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.43
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.42
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.28
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.26
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.17
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.09
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.09
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.07
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.07
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.06
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.04
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.03
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.03
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.03
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.03
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.02
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.01
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.01
3co5_A143 Putative two-component system transcriptional RES 99.0
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.99
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.97
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.96
3pvs_A447 Replication-associated recombination protein A; ma 98.96
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.95
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.95
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.95
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.94
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.91
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.9
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.89
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.89
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.87
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.85
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.82
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.81
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.81
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.81
3bos_A242 Putative DNA replication factor; P-loop containing 98.8
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.78
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.75
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.74
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.74
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.73
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.7
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.7
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.69
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.68
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.67
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.67
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.63
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.63
2r62_A268 Cell division protease FTSH homolog; ATPase domain 98.57
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.56
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.56
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.56
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.56
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.55
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.55
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.52
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.52
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.51
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.5
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.5
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.49
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.41
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.4
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.39
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.39
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.35
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.34
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.32
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.31
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.31
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.31
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.3
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.29
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.28
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.27
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.27
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.25
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.24
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.23
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.22
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.22
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.22
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.16
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.14
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.13
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.1
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.08
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.06
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.02
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.99
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.99
2qgz_A308 Helicase loader, putative primosome component; str 97.98
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.97
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.91
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.91
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.89
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.86
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.84
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.82
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.75
3pvs_A447 Replication-associated recombination protein A; ma 97.72
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.68
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.67
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.6
3f8t_A506 Predicted ATPase involved in replication control, 97.58
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.55
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.55
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.5
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.43
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.36
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.36
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.34
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.29
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.24
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.22
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.19
2fna_A357 Conserved hypothetical protein; structural genomic 97.15
2fna_A357 Conserved hypothetical protein; structural genomic 97.08
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.08
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.05
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.03
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.02
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 96.97
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.94
1tue_A212 Replication protein E1; helicase, replication, E1E 96.93
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.91
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.88
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.87
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.85
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 96.83
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.81
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.79
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.65
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.6
3co5_A143 Putative two-component system transcriptional RES 96.55
3bos_A242 Putative DNA replication factor; P-loop containing 96.51
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.44
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.42
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.28
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.23
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.23
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.14
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.04
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.02
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.0
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.93
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.73
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.66
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.63
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.6
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 95.6
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.43
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.18
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.15
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.07
1p9r_A418 General secretion pathway protein E; bacterial typ 95.06
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.8
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.78
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.59
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.54
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.46
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.44
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.42
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.34
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.22
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.16
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.14
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.13
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.12
2oap_1511 GSPE-2, type II secretion system protein; hexameri 94.08
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.77
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.68
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 93.59
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.58
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.42
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.37
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.28
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.23
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.2
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.05
2xxa_A433 Signal recognition particle protein; protein trans 93.0
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.97
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.95
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.79
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.72
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 92.68
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.68
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.67
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 92.63
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.47
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.45
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.44
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.25
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 92.16
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.14
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 91.91
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 91.89
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 91.87
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 91.85
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 91.82
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 91.81
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.75
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.7
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.54
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.53
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.49
1u94_A356 RECA protein, recombinase A; homologous recombinat 91.38
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.31
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.13
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.03
1xp8_A366 RECA protein, recombinase A; recombination, radior 91.03
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 90.97
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 90.89
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 90.88
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.85
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 90.69
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 90.58
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.58
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 90.57
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 90.56
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.54
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 90.48
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.46
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.46
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.41
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 90.4
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.39
2qgz_A308 Helicase loader, putative primosome component; str 90.38
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.35
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.34
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 90.32
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.24
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 90.2
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 90.19
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.09
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 90.07
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.98
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 89.95
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 89.9
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.88
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 89.85
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 89.85
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.85
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.79
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.79
1via_A175 Shikimate kinase; structural genomics, transferase 89.76
2r44_A331 Uncharacterized protein; putative ATPase, structur 89.74
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.69
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 89.6
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.44
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 89.41
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.3
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 89.26
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 89.21
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 89.18
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.17
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.16
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 89.15
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 89.13
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.08
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 88.97
2vli_A183 Antibiotic resistance protein; transferase, tunica 88.9
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 88.84
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 88.81
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 88.7
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.59
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 88.54
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.52
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 88.43
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 88.42
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 88.42
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.41
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 88.36
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 88.34
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 88.28
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 88.27
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 88.26
2kjq_A149 DNAA-related protein; solution structure, NESG, st 88.21
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 88.21
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.06
2og2_A359 Putative signal recognition particle receptor; nuc 88.0
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 87.99
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 87.93
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.9
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.71
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 87.5
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 87.49
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.42
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 87.4
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 87.06
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 87.04
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 86.97
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 86.91
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 86.89
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.72
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 86.61
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 86.6
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 86.58
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 86.57
1vma_A306 Cell division protein FTSY; TM0570, structural gen 86.5
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 86.37
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 86.35
3lxx_A239 GTPase IMAP family member 4; structural genomics c 86.14
3tlx_A243 Adenylate kinase 2; structural genomics, structura 86.05
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.04
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 85.8
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 85.79
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 85.74
3kta_A182 Chromosome segregation protein SMC; structural mai 85.72
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 85.68
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 85.65
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 85.57
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 85.35
2z43_A324 DNA repair and recombination protein RADA; archaea 85.32
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 85.31
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 85.29
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 85.23
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 85.1
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 84.91
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.87
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 84.82
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 84.79
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 84.75
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 84.74
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.02
3io5_A333 Recombination and repair protein; storage dimer, i 84.0
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 83.99
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 83.88
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 83.7
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 83.56
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.54
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 83.45
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 83.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 83.33
3ice_A422 Transcription termination factor RHO; transcriptio 83.12
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 83.1
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 82.98
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 82.97
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 82.95
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 82.91
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 82.83
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 82.67
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.64
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 82.55
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 82.46
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 82.42
3lxw_A247 GTPase IMAP family member 1; immunity, structural 82.26
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 82.19
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 82.17
2gno_A305 DNA polymerase III, gamma subunit-related protein; 82.09
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 82.05
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 81.87
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 81.78
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 81.68
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 81.58
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 81.49
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 81.43
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 81.4
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 81.36
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 81.3
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 81.27
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 81.25
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 81.21
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 80.97
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 80.88
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 80.82
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 80.76
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 80.74
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 80.68
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 80.55
3r20_A233 Cytidylate kinase; structural genomics, seattle st 80.54
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 80.48
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 80.3
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 80.21
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 80.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 80.01
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
Probab=100.00  E-value=9.2e-52  Score=504.79  Aligned_cols=595  Identities=17%  Similarity=0.266  Sum_probs=372.6

