Citrus Sinensis ID: 003088

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------85
MEVSTCSPLSVNSRCLFANQPPPPRHRLPPLQYVNPMSSFFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHcccEEEEEccccHHHccccccccccccHHHHccccccccccccHHHHccccHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHHHHHHHcccccccEEccccccccHHHHHHccccccccccccccccHHHHHcccccEEEEcHHHHccccHHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHcccccc
ccEcccccccccccEEEccccccccccccccccccccHHHccccEEEEcccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHcccEEEEEEHHHHHHcccccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHccccccccccccHHHHHHHHHHHHHHcHHHHHcHccHHHHHHHHHHHHHHHHcccccEcccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHcccHccEEEEcHHHHHHHHcHHHHcccccccccccccccccHHHcccccEEEEHHHHHHHcHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHcHEEEEccccHHHHHHHHcc
mevstcsplsvnsrclfanqpppprhrlpplqyvnpmssffNISMISHKVQFFHSnytsnnnncnpicarkrrkiipissVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIaedrhpngflesgiTIDKAREAVVSIWHstnnqdtddaaaqgkpfssaakmpfsiSTKRVFEAAVEYSRsrgynfiapehialglftvddgsagRVLKRLGVDVNHLAAVAVSRLQGElakegrepslakgvrensisgktaalkspgrtrASALEQFCVDLTARAseelidpvigrETEIQRIIQILCRrtknnpillgesgvgKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLigsgtvgrgnkgtgldisnllkpslgrgelqciASTTQDEHRTQFEKDKALARrfqpvlisepsqEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARyisdrylpdkAIDLVDEAGSRAHIELFKRKKEqqtcilskppddywQEIRTVQAMHEVVQGSRLKYDDVVAsmgdtseivvesslpsasdddepavvgpddIAAVASLwsgipvqqiTADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRsrvglkdpnrptaamlfcgptgvgkTELAKSLAAcyfgsessmlrLDMSEYMERHTVskligsppgyvgyeegglLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVfedghltdshgrrvsFKNALIVMTSNvgsttiakgrhgsigfllednestsyaGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAqvcqlpli
mevstcsplsvnsrcLFANQPPPPRHRLPPLQYVNPMSSFFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHstnnqdtddaaaqgkpfssaakmpfsiSTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRlqgelakegrepslakgvrensisgktaalkspgrtrASALEQFCVDLTARASeelidpvigretEIQRIIQILCrrtknnpillgesgVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIgsgtvgrgnkgtglDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRfqpvlisepsqedAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIElfkrkkeqqtcilskppddYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVesslpsasdddEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAIsravkrsrvglkdpnrptaAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSnvgsttiakgrhgSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEkaqvcqlpli
MEVSTCSPLSVNSRCLFANQpppprhrlpplQYVNPMSSFFNISMISHKVQFFHSNYTSnnnncnPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
******************************LQYVNPMSSFFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWH**************************ISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRL***************************************LEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIA********************FQPVLI******DAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASM***********************VGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKR**V*******PTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQ****
*************************************************VQFFH**************************VFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWH**************************ISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRL*****************************************QFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHI********************************EVV*GS***********************************GPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRH**********************VEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
*********SVNSRCLFANQPPPPRHRLPPLQYVNPMSSFFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIAST*********EKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIV*************PAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
*****CSPLSVNSRCLFANQPPPPRHRLPPLQYVNPMSSFFNISMISHKVQFFHSNYTSN**************IIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQG**********************************ASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGR*NKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVSTCSPLSVNSRCLFANQPPPPRHRLPPLQYVNPMSSFFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query849 2.2.26 [Sep-21-2011]
P42762945 Chaperone protein ClpD, c yes no 0.944 0.848 0.755 0.0
Q7XL03937 Chaperone protein ClpD2, yes no 0.897 0.813 0.671 0.0
Q6H795938 Chaperone protein ClpD1, yes no 0.885 0.801 0.677 0.0
Q9TM05854 ATP-dependent Clp proteas N/A no 0.861 0.855 0.463 0.0
P35100922 Chaperone protein ClpC, c N/A no 0.899 0.828 0.480 0.0
Q1XDF4821 ATP-dependent Clp proteas N/A no 0.849 0.878 0.481 0.0
O78410819 ATP-dependent Clp proteas yes no 0.850 0.881 0.484 0.0
P51332821 ATP-dependent Clp proteas N/A no 0.849 0.878 0.481 0.0
Q9FI56 929 Chaperone protein ClpC1, no no 0.877 0.801 0.481 0.0
P31541926 ATP-dependent Clp proteas N/A no 0.856 0.785 0.493 0.0
>sp|P42762|CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana GN=CLPD PE=1 SV=1 Back     alignment and function desciption
 Score = 1240 bits (3208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/809 (75%), Positives = 694/809 (85%), Gaps = 7/809 (0%)

Query: 40  FFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQRE 99
           +  IS+ +  +  F +  T    N      RKR+K  PIS+VFERFTERA++A+IFSQ+E
Sbjct: 42  YLGISLSNRTIHRFSTTPT----NLRRFPQRKRKKFTPISAVFERFTERAIRAIIFSQKE 97

Query: 100 AKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQ 159
           AKSLGKDMV+TQHLLLGLIAEDR P GFL SGITIDKAREAV SIW   N+ D+    A 
Sbjct: 98  AKSLGKDMVYTQHLLLGLIAEDRDPQGFLGSGITIDKAREAVWSIWDEANS-DSKQEEAS 156

Query: 160 GKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLG 219
              +S +  MPFSISTKRVFEAAVEYSR+    +IAPEHIA+GLFTVDDGSAGRVLKRLG
Sbjct: 157 STSYSKSTDMPFSISTKRVFEAAVEYSRTMDCQYIAPEHIAVGLFTVDDGSAGRVLKRLG 216

Query: 220 VDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSI-SGKTAALKSPGRTRASALEQFCV 278
            ++N L A A++RL+GE+AK+GREPS +      S  SG+ A     G+   + LEQFCV
Sbjct: 217 ANMNLLTAAALTRLKGEIAKDGREPSSSSKGSFESPPSGRIAGSGPGGKKAKNVLEQFCV 276

Query: 279 DLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQA 338
           DLTARASE LIDPVIGRE E+QR+IQILCRRTKNNPILLGE+GVGKTAIAEGLAI I +A
Sbjct: 277 DLTARASEGLIDPVIGREKEVQRVIQILCRRTKNNPILLGEAGVGKTAIAEGLAISIAEA 336