Q ss_pred             CCcHHHHHHHHHHHhcCCCCCeEEEcCCCchHHHHHHHHHHhHHhCCCCcccCCcEEEEeecccccccccChhHHHHHHH
Q 003070           69 SVSKEDIKLVFEVFLRKKRRNTVIVGDCLSITDALVFDFMGRVERGDVPQELKQTHVIKFHFAPVTLRFMKKEEVEMNLT  148 (850)
Q Consensus        69 ~gRdeeirrVieIL~Rr~K~NPVLVGe~gvgktAvVegla~rI~~G~VP~~Lkg~~visLdl~~l~~~~~~RgefE~Rlk  148 (850)
                      -||++++++++++|+|++++|++|+|+||+|||++++++++++..+++|..|++.+++.++++.+..+...+|+++.+++
T Consensus       173 iGr~~~i~~l~~~l~~~~~~~vlL~G~pG~GKT~la~~la~~l~~~~~p~~l~~~~~~~l~~~~l~~g~~~~g~~~~~l~  252 (854)
T 1qvr_A          173 IGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLK  252 (854)
T ss_dssp             CSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEEEEECC-----------CHHHHHH
T ss_pred             CCcHHHHHHHHHHHhcCCCCceEEEcCCCCCHHHHHHHHHHHHhcCCCchhhcCCeEEEeehHHhhccCccchHHHHHHH
Confidence            49999999999999999999999999999999999999999999999999999999999999887444445999999999


Q ss_pred             HHHHHHhccccCCCCeEEEecchhhhhcCCccCCCCCCCCCccccCCchhhhhHHhhhhcccccCCCCCeEEEEecccHH
Q 003070          149 ELKRKVDSLTSVGGGAIIYTGDLKWTVDQQESNNNNNFNGEIASCYNPINHLVSEVGKLVSDCNSASSTRVWLMATASYQ  228 (850)
Q Consensus       149 eL~~~V~~~~~~~~gvILfIdELh~lvgag~~~g~~~~~~g~~~~~~a~~~~V~El~nLLkp~l~~arG~lwlIGatT~e  228 (850)
                      .+++.+..   .++++||||||+|++++++..+|             .     .++.++|++.+  .+|+++||||||+.
T Consensus       253 ~~~~~~~~---~~~~~iL~IDEi~~l~~~~~~~g-------------~-----~~~~~~L~~~l--~~~~i~~I~at~~~  309 (854)
T 1qvr_A          253 AVIQEVVQ---SQGEVILFIDELHTVVGAGKAEG-------------A-----VDAGNMLKPAL--ARGELRLIGATTLD  309 (854)
T ss_dssp             HHHHHHHT---TCSSEEEEECCC-------------------------------------HHHH--HTTCCCEEEEECHH
T ss_pred             HHHHHHHh---cCCCeEEEEecHHHHhccCCccc-------------h-----HHHHHHHHHHH--hCCCeEEEEecCch
Confidence            99999986   25689999999999998875422             1     23468888887  68999999999999


Q ss_pred             HHHhhhhcCCcccccccceeeecCCCCcccc---c----------ccccccccccccccCCC-ccccCCCCCCccc-ccc
Q 003070          229 TYMKCQMRQPPLEIQWALQAVSIPSGGLGLS---L----------HSSSVHESRLTFSQNPS-QVWETKPFAIKEE-EDH  293 (850)
Q Consensus       229 eY~K~iekdPaLEr~W~LQ~V~Vps~~~~l~---l----------~~~s~~~~~~~~s~~~s-~v~~~~~l~~~~~-~~~  293 (850)
                      +|++ ++.+|+|.+||  |.|.|+.|+..-.   +          |+..+.+..+......+ .....+++++++. +-+
T Consensus       310 ~~~~-~~~d~aL~rRf--~~i~l~~p~~~e~~~iL~~~~~~~~~~~~~~i~~~al~~~~~ls~r~i~~~~lp~kai~lld  386 (854)
T 1qvr_A          310 EYRE-IEKDPALERRF--QPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLID  386 (854)
T ss_dssp             HHHH-HTTCTTTCSCC--CCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHH
T ss_pred             HHhh-hccCHHHHhCC--ceEEeCCCCHHHHHHHHHhhhhhhhhhcCCCCCHHHHHHHHHHHhhhcccccChHHHHHHHH
Confidence            9999 99999999975  6688877773100   0          11101011000000001 1123455554431 001


Q ss_pred             h--------hhcchHhhhhHHHHHHHHhccc----cccCC---CCcCcCcccchhhHHHHHHHHHHHHHHhhhhcccccc
Q 003070          294 K--------LNCCAECTSNYEEEAQLFKSGQ----KKLLP---PWLQPHSSSNANQKDELVEMRRKWNRSCHSLHQGRHT  358 (850)
Q Consensus       294 ~--------~~~c~~c~~~ye~E~~~~~~~~----~~~lP---~wLq~~~~~~~~~~~~~~~L~kkW~~~c~~lh~~~~~  358 (850)
                      .        ...++.+.+.+++++..+....    ...-+   ..+..........+.++..+..+|...|..++..+..
T Consensus       387 ea~a~~~~~~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  466 (854)
T 1qvr_A          387 EAAARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREA  466 (854)
T ss_dssp             HHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhhccCCchhHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            0        1122344444444333321110    00000   0000000011223455778999999998876643211


Q ss_pred             cccccc-ccccccccccccccccc----cCCCCccccccccccCchhhhhcccCCCCCchhhHHHhhcccccccccccCc
Q 003070          359 QSQFSS-NLYNNQSLTGKSCSYAS----TYPWWPSQSSIFLDSNSISFAESAMKPHNSSNSVAKFRRQQSCSTIEFNFGN  433 (850)
Q Consensus       359 ~~~~~~-~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~i~~~~r~~s~~t~e~~~~~  433 (850)
                      ...... ...  .........|..    .|..+|+...                      .+......+.  .      .
T Consensus       467 ~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~~~~~--~------~  514 (854)
T 1qvr_A          467 QHRLDEVRRE--IELAERQYDLNRAAELRYGELPKLEA----------------------EVEALSEKLR--G------A  514 (854)
T ss_dssp             HHHHHHHHHH--HHHHTTTTCHHHHHHHHTTHHHHHHH----------------------HHHHHHHHSS--S------C
T ss_pred             HHHHHHHhhh--HHHHHhcccHHHHHHHhhhhhHHHHH----------------------HHHHHHhhhc--c------c
Confidence            000000 000  000000000000    0000000000                      0000000000  0      0