Query: 339 EVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSG 398
             P FLL+KRIMSLD+GLLMAGAKERGELEARVT LISE++KSG VILFIDEVHTLIGSG
Sbjct: 337 SAPGFLLTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGSG 396

Query: 399 TVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPS 458
           TVGRGNKG+GLDI+NLLKPSLGRGELQCIASTT DE R+QFEKDKALARRFQPVLI+EPS
Sbjct: 397 TVGRGNKGSGLDIANLLKPSLGRGELQCIASTTLDEFRSQFEKDKALARRFQPVLINEPS 456

Query: 459 QEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAH 518
           +EDAV+ILLGLREKYEAHHNCK+T+EAI+AAV+LS+RYI+DR+LPDKAIDL+DEAGSRA 
Sbjct: 457 EEDAVKILLGLREKYEAHHNCKYTMEAIDAAVYLSSRYIADRFLPDKAIDLIDEAGSRAR 516

Query: 519 IELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVES 578
           IE F++KKE   CILSKPP+DYWQEI+TVQAMHEVV  SR K DD  A   ++ E+V ES
Sbjct: 517 IEAFRKKKEDAICILSKPPNDYWQEIKTVQAMHEVVLSSRQKQDDGDAISDESGELVEES 576

Query: 579 SLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAV 638
           SLP A+ DDEP +VGPDDIAAVAS+WSGIPVQQITADERMLL+ LE+QL+ RV+GQDEAV
Sbjct: 577 SLPPAAGDDEPILVGPDDIAAVASVWSGIPVQQITADERMLLMSLEDQLRGRVVGQDEAV 636

Query: 639 AAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEY 698
           AAISRAVKRSRVGLKDP+RP AAMLFCGPTGVGKTEL K+LAA YFGSE SMLRLDMSEY
Sbjct: 637 AAISRAVKRSRVGLKDPDRPIAAMLFCGPTGVGKTELTKALAANYFGSEESMLRLDMSEY 696

Query: 699 MERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDG 758
           MERHTVSKLIGSPPGYVG+EEGG+LTEAIRRRPFT++L DEIEKAHPDIFNILLQ+FEDG
Sbjct: 697 MERHTVSKLIGSPPGYVGFEEGGMLTEAIRRRPFTVVLFDEIEKAHPDIFNILLQLFEDG 756

Query: 759 HLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDN-ESTSYAGMKTLVVEEL 817
           HLTDS GRRVSFKNALI+MTSNVGS  IAKGRHGSIGF+L+D+ E+ SY GMK LVVEEL
Sbjct: 757 HLTDSQGRRVSFKNALIIMTSNVGSLAIAKGRHGSIGFILDDDEEAASYTGMKALVVEEL 816

Query: 818 KAYFRPELLNRIDEVVVFRSLEKAQVCQL 846
           K YFRPELLNRIDE+V+FR LEKAQ+ ++
Sbjct: 817 KNYFRPELLNRIDEIVIFRQLEKAQMMEI 845
Molecular chaperone that may interact with a clpP-like protease involved in degradation of denatured proteins in the chloroplast.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XL03|CLPD2_ORYSJ Chaperone protein ClpD2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPD2 PE=2 SV=2 Back     alignment and function description
>sp|Q6H795|CLPD1_ORYSJ Chaperone protein ClpD1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPD1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TM05|CLPC_CYACA ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Cyanidium caldarium GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|P35100|CLPC_PEA Chaperone protein ClpC, chloroplastic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q1XDF4|CLPC_PORYE ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Porphyra yezoensis GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|O78410|CLPC_GUITH ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Guillardia theta GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|P51332|CLPC_PORPU ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Porphyra purpurea GN=clpC PE=3 SV=1 Back     alignment and function description
>sp|Q9FI56|CLPC1_ARATH Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana GN=CLPC1 PE=1 SV=1 Back     alignment and function description
>sp|P31541|CLPAA_SOLLC ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic OS=Solanum lycopersicum GN=CD4A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query849
387169509946 hypothetical protein 11M19.14 [Arabidops 0.944 0.847 0.759 0.0
224119914948 predicted protein [Populus trichocarpa] 0.948 0.849 0.754 0.0
387169538943 hypothetical protein 7G9.17 [Boechera st 0.944 0.850 0.758 0.0
297792419946 hypothetical protein ARALYDRAFT_495173 [ 0.944 0.847 0.754 0.0
312282443 950 unnamed protein product [Thellungiella h 0.988 0.883 0.724 0.0
18423233945 ERD1 protein [Arabidopsis thaliana] gi|1 0.944 0.848 0.755 0.0
255539981946 ERD1 protein, chloroplast precursor, put 0.939 0.843 0.749 0.0
387169561945 hypothetical protein 34G24.25 [Capsella 0.944 0.848 0.751 0.0
224134250939 predicted protein [Populus trichocarpa] 0.932 0.843 0.741 0.0
359493969946 PREDICTED: chaperone protein ClpD, chlor 0.930 0.835 0.745 0.0
>gi|387169509|gb|AFJ66170.1| hypothetical protein 11M19.14 [Arabidopsis halleri] Back     alignment and taxonomy information
 Score = 1253 bits (3243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/810 (75%), Positives = 699/810 (86%), Gaps = 8/810 (0%)

Query: 40  FFNISMISHKVQFFHSNYTSNNNNCNPICARKRRKIIPISSVFERFTERAVKAVIFSQRE 99
           +  IS+ +  +  F S  T    N      RKR+K  PIS+VFERFTERA++A+IFSQ+E
Sbjct: 42  YLGISLSNRTIHRFSSTPT----NFRRFPQRKRKKFTPISAVFERFTERAIRAIIFSQKE 97

Query: 100 AKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQ 159
           AKSLGKDMV+TQHLLLGLIAEDR P GFL SGITIDKAREAV SIW   N+ D+      
Sbjct: 98  AKSLGKDMVYTQHLLLGLIAEDRDPQGFLGSGITIDKAREAVWSIWDEANS-DSKQEEVS 156

Query: 160 GKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLG 219
              +S +  MPFSISTKRVFEAAVEYSR+    +IAPEHIA+GLFTVDDGSAGRVLKRLG
Sbjct: 157 STSYSKSTDMPFSISTKRVFEAAVEYSRTMDCQYIAPEHIAVGLFTVDDGSAGRVLKRLG 216

Query: 220 VDVNHLAAVAVSRLQGELAKEGREPSLA-KGVRENSISGKTAALKSPGRTRA-SALEQFC 277
            ++N L A A++RL+GE+AK+GREPS + KG  E   SG+     + G+ +A + LEQFC
Sbjct: 217 ANMNLLTAAALTRLKGEIAKDGREPSSSSKGSYEAPPSGRIVGSGTGGKAKAKTVLEQFC 276