Q ss_pred             CCCCCCCCccc--ccccccCCCcceeeecccCCCcCChhHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHhhhC-----
Q 003070          434 CTRKPQGVEPR--LDSLKSNEGKEVKITLALGNSELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSA-----  506 (850)
Q Consensus       434 ~~~~~~~v~~~--~~~~~~~~gi~v~t~l~lg~s~~~~~~~~~l~~L~~~L~~~V~gQ~eai~~Ia~av~~~r~g-----  506 (850)
                      .+. ..+++++  ...++.++|+|+.        ++...+.+++..|++.|.++|+||++++..|..+|.+.++|     
T Consensus       515 ~~~-~~~v~~~~l~~~v~~~~~ip~~--------~~~~~~~~~l~~l~~~l~~~viG~~~a~~~l~~~i~~~~~g~~~~~  585 (854)
T 1qvr_A          515 RFV-RLEVTEEDIAEIVSRWTGIPVS--------KLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPN  585 (854)
T ss_dssp             SSC-CSEECHHHHHHHHHTTSSCHHH--------HTTCCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSS
T ss_pred             ccc-cCCcCHHHHHHHHHHHhCCChH--------hhcHHHHHHHHHHHHHHhcccCCcHHHHHHHHHHHHHHhcccCCCC
Confidence            000 1112222  2245677887763        23344567788899999999999999999999999999986     


Q ss_pred             CCCeEEEEecCCchHHHHHHHHHHHHhcCCCCceEEecCccccC---------CCCCch-----hhHHHHhhhCCCEEEe
Q 003070          507 KKATWFLLQGNDTIGKRRLALSIAESVFGSTDLLFHIDMRKRND---------GVSSHS-----EMLMGTLKNYEKLVVL  572 (850)
Q Consensus       507 k~~~~~lf~Gp~gvGKt~lA~~LA~~lfgs~~~~i~idms~~~~---------~~~~~~-----~~l~e~vr~~P~sVvl  572 (850)
                      +|.+++||.||+|+|||.+|++||+.+|++...|+++||+++.+         .+++|+     +.|+++++++||+|||
T Consensus       586 ~p~~~vLl~Gp~GtGKT~lA~~la~~~~~~~~~~i~i~~~~~~~~~~~s~l~g~~~~~~G~~~~g~l~~~~~~~~~~vl~  665 (854)
T 1qvr_A          586 RPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVIL  665 (854)
T ss_dssp             SCSEEEEEBSCSSSSHHHHHHHHHHHHHSSGGGEEEECTTTCCSSGGGGGC--------------CHHHHHHHCSSEEEE
T ss_pred             CCceEEEEECCCCCCHHHHHHHHHHHhcCCCCcEEEEechhccchhHHHHHcCCCCCCcCccccchHHHHHHhCCCeEEE
Confidence            56699999999999999999999999999999999999998743         356676     4799999999999999


Q ss_pred             eccccccCHHHHHHHHhhhccCc----------cCceEEEEecC-CCchhhhhhhhcccccchhheecccCcccccchhh
Q 003070          573 VEDIDLADPQFIKILADGFETEN----------FGKVIFVLTKG-DSSNYEERIENQDSVINMTLKVNERNQNFDHKRKA  641 (850)
Q Consensus       573 ldeiekA~~~v~~~l~q~~d~G~----------l~n~Iii~Tsn-~~~~~~e~~~~~~~~~~l~l~~~~~~~~~~~krk~  641 (850)
                      |||||++|+++++.|+|+||+|+          |+|+||||||| ++..+...  .           ..   +   +. .
T Consensus       666 lDEi~~l~~~~~~~Ll~~l~~~~~~~~~g~~vd~~~~iiI~tsn~~~~~~~~~--~-----------~~---~---~~-~  725 (854)
T 1qvr_A          666 FDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEG--L-----------QK---G---WP-Y  725 (854)
T ss_dssp             ESSGGGSCHHHHHHHHHHHTTTEECCSSSCCEECTTEEEEEECCTTHHHHHHH--H-----------HT---T---CC-H
T ss_pred             EecccccCHHHHHHHHHHhccCceECCCCCEeccCCeEEEEecCcChHHHhhh--c-----------cc---c---cc-h
Confidence            99999999999999999999997          46999999999 44322110  0           00   0   00 0


Q ss_pred             hhhhhccCCCCCccccccccccccccccCCCcccccccCcccccccccccCCcCccCCCCCCCCCCCcccchhhcccCCC
Q 003070          642 EWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKDFSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPA  721 (850)
Q Consensus       642 ~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~kr~~~~~~s~~~lDLNl~a~e~e~~~~~~~~~~~~~~sd~~~e~~~~~~  721 (850)
                      +             +-+                                                     ..+.......
T Consensus       726 ~-------------~l~-----------------------------------------------------~~v~~~~~~~  739 (854)
T 1qvr_A          726 E-------------RIR-----------------------------------------------------DEVFKVLQQH  739 (854)
T ss_dssp             H-------------HHH-----------------------------------------------------HHHHHHHHTT
T ss_pred             H-------------HHH-----------------------------------------------------HHHHHHHHhh
Confidence            0             000                                                     0000011267


Q ss_pred             CCchhhhcccceEeccCCCCCchhHHHHHHHHHHHHHHHHHccCCceEEEeCHHHHHHHHhccCC---cchhHHHHHHHH
Q 003070          722 LSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMKESFDEIFKRQNKVNFSVEERVLEEVLIGSGF---FHNSLFEKWLKE  798 (850)
Q Consensus       722 ~~~efLnriD~~vvF~~l~~~~~~l~~~i~~~~~~~~~~~l~~~~~~~l~vd~~~~e~l~~~~~~---~~~r~le~wie~  798 (850)
                      |+|+|++|+|.+|+|.|++.  .++..++.. +...+.+.++.. ++.+.++++++++|+..+ |   .+.|++++.|+.
T Consensus       740 f~~~l~~Rl~~~i~~~pl~~--edi~~i~~~-~l~~~~~~~~~~-~~~~~~~~~a~~~L~~~~-~~~~gn~R~L~~~i~~  814 (854)
T 1qvr_A          740 FRPEFLNRLDEIVVFRPLTK--EQIRQIVEI-QLSYLRARLAEK-RISLELTEAAKDFLAERG-YDPVFGARPLRRVIQR  814 (854)
T ss_dssp             SCHHHHHTCSBCCBCCCCCH--HHHHHHHHH-HHHHHHHHHHTT-TCEEEECHHHHHHHHHHH-CBTTTBTSTHHHHHHH
T ss_pred             CCHHHHHhcCeEEeCCCCCH--HHHHHHHHH-HHHHHHHHHHhC-CceEEECHHHHHHHHHcC-CCCCCChHHHHHHHHH
Confidence            99999999999999999987  355444444 445677777655 388999999999999876 5   789999999999


Q ss_pred             HHhhHHHHHHhCCCC-CCceEEEe
Q 003070          799 VFQTSLEAVKIGGKG-GGIEIRLC  821 (850)
Q Consensus       799 vl~~~l~~~~~~g~~-~~~~v~L~  821 (850)
                      .+.+.+++..+.|+. .+..|++.
T Consensus       815 ~~~~~~~~~i~~~~~~~~~~~~~~  838 (854)
T 1qvr_A          815 ELETPLAQKILAGEVKEGDRVQVD  838 (854)
T ss_dssp             HTHHHHHHHHHHTSSCSSCEEEEE
T ss_pred             HHHHHHHHHHHhCcCCCCCEEEEE
Confidence            999999999999875 45566665
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 850
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 1e-07
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score = 52.0 bits (124), Expect = 1e-07
 Identities = 36/203 (17%), Positives = 78/203 (38%), Gaps = 29/203 (14%)

Query: 468 SDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKS-----AKKATWFLLQGNDTIGK 522
            +  KL R  L + L + V  Q ++I ++ + +   ++      +    FL  G   +GK
Sbjct: 9   GEREKLLR--LEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGK 66

Query: 523 RRLALSIAESVFGSTDLLFHIDMRKRNDGVSSHS--------------EMLMGTLKNYEK 568
             LA ++A ++F + + +  IDM +  +  +                   L   ++    
Sbjct: 67  TELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPY 126

Query: 569 LVVLVEDIDLADP----QFIKILADGFETENFGKVI----FVLTKGDSSNYEERIENQDS 620
            V+L ++I+ A P      ++IL DG  T++ G+ +     V+    +      +E    
Sbjct: 127 SVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQK 186