Query: 278 VDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQ 337
           VDLTARASE LIDPVIGRE E+QR+IQILCRRTKNNPILLGE+GVGKTAIAEGLAI I +
Sbjct: 277 VDLTARASEGLIDPVIGREKEVQRVIQILCRRTKNNPILLGEAGVGKTAIAEGLAISIAE 336

Query: 338 AEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGS 397
           A+ P FLL+KRIMSLD+GLLMAGAKERGELEARVT LISE++KSG VILFIDEVHTLIGS
Sbjct: 337 AKAPGFLLTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGS 396

Query: 398 GTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEP 457
           GTVGRGNKG+GLDI+NLLKPSLGRGELQCIASTT DE R+QFEKDKALARRFQPVLI+EP
Sbjct: 397 GTVGRGNKGSGLDIANLLKPSLGRGELQCIASTTLDEFRSQFEKDKALARRFQPVLINEP 456

Query: 458 SQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRA 517
           S+EDAV+ILLGLREKYEAHHNCK+T+EAI+AAV+LS+RYI+DR+LPDKAIDL+DEAGSRA
Sbjct: 457 SEEDAVKILLGLREKYEAHHNCKYTMEAIDAAVYLSSRYIADRFLPDKAIDLIDEAGSRA 516

Query: 518 HIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVE 577
            IE F++KKE   CILSKPP+DYWQEI+TVQAMHEVV  SR K DD  A   ++ E+V E
Sbjct: 517 RIEAFRKKKEDAICILSKPPNDYWQEIKTVQAMHEVVLSSRQKQDDGDAIADESGELVEE 576

Query: 578 SSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEA 637
           SSLP AS DDEP +VGPDDIAAVAS WSGIPVQQITADERMLL+GLE+QL+ RV+GQDEA
Sbjct: 577 SSLPPASGDDEPILVGPDDIAAVASAWSGIPVQQITADERMLLMGLEDQLRSRVVGQDEA 636

Query: 638 VAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSE 697
           VAAISRAVKRSRVGLKDP+RP AAMLFCGPTGVGKTEL K+LAA YFGSE SMLRLDMSE
Sbjct: 637 VAAISRAVKRSRVGLKDPDRPIAAMLFCGPTGVGKTELTKALAANYFGSEESMLRLDMSE 696

Query: 698 YMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFED 757
           YMERHTVSKLIGSPPGYVG+EEGG+LTEAIRRRPFT++L DEIEKAHPDIFNILLQ+FED
Sbjct: 697 YMERHTVSKLIGSPPGYVGFEEGGMLTEAIRRRPFTVVLFDEIEKAHPDIFNILLQLFED 756

Query: 758 GHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDN-ESTSYAGMKTLVVEE 816
           GHLTDS GRRVSFKNALI+MTSNVGS+ IAKGRHGSIGF+L+D+ E+ SY GMK LVVEE
Sbjct: 757 GHLTDSQGRRVSFKNALIIMTSNVGSSAIAKGRHGSIGFILDDDEEAASYTGMKALVVEE 816

Query: 817 LKAYFRPELLNRIDEVVVFRSLEKAQVCQL 846
           LK YFRPELLNRIDE+V+FR LEKAQ+ ++
Sbjct: 817 LKNYFRPELLNRIDEIVIFRQLEKAQMMEI 846

Source: Arabidopsis halleri

Species: Arabidopsis halleri

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224119914|ref|XP_002318194.1| predicted protein [Populus trichocarpa] gi|222858867|gb|EEE96414.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|387169538|gb|AFJ66198.1| hypothetical protein 7G9.17 [Boechera stricta] Back     alignment and taxonomy information
>gi|297792419|ref|XP_002864094.1| hypothetical protein ARALYDRAFT_495173 [Arabidopsis lyrata subsp. lyrata] gi|297309929|gb|EFH40353.1| hypothetical protein ARALYDRAFT_495173 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|312282443|dbj|BAJ34087.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|18423233|ref|NP_568750.1| ERD1 protein [Arabidopsis thaliana] gi|1169544|sp|P42762.1|CLPD_ARATH RecName: Full=Chaperone protein ClpD, chloroplastic; AltName: Full=ATP-dependent Clp protease ATP-binding subunit ClpD homolog; AltName: Full=Casein lytic proteinase D; AltName: Full=ERD1 protein; AltName: Full=Protein EARLY RESPONSIVE TO DEHYDRATION 1; AltName: Full=Protein SENESCENCE ASSOCIATED GENE 15; Flags: Precursor gi|497629|dbj|BAA04506.1| ERD1 protein [Arabidopsis thaliana] gi|10177198|dbj|BAB10330.1| Erd1 protein precursor [Arabidopsis thaliana] gi|14334878|gb|AAK59617.1| putative ATP-dependent Clp protease ATP-binding subunit ClpD, ERD1 protein precursor [Arabidopsis thaliana] gi|22136916|gb|AAM91802.1| putative ATP-dependent Clp protease ATP-binding subunit ClpD, ERD1 protein precursor [Arabidopsis thaliana] gi|332008646|gb|AED96029.1| ERD1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255539981|ref|XP_002511055.1| ERD1 protein, chloroplast precursor, putative [Ricinus communis] gi|223550170|gb|EEF51657.1| ERD1 protein, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|387169561|gb|AFJ66220.1| hypothetical protein 34G24.25 [Capsella rubella] Back     alignment and taxonomy information
>gi|224134250|ref|XP_002321773.1| predicted protein [Populus trichocarpa] gi|222868769|gb|EEF05900.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493969|ref|XP_002283802.2| PREDICTED: chaperone protein ClpD, chloroplastic-like [Vitis vinifera] gi|147770910|emb|CAN67541.1| hypothetical protein VITISV_012383 [Vitis vinifera] gi|302142786|emb|CBI20081.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query849
TAIR|locus:2157363945 ERD1 "EARLY RESPONSIVE TO DEHY 0.990 0.889 0.737 0.0
UNIPROTKB|Q6H795938 CLPD1 "Chaperone protein ClpD1 0.899 0.814 0.673 1.6e-269
TAIR|locus:2099433 952 HSP93-III [Arabidopsis thalian 0.689 0.614 0.539 6e-185
TAIR|locus:2157383 929 CLPC1 "CLPC homologue 1" [Arab 0.665 0.608 0.550 8.7e-184
UNIPROTKB|Q81VV9811 BAS0081 "Negative regulator of 0.704 0.737 0.500 1.4e-170
TIGR_CMR|BA_0080811 BA_0080 "negative regulator of 0.704 0.737 0.500 1.4e-170
TIGR_CMR|DET_0057824 DET_0057 "ATP-dependent Clp pr 0.669 0.689 0.518 3.8e-168
UNIPROTKB|Q724I0820 LMOf2365_0244 "ClpC ATPase" [L 0.658 0.681 0.510 2e-162
UNIPROTKB|Q3A9N1811 CHY_2348 "Negative regulator o 0.679 0.711 0.512 5.8e-153
TIGR_CMR|CHY_2348811 CHY_2348 "negative regulator o 0.679 0.711 0.512 5.8e-153
TAIR|locus:2157363 ERD1 "EARLY RESPONSIVE TO DEHYDRATION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3115 (1101.6 bits), Expect = 0., P = 0.
 Identities = 627/850 (73%), Positives = 717/850 (84%)

Query:     1 MEV-STCSPLSVNS-RCLFANQXXXXXXXXXXXQYVNPMSSFFNISMISHKVQFFHSNYT 58
             MEV ST SPL+++S R L A+               +  SS+  IS+ +  +  F +  T
Sbjct:     1 MEVLSTSSPLTLHSHRLLSASSSSSHVTSIAASSLSSFASSYLGISLSNRTIHRFSTTPT 60

Query:    59 SXXXXXXPICARKRRKIIPISSVFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLI 118
             +      P   RKR+K  PIS+VFERFTERA++A+IFSQ+EAKSLGKDMV+TQHLLLGLI
Sbjct:    61 NLRRF--P--QRKRKKFTPISAVFERFTERAIRAIIFSQKEAKSLGKDMVYTQHLLLGLI 116

Query:   119 AEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRV 178
             AEDR P GFL SGITIDKAREAV SIW   N+ D+    A    +S +  MPFSISTKRV
Sbjct:   117 AEDRDPQGFLGSGITIDKAREAVWSIWDEANS-DSKQEEASSTSYSKSTDMPFSISTKRV 175

Query:   179 FEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELA 238
             FEAAVEYSR+    +IAPEHIA+GLFTVDDGSAGRVLKRLG ++N L A A++RL+GE+A
Sbjct:   176 FEAAVEYSRTMDCQYIAPEHIAVGLFTVDDGSAGRVLKRLGANMNLLTAAALTRLKGEIA 235

Query:   239 KEGREPSLA-KGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRET 297
             K+GREPS + KG  E+  SG+ A     G+   + LEQFCVDLTARASE LIDPVIGRE 
Sbjct:   236 KDGREPSSSSKGSFESPPSGRIAGSGPGGKKAKNVLEQFCVDLTARASEGLIDPVIGREK 295

Query:   298 EIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLL 357
             E+QR+IQILCRRTKNNPILLGE+GVGKTAIAEGLAI I +A  P FLL+KRIMSLD+GLL
Sbjct:   296 EVQRVIQILCRRTKNNPILLGEAGVGKTAIAEGLAISIAEASAPGFLLTKRIMSLDIGLL 355

Query:   358 MAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKP 417
             MAGAKERGELEARVT LISE++KSG VILFIDEVHTLIGSGTVGRGNKG+GLDI+NLLKP
Sbjct:   356 MAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKP 415

Query:   418 SLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHH 477
             SLGRGELQCIASTT DE R+QFEKDKALARRFQPVLI+EPS+EDAV+ILLGLREKYEAHH
Sbjct:   416 SLGRGELQCIASTTLDEFRSQFEKDKALARRFQPVLINEPSEEDAVKILLGLREKYEAHH 475

Query:   478 NCKFTLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPP 537
             NCK+T+EAI+AAV+LS+RYI+DR+LPDKAIDL+DEAGSRA IE F++KKE   CILSKPP
Sbjct:   476 NCKYTMEAIDAAVYLSSRYIADRFLPDKAIDLIDEAGSRARIEAFRKKKEDAICILSKPP 535

Query:   538 DDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDI 597
             +DYWQEI+TVQAMHEVV  SR K DD  A   ++ E+V ESSLP A+ DDEP +VGPDDI
Sbjct:   536 NDYWQEIKTVQAMHEVVLSSRQKQDDGDAISDESGELVEESSLPPAAGDDEPILVGPDDI 595

Query:   598 AAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNR 657
             AAVAS+WSGIPVQQITADERMLL+ LE+QL+ RV+GQDEAVAAISRAVKRSRVGLKDP+R
Sbjct:   596 AAVASVWSGIPVQQITADERMLLMSLEDQLRGRVVGQDEAVAAISRAVKRSRVGLKDPDR 655

Query:   658 PTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGY 717
             P AAMLFCGPTGVGKTEL K+LAA YFGSE SMLRLDMSEYMERHTVSKLIGSPPGYVG+
Sbjct:   656 PIAAMLFCGPTGVGKTELTKALAANYFGSEESMLRLDMSEYMERHTVSKLIGSPPGYVGF 715

Query:   718 EEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVM 777
             EEGG+LTEAIRRRPFT++L DEIEKAHPDIFNILLQ+FEDGHLTDS GRRVSFKNALI+M
Sbjct:   716 EEGGMLTEAIRRRPFTVVLFDEIEKAHPDIFNILLQLFEDGHLTDSQGRRVSFKNALIIM 775

Query:   778 TSNVGSTTIAKGRHGSIGFLLEDNE-STSYAGMKTLVVEELKAYFRPELLNRIDEVVVFR 836
             TSNVGS  IAKGRHGSIGF+L+D+E + SY GMK LVVEELK YFRPELLNRIDE+V+FR
Sbjct:   776 TSNVGSLAIAKGRHGSIGFILDDDEEAASYTGMKALVVEELKNYFRPELLNRIDEIVIFR 835

Query:   837 SLEKAQVCQL 846
              LEKAQ+ ++
Sbjct:   836 QLEKAQMMEI 845
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016887 "ATPase activity" evidence=ISS;IDA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0019538 "protein metabolic process" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA;TAS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0034214 "protein hexamerization" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0009646 "response to absence of light" evidence=RCA
UNIPROTKB|Q6H795 CLPD1 "Chaperone protein ClpD1, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2099433 HSP93-III [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157383 CLPC1 "CLPC homologue 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q81VV9 BAS0081 "Negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0080 BA_0080 "negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0057 DET_0057 "ATP-dependent Clp protease, ATP-binding subunit ClpC" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q724I0 LMOf2365_0244 "ClpC ATPase" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|Q3A9N1 CHY_2348 "Negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2348 CHY_2348 "negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P24428CLPC_MYCLENo assigned EC number0.42690.85150.8525yesno
Q2YSD6CLPC_STAABNo assigned EC number0.43890.82560.8569yesno
Q9PKA8CLPC_CHLMUNo assigned EC number0.40760.85860.8379yesno
Q2G0P5CLPC_STAA8No assigned EC number0.44470.83510.8667yesno
Q6H795CLPD1_ORYSJNo assigned EC number0.67780.88570.8017yesno
P37571CLPC_BACSUNo assigned EC number0.46820.84330.8839yesno
P0A522CLPC_MYCTUNo assigned EC number0.43070.85150.8525yesno
P0A523CLPC_MYCBONo assigned EC number0.43070.85150.8525yesno
P42762CLPD_ARATHNo assigned EC number0.75520.94460.8486yesno
Q8NXY8CLPC_STAAWNo assigned EC number0.44340.83510.8667yesno
Q99W78CLPC_STAAMNo assigned EC number0.44470.83510.8667yesno
Q4L3I4CLPC_STAHJNo assigned EC number0.42920.82680.8519yesno
Q7XL03CLPD2_ORYSJNo assigned EC number0.67170.89750.8132yesno
Q9A9T4CLPB_CAUCRNo assigned EC number0.42680.82920.8195yesno
Q8EU05CLPB_OCEIHNo assigned EC number0.46540.83740.8788yesno
Q54316HLYB_TREHYNo assigned EC number0.42680.84450.8659yesno
Q9RVI3CLPB_DEIRANo assigned EC number0.41610.81620.8133yesno
Q8CQ88CLPC_STAESNo assigned EC number0.42740.82560.8580yesno
Q7A797CLPC_STAANNo assigned EC number0.44470.83510.8667yesno
Q6GJE4CLPC_STAARNo assigned EC number0.44470.83510.8667yesno
P0C281CLPC_STAACNo assigned EC number0.44470.83510.8667yesno
O78410CLPC_GUITHNo assigned EC number0.48450.85040.8815yesno
Q5HRM8CLPC_STAEQNo assigned EC number0.42740.82560.8580yesno
Q73IE4CLPB_WOLPMNo assigned EC number0.39340.83740.8335yesno
Q49V34CLPC_STAS1No assigned EC number0.42690.84090.8707yesno
Q6GBW3CLPC_STAASNo assigned EC number0.44470.83510.8667yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_XII001082
hypothetical protein (948 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query849
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.0
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.0
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 1e-175
TIGR03346 852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 1e-121
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 1e-120
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 8e-82
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-18
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-17
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-13
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 4e-11
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 4e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 7e-10
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 1e-08
pfam00004131 pfam00004, AAA, ATPase family associated with vari 5e-07
pfam13401124 pfam13401, AAA_22, AAA domain 1e-06
TIGR02397 355 TIGR02397, dnaX_nterm, DNA polymerase III, subunit 3e-06
TIGR02902 531 TIGR02902, spore_lonB, ATP-dependent protease LonB 5e-06
pfam00004131 pfam00004, AAA, ATPase family associated with vari 8e-06
COG3899 849 COG3899, COG3899, Predicted ATPase [General functi 2e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 2e-04
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 7e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.001
PRK05342 412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.001
TIGR00390 441 TIGR00390, hslU, ATP-dependent protease HslVU, ATP 0.001
COG1220 444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 0.001
TIGR02640262 TIGR02640, gas_vesic_GvpN, gas vesicle protein Gvp 0.001
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.002
PRK09183259 PRK09183, PRK09183, transposase/IS protein; Provis 0.002
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 0.003
PRK14956 484 PRK14956, PRK14956, DNA polymerase III subunits ga 0.004
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  824 bits (2130), Expect = 0.0
 Identities = 342/760 (45%), Positives = 459/760 (60%), Gaps = 63/760 (8%)

Query: 84  RFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVS 143
           + TERA KA+  +Q  A+    + V  +HLLL L+ + +        GI +DK R+ +  
Sbjct: 1   KLTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGDELLNLCGIDLDKLRQEL-- 58

Query: 144 IWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGL 203
                     ++   +      +  +   +  KRV E A   ++S G  +++ EH+ L L
Sbjct: 59  ----------EEFIDKLPKVLGSPYLSPRL--KRVLERAWLLAQSLGDEYVSTEHLLLAL 106

Query: 204 FTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTAALK 263
               +  A  +LK+LGV    +  +                          + G      
Sbjct: 107 LNEPESVAAYILKKLGVTRKDVEELI-----------------------EELRGGNEVDS 143

Query: 264 SPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVG 323
                   ALE++  DLT  A E  +DPVIGR+ EI+R IQIL RRTKNNP+L+GE GVG
Sbjct: 144 KNAEEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVG 203

Query: 324 KTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGD 383
           KTAI EGLA RIV  +VP  L  KRI SLD+G L+AGAK RGE E R+  ++ E++KS +
Sbjct: 204 KTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSKN 263

Query: 384 VILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDK 443
           VILFIDE+HT++G+G      +G  +D +NLLKP+L RGEL+CI +TT DE+R   EKD 
Sbjct: 264 VILFIDEIHTIVGAG----ATEGGAMDAANLLKPALARGELRCIGATTLDEYRKYIEKDA 319

Query: 444 ALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLP 503
           AL RRFQ VL+ EPS ED + IL GL+E+YEAHH  + T EA+ AAV LS RYI DR+LP
Sbjct: 320 ALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLP 379

Query: 504 DKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDD 563
           DKAIDL+DEAG+R  +E+             KP +    E    Q   E     R +  D
Sbjct: 380 DKAIDLLDEAGARVRLEI------------DKPEELDELERELAQLEIEKEALEREQ--D 425

Query: 564 VVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGL 623
                     I ++       + +  A V  DDIA V + W+GIPV ++  DE+  L+ L
Sbjct: 426 EKEKKLIDEIIKLKEGRIPELEKELEAEVDEDDIAEVVARWTGIPVAKLLEDEKEKLLNL 485

Query: 624 EEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACY 683
           E +LKKRVIGQDEAV A+S A++R+R GL DPNRP  + LF GPTGVGKTELAK+LA   
Sbjct: 486 ERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEAL 545

Query: 684 FGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDEIEKA 743
           FG E +++R+DMSEYME+H+VS+LIG+PPGYVGYEEGG LTEA+RR+P++++LLDEIEKA
Sbjct: 546 FGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKA 605

Query: 744 HPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDNES 803
           HPD+FN+LLQV +DG LTD  GR V F+N +I+MTSN GS  I +          + ++ 
Sbjct: 606 HPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILR--------DADGDDF 657

Query: 804 TSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQV 843
                +K  V+EELK +FRPE LNRIDE++ F  L K  +
Sbjct: 658 ADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVL 697

Length = 786
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|233847 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|226415 COG3899, COG3899, Predicted ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131688 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181681 PRK09183, PRK09183, transposase/IS protein; Provisional Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 849
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.97
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.95
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.91
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.91
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.9
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.9
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.9
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.89
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.88
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.87
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.86
COG2204 464 AtoC Response regulator containing CheY-like recei 99.86
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.85
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.85
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.84
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.84
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.84
KOG2028554 consensus ATPase related to the helicase subunit o 99.83
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.83
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.82
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.82
CHL00195489 ycf46 Ycf46; Provisional 99.81
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.81
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.81
CHL00195489 ycf46 Ycf46; Provisional 99.81
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.8
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.8
PRK13342413 recombination factor protein RarA; Reviewed 99.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.8
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.8
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.79
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.79
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.79
PLN03025319 replication factor C subunit; Provisional 99.78
PRK03992389 proteasome-activating nucleotidase; Provisional 99.78
CHL00181287 cbbX CbbX; Provisional 99.78
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.78
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.78
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.77
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.77
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.77
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.77
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.77
PRK13341 725 recombination factor protein RarA/unknown domain f 99.76
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.76
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.76
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.76
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.76
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.75
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.75
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.75
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.75
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.75
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.74
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.74
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.73
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.73
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.73
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.73
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.73
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.73
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.73
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 99.73
CHL00176638 ftsH cell division protein; Validated 99.73
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.72
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.72
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.72
PRK15424 538 propionate catabolism operon regulatory protein Pr 99.72
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.72
CHL00181287 cbbX CbbX; Provisional 99.71
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.71
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.71
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.71
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.7
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.7
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 99.7
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.7
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.7
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.7
PHA02544316 44 clamp loader, small subunit; Provisional 99.69
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.69
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.69
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.69
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.69
PRK12402337 replication factor C small subunit 2; Reviewed 99.69
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.69
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 99.68
PRK11608 326 pspF phage shock protein operon transcriptional ac 99.68
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.68
PRK04195482 replication factor C large subunit; Provisional 99.68
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 99.68
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.67
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 99.67
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.67
COG1221 403 PspF Transcriptional regulators containing an AAA- 99.67
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.66
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.66
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.66
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.66
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.66
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.65
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.65
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 99.65
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.65
PRK05022 509 anaerobic nitric oxide reductase transcription reg 99.65
CHL002062281 ycf2 Ycf2; Provisional 99.64
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.64
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.63
PRK00440319 rfc replication factor C small subunit; Reviewed 99.63
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.63
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.62
PRK08084235 DNA replication initiation factor; Provisional 99.62
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 99.62
CHL00095821 clpC Clp protease ATP binding subunit 99.61
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.61
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.61
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.61
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.61
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.61
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.61
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.6
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 99.59
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.58
PF00004132 AAA: ATPase family associated with various cellula 99.58
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.58
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 99.58
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.58
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.58
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.57
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.57
PRK13531 498 regulatory ATPase RavA; Provisional 99.56
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.56
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.55
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.54
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.54
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.54
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.53
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.52
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.52
PRK07940394 DNA polymerase III subunit delta'; Validated 99.52
PRK06893229 DNA replication initiation factor; Validated 99.52
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.52
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.52
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.52
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.51
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.51
PLN03025 319 replication factor C subunit; Provisional 99.51
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.51
PRK15115 444 response regulator GlrR; Provisional 99.51
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK03992389 proteasome-activating nucleotidase; Provisional 99.5
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.5
PTZ001121164 origin recognition complex 1 protein; Provisional 99.5
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.5
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.5
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.5
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 99.5
PRK05642234 DNA replication initiation factor; Validated 99.49
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.49
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.49
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.48
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.48
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.48
PRK12422445 chromosomal replication initiation protein; Provis 99.48
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.48
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.48
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.48
PRK08727233 hypothetical protein; Validated 99.48
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.47
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.47
PRK14086617 dnaA chromosomal replication initiation protein; P 99.47
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.46
PRK00149450 dnaA chromosomal replication initiation protein; R 99.46
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.46
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.45
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.45
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.45
PRK14088440 dnaA chromosomal replication initiation protein; P 99.45
PRK09112351 DNA polymerase III subunit delta'; Validated 99.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.44
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.44
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 99.44
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.44
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.43
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.43
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.43
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.43
COG0714 329 MoxR-like ATPases [General function prediction onl 99.42
PRK07471365 DNA polymerase III subunit delta'; Validated 99.42
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.42
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.42
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.41
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.41
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.41
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.41
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.41
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.41
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 99.4
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK06620214 hypothetical protein; Validated 99.39
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.39
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.38
PRK09862 506 putative ATP-dependent protease; Provisional 99.38
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.38
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.38
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.38
PHA02244 383 ATPase-like protein 99.38
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.38
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.38
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.38
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.37
PRK14087450 dnaA chromosomal replication initiation protein; P 99.37
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.37
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 99.37
PRK05564313 DNA polymerase III subunit delta'; Validated 99.36
PRK13342 413 recombination factor protein RarA; Reviewed 99.36
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.36
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.36
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.36
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.35
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.34
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.34
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.34
KOG2028 554 consensus ATPase related to the helicase subunit o 99.34
PRK07399 314 DNA polymerase III subunit delta'; Validated 99.33
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.33
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.33
PF00004132 AAA: ATPase family associated with various cellula 99.33
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.33
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.32
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.32
PRK12402 337 replication factor C small subunit 2; Reviewed 99.32
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.31
PRK09087226 hypothetical protein; Validated 99.31
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.31
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.31
CHL00176 638 ftsH cell division protein; Validated 99.31
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.31
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.31
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.3
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.3
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.3
PF07726131 AAA_3: ATPase family associated with various cellu 99.3
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.3
PRK07399314 DNA polymerase III subunit delta'; Validated 99.3
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.29
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.29
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.29
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.28
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.28
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.28
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.27
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 99.27
PRK07471 365 DNA polymerase III subunit delta'; Validated 99.27
PRK09112 351 DNA polymerase III subunit delta'; Validated 99.26
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.26
PRK04195 482 replication factor C large subunit; Provisional 99.25
COG0593408 DnaA ATPase involved in DNA replication initiation 99.25
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.25
CHL00206 2281 ycf2 Ycf2; Provisional 99.24
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK04132846 replication factor C small subunit; Provisional 99.23
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.23
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.23
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.23
PRK08058329 DNA polymerase III subunit delta'; Validated 99.23
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.23
PRK13341 725 recombination factor protein RarA/unknown domain f 99.22
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 99.22
PRK05564 313 DNA polymerase III subunit delta'; Validated 99.22
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.22
KOG1969877 consensus DNA replication checkpoint protein CHL12 99.21
PHA02544 316 44 clamp loader, small subunit; Provisional 99.21
PRK00440 319 rfc replication factor C small subunit; Reviewed 99.21
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.21
PRK08058 329 DNA polymerase III subunit delta'; Validated 99.21
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.21
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.2
smart00350 509 MCM minichromosome maintenance proteins. 99.2
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.2
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.2
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.19
PRK10865857 protein disaggregation chaperone; Provisional 99.19
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.19
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.18
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.18
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 99.18
PRK13531498 regulatory ATPase RavA; Provisional 99.18
PRK05707328 DNA polymerase III subunit delta'; Validated 99.17
PRK06871 325 DNA polymerase III subunit delta'; Validated 99.17
PRK08769 319 DNA polymerase III subunit delta'; Validated 99.16
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.15
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.15
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.13
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.13
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 99.12
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.12
PRK08769319 DNA polymerase III subunit delta'; Validated 99.12
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.12
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.11
COG0714329 MoxR-like ATPases [General function prediction onl 99.11
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.1
PRK06090 319 DNA polymerase III subunit delta'; Validated 99.1
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.09
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.09
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.09
PRK05707 328 DNA polymerase III subunit delta'; Validated 99.09
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.09
PRK07993 334 DNA polymerase III subunit delta'; Validated 99.09
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.08
PRK07993334 DNA polymerase III subunit delta'; Validated 99.07
PHA02244383 ATPase-like protein 99.07
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.07
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.07
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.06
COG1221403 PspF Transcriptional regulators containing an AAA- 99.06
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.06
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.06
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.06
KOG2035 351 consensus Replication factor C, subunit RFC3 [Cell 99.05
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.05
PRK06964 342 DNA polymerase III subunit delta'; Validated 99.05
COG2204464 AtoC Response regulator containing CheY-like recei 99.04
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.04
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.03
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.03
PRK11608326 pspF phage shock protein operon transcriptional ac 99.03
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.02
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.02
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 99.01
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.01
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.0
PRK06871325 DNA polymerase III subunit delta'; Validated 99.0
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.0
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.99
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 98.99
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.98
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.98
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.98
PRK13765 637 ATP-dependent protease Lon; Provisional 98.97
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.97
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.96
PRK15424538 propionate catabolism operon regulatory protein Pr 98.96
COG4650 531 RtcR Sigma54-dependent transcription regulator con 98.95
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.95
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.94
PRK06964342 DNA polymerase III subunit delta'; Validated 98.94
PRK06090319 DNA polymerase III subunit delta'; Validated 98.93
PRK06893229 DNA replication initiation factor; Validated 98.93
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.93
PRK05917 290 DNA polymerase III subunit delta'; Validated 98.93
PRK08727233 hypothetical protein; Validated 98.92
smart00350509 MCM minichromosome maintenance proteins. 98.92
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.92
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.91
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.9
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 98.9
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.9
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.9
PRK08084235 DNA replication initiation factor; Provisional 98.88
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.87
PRK04132 846 replication factor C small subunit; Provisional 98.86
PRK08699 325 DNA polymerase III subunit delta'; Validated 98.85
PRK08181269 transposase; Validated 98.84
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.84
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.83
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.82
PF07726131 AAA_3: ATPase family associated with various cellu 98.82
PRK06526254 transposase; Provisional 98.82
PRK13765637 ATP-dependent protease Lon; Provisional 98.81
PRK07276 290 DNA polymerase III subunit delta'; Validated 98.81
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.81
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.8
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.79
PRK12377248 putative replication protein; Provisional 98.79
PRK05642234 DNA replication initiation factor; Validated 98.77
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.75
PRK08699325 DNA polymerase III subunit delta'; Validated 98.75
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 98.74
PRK12377248 putative replication protein; Provisional 98.73
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.73
PRK09183259 transposase/IS protein; Provisional 98.71
PRK08116268 hypothetical protein; Validated 98.7
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.7
PRK05818 261 DNA polymerase III subunit delta'; Validated 98.7
smart00382148 AAA ATPases associated with a variety of cellular 98.68
PRK12422 445 chromosomal replication initiation protein; Provis 98.68
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.67
PRK05917290 DNA polymerase III subunit delta'; Validated 98.67
PF13173128 AAA_14: AAA domain 98.67
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.66
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.66
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.66
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.65
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.64
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.61
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 98.61
PRK08116268 hypothetical protein; Validated 98.61
PRK14087 450 dnaA chromosomal replication initiation protein; P 98.61
PRK09862506 putative ATP-dependent protease; Provisional 98.6
smart00382148 AAA ATPases associated with a variety of cellular 98.59
PRK07952244 DNA replication protein DnaC; Validated 98.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.59
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.59
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.58
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 98.57
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.57
PRK07132 299 DNA polymerase III subunit delta'; Validated 98.57
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.56
PRK06526254 transposase; Provisional 98.55
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 98.54
PRK07132299 DNA polymerase III subunit delta'; Validated 98.52
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.51
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.5
PRK08181269 transposase; Validated 98.5
PRK15115444 response regulator GlrR; Provisional 98.5
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.48
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.47
PRK07276290 DNA polymerase III subunit delta'; Validated 98.46
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.46
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.45
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.45
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.44
PRK06620214 hypothetical protein; Validated 98.43
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.42
PRK06835329 DNA replication protein DnaC; Validated 98.42
KOG0478 804 consensus DNA replication licensing factor, MCM4 c 98.41
PRK06835329 DNA replication protein DnaC; Validated 98.41
PRK15455 644 PrkA family serine protein kinase; Provisional 98.4
PRK07952244 DNA replication protein DnaC; Validated 98.38
PRK08939306 primosomal protein DnaI; Reviewed 98.36
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.36
COG1241 682 MCM2 Predicted ATPase involved in replication cont 98.35
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.35
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.35
PRK09087226 hypothetical protein; Validated 98.34
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 98.33
PHA00729226 NTP-binding motif containing protein 98.31
PF05729166 NACHT: NACHT domain 98.31
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.29
PF13173128 AAA_14: AAA domain 98.28
PRK06921266 hypothetical protein; Provisional 98.27
PRK05818261 DNA polymerase III subunit delta'; Validated 98.25
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.24
PRK09183259 transposase/IS protein; Provisional 98.23
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.22
PRK15455644 PrkA family serine protein kinase; Provisional 98.21
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.19
PRK08939306 primosomal protein DnaI; Reviewed 98.19
PRK06921266 hypothetical protein; Provisional 98.19
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.17
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.16
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.14
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.13
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.12
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.1
PRK06581 263 DNA polymerase III subunit delta'; Validated 98.08
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.06
PRK14700300 recombination factor protein RarA; Provisional 98.05
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.04
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.04
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 98.01
PF05729166 NACHT: NACHT domain 97.96
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.96
COG0593 408 DnaA ATPase involved in DNA replication initiation 97.94
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.93
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.93
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.92
PRK06581263 DNA polymerase III subunit delta'; Validated 97.91
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.89
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.86
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.85
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.84
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-118  Score=1029.24  Aligned_cols=696  Identities=49%  Similarity=0.772  Sum_probs=613.4

Q ss_pred             HhhHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHhcCCChHHHHHHCCCCHHHHHHHHHHHhhhCCCCCCcchhccCCCC
Q 003088           84 RFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHSTNNQDTDDAAAQGKPF  163 (849)
Q Consensus        84 rft~~a~~~l~~A~~~A~~~~~~~v~~eHLLlaLl~~~~~~~~l~~~gi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (849)
                      +||+++++++..|+.+|+.++|.+|++||||++|+.++.+..++..+|++++.++..+...+++.+..           .
T Consensus         1 ~~~~~~~~~l~~a~~~a~~~~h~~~~~eHll~~ll~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~-----------~   69 (786)
T COG0542           1 KLTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGDELLNLCGIDLDKLRQELEEFIDKLPKV-----------L   69 (786)
T ss_pred             CcCHHHHHHHHHHHHHHHHhCCCcccHHHHHHHHHcCCchHHHHHHcCCCHHHHHHHHHHHHhccCCC-----------C
Confidence            59999999999999999999999999999999999998877999999999999999999999987641           1


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHhhhcCCchhhHHHHhhcCCHHHHHHHHHHhhhhcccccCCC
Q 003088          164 SSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGRE  243 (849)
Q Consensus       164 ~~~~~~~~s~~~~~vl~~A~~~a~~~g~~~I~~ehlLlall~~~~~~a~~iL~~~gv~~~~l~~~~~~~~~~~~~~~~~~  243 (849)
                      +  . +.+|+.++++++.|..+|+.+|+.||+++|||+|++.++++.+..+|...|++...+.+ +...+.+.....   
T Consensus        70 ~--~-~~~s~~~~~~~~~a~~~a~~~~~~~v~~~~llla~~~~~~~~~~~~l~~~~~~~~~~~~-~~~~~~~~~~~~---  142 (786)
T COG0542          70 G--S-PYLSPRLKRVLERAWLLAQSLGDEYVSTEHLLLALLNEPESVAAYILKKLGVTRKDVEE-LIEELRGGNEVD---  142 (786)
T ss_pred             C--C-CCCCHHHHHHHHHHHHHHHhccCccccHHHHHHHHhcccchHHHHHHHhccCCHHHHHH-HHHHHhcccccC---
Confidence            1  2 78899999999999999999999999999999999999999999999999999998844 444443221100   


Q ss_pred             CccccccccccccccccccCCCCCCcchhHHhhhhhhHHHHhhcCCCCccccHHHHHHHHHHHhcCCCCCCeEeCCCCCh
Q 003088          244 PSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVG  323 (849)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~l~~iiG~~~~i~~l~~~l~~~~~~niLL~GppGtG  323 (849)
                                   ++      +.......|++|+.|+++.++.+++||+|||++++++++++|+|+++||++|+|+||||
T Consensus       143 -------------~~------~~~~~~~~L~~y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVG  203 (786)
T COG0542         143 -------------SK------NAEEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVG  203 (786)
T ss_pred             -------------Cc------ccccchhhHHHHhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCC
Confidence                         00      00123478999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhCCCCccccCCeEEEeehhhhhccccccchHHHHHHHHHHHHHhcCCeEEEEcCcchhhhCCCCCCC
Q 003088          324 KTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVGRG  403 (849)
Q Consensus       324 KT~la~~la~~l~~~~~p~~~~~~~~~~l~~~~~~~~~~~~g~~e~~l~~l~~~~~~~~~~ILfIDEi~~l~~~~~~~~~  403 (849)
                      ||++|++||.++..++||..+.+++++++|++++++|++|+|+||++++.+++++++.++.||||||+|.++++|..   
T Consensus       204 KTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g~LvAGakyRGeFEeRlk~vl~ev~~~~~vILFIDEiHtiVGAG~~---  280 (786)
T COG0542         204 KTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSKNVILFIDEIHTIVGAGAT---  280 (786)
T ss_pred             HHHHHHHHHHHHhcCCCCHHHcCCEEEEecHHHHhccccccCcHHHHHHHHHHHHhcCCCeEEEEechhhhcCCCcc---
Confidence            99999999999999999999999999999999999999999999999999999999988999999999999998876   


Q ss_pred             CCCc-cHHHHHHHhhhhcCCCeEEEEccChHHHHHHhhccHHHHhccccEEecCCCHHHHHHHHHHHHHHHHhhcCCccC
Q 003088          404 NKGT-GLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFT  482 (849)
Q Consensus       404 ~~~~-~~~~~~~L~~~le~~~i~vI~at~~~~~~~~~~~d~al~~Rf~~i~~~~ps~~e~~~iL~~~~~~~~~~~~~~i~  482 (849)
                        ++ .+|+.|+|+|.|++|.+.||||||.+||++|++.|+||.|||++|.+.+||.++.+.||+++.++|+.||++.|+
T Consensus       281 --~G~a~DAaNiLKPaLARGeL~~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~  358 (786)
T COG0542         281 --EGGAMDAANLLKPALARGELRCIGATTLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRIT  358 (786)
T ss_pred             --cccccchhhhhHHHHhcCCeEEEEeccHHHHHHHhhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceec
Confidence              23 599999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhcccccCcchhhHHHHHHHHhhHHHHhhhhchhhhhhhhcCCCCchHHHHHHHHHHhHHHHHhccc---
Q 003088          483 LEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRL---  559 (849)
Q Consensus       483 ~~~l~~~a~ls~~~~~~r~~p~~ai~ll~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~---  559 (849)
                      ++++.+++.++++|+++|++||||||++|+||++.++... .|.+.         ++...++.++....+.....+.   
T Consensus       359 D~Al