Query: 621 VINMTLKVNERNQNFDHKRKAEW 643
                   +E  +      + E+
Sbjct: 187 GWPYERIRDEVFKVLQQHFRPEF 209

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query850
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.87
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.44
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.24
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.21
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.13
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.09
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.06
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.06
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.04
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.02
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.0
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.88
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.86
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.85
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.84
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.76
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.74
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.68
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.67
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.57
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.55
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.37
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.24
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.17
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.15
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.14
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.14
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.12
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.06
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.74
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.74
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.72
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.61
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.34
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.15
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.03
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.9
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.83
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.03
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.83
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.72
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.54
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.46
d2qy9a2211 GTPase domain of the signal recognition particle r 95.34
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.3
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.26
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.17
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.15
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.12
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.09
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.09
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.95
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 94.95
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.93
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.76
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.74
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.74
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.68
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.61
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.57
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.48
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.41
d1okkd2207 GTPase domain of the signal recognition particle r 94.3
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.02
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.01
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.96
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.94
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.9
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.75
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.71
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.61
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.61
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.58
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.31
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.17
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.06
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.01
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.0
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.89
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.87
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.85
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.8
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.7
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.63
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.61
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.59
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.58
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.27
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.22
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.2
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.19
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.11
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.01
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.93
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.91
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.81
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.53
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 91.31
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.25
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.24
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.18
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.11
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.05
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.82
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.76
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.66
d1vmaa2213 GTPase domain of the signal recognition particle r 90.41
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 90.06
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 90.0
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.52
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.45
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 88.81
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.73
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.59
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.37
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 88.02
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 87.68
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.31
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.11
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.1
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 87.02
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.43
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.13
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.08
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 85.96
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 85.66
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.5
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.39
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 85.35
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 85.26
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.11
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.1
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 84.93
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.76
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.65
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 84.51
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.1
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 83.9
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 83.01
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 82.08
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 82.05
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 81.95
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 81.11
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 80.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 80.74
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 80.4
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 80.34
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.8e-43  Score=383.33  Aligned_cols=267  Identities=15%  Similarity=0.236  Sum_probs=214.5

Q ss_pred             cCChhHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHhhhC-----CCCeEEEEecCCchHHHHHHHHHHHHhcCCCCce
Q 003070          466 ELSDSAKLQRSDLYKVLQENVPWQFDSIHSIVEVLVECKSA-----KKATWFLLQGNDTIGKRRLALSIAESVFGSTDLL  540 (850)
Q Consensus       466 ~~~~~~~~~l~~L~~~L~~~V~gQ~eai~~Ia~av~~~r~g-----k~~~~~lf~Gp~gvGKt~lA~~LA~~lfgs~~~~  540 (850)
                      ++.+.++++|+.|++.|.++|+||++|+..|+.+|.++++|     ||.+||||+||||||||+||+.||+.|||+...|
T Consensus         5 ~~~~~~~~~l~~l~~~L~~~v~GQ~~ai~~v~~~i~~~~~~l~~~~kp~~~~lf~Gp~G~GKt~lak~la~~l~~~~~~~   84 (315)
T d1qvra3           5 KLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAM   84 (315)
T ss_dssp             HTTCCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHHHHHHSSGGGE
T ss_pred             hhhHHHHHHHHHHHHHhcCeEeCHHHHHHHHHHHHHHHhcCCCCCCCCceEEEEECCCcchHHHHHHHHHHHhcCCCcce
Confidence            56677889999999999999999999999999999999886     6889999999999999999999999999999999


Q ss_pred             EEecCccccC---------CCCCchh-----hHHHHhhhCCCEEEeeccccccCHHHHHHHHhhhccCcc----------
Q 003070          541 FHIDMRKRND---------GVSSHSE-----MLMGTLKNYEKLVVLVEDIDLADPQFIKILADGFETENF----------  596 (850)
Q Consensus       541 i~idms~~~~---------~~~~~~~-----~l~e~vr~~P~sVvlldeiekA~~~v~~~l~q~~d~G~l----------  596 (850)
                      +++||++|.+         ++|||+|     .|+++|+++||+|||||||||||++|++.|+|++|+|++          
T Consensus        85 ~~~~~~~~~~~~~~~~L~g~~~gyvG~~~~~~l~~~~~~~p~~Vvl~DEieK~~~~v~~~ll~~l~~g~~~~~~gr~v~~  164 (315)
T d1qvra3          85 IRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDF  164 (315)
T ss_dssp             EEECTTTCCSSGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEECCSSSCCEEC
T ss_pred             EEEeccccccchhhhhhcCCCCCCcCcccCChHHHHHHhCCCcEEEEehHhhcCHHHHHHHHHHhccCceeCCCCcEecC
Confidence            9999999843         4689987     599999999999999999999999999999999999985          


Q ss_pred             CceEEEEecC-CCchhhhhhhhcccccchhheecccCcccccchhhhhhhhccCCCCCccccccccccccccccCCCccc
Q 003070          597 GKVIFVLTKG-DSSNYEERIENQDSVINMTLKVNERNQNFDHKRKAEWEFANKTKSPRIDEKEDATSVTIDNVSSGNKKD  675 (850)
Q Consensus       597 ~n~Iii~Tsn-~~~~~~e~~~~~~~~~~l~l~~~~~~~~~~~krk~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~kr~  675 (850)
                      +|+||||||| |+.........                   .+.  ..            ..+                 
T Consensus       165 ~~~i~i~tsnlG~~~i~~~~~~-------------------~~~--~~------------~~~-----------------  194 (315)
T d1qvra3         165 RNTVIILTSNLGSPLILEGLQK-------------------GWP--YE------------RIR-----------------  194 (315)
T ss_dssp             TTEEEEEECCTTHHHHHHHHHT-------------------TCC--HH------------HHH-----------------
T ss_pred             cceEEEEecccChHHHhhhccc-------------------ccc--hh------------hhh-----------------
Confidence            4999999999 65433211000                   000  00            000                 


Q ss_pred             ccccCcccccccccccCCcCccCCCCCCCCCCCcccchhhcccCCCCCchhhhcccceEeccCCCCCchhHHHHHHHHHH
Q 003070          676 FSRQSSFNTLDLNMKADDEDDEGEQKPGELSPISSDLTRENITNPALSNGFLDLIQNRFVFNRNSSNDGKITGLFLAKMK  755 (850)
Q Consensus       676 ~~~~~s~~~lDLNl~a~e~e~~~~~~~~~~~~~~sd~~~e~~~~~~~~~efLnriD~~vvF~~l~~~~~~l~~~i~~~~~  755 (850)
                                                          ..........|.|||+||||++|+|+|++.  +++.+++.. ..
T Consensus       195 ------------------------------------~~~~~~l~~~f~pEflnRid~Ii~F~~L~~--~~~~~I~~~-~l  235 (315)
T d1qvra3         195 ------------------------------------DEVFKVLQQHFRPEFLNRLDEIVVFRPLTK--EQIRQIVEI-QL  235 (315)
T ss_dssp             ------------------------------------HHHHHHHHTTSCHHHHHTCSBCCBCCCCCH--HHHHHHHHH-HH
T ss_pred             ------------------------------------HHHHHHHHhhcCHHHHhcCCeeeeccchhh--hhhHHHHHH-HH
Confidence                                                000011136899999999999999999998  466555544 45


Q ss_pred             HHHHHHHccCCceEEEeCHHHHHHHHhcc--CCcchhHHHHHHHHHHhhHHHHHHhCCCC-CCceEEEee
Q 003070          756 ESFDEIFKRQNKVNFSVEERVLEEVLIGS--GFFHNSLFEKWLKEVFQTSLEAVKIGGKG-GGIEIRLCF  822 (850)
Q Consensus       756 ~~~~~~l~~~~~~~l~vd~~~~e~l~~~~--~~~~~r~le~wie~vl~~~l~~~~~~g~~-~~~~v~L~~  822 (850)
                      ..+.+++... ++.+.++++|+++|+..+  ..+|+|+++|-|++.+.++|++..+.++. .+..|++..
T Consensus       236 ~~l~~rl~~~-~i~l~i~~~~~~~L~~~~y~~~~GAR~L~r~Ie~~i~~~La~~iL~~~~~~g~~i~i~~  304 (315)
T d1qvra3         236 SYLRARLAEK-RISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDV  304 (315)
T ss_dssp             HHHHHHHHTT-TCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEEC
T ss_pred             HHHHHHHHhc-cccccccHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEEE
Confidence            6677777665 399999999999999886  24799999999999999999999998875 566788764
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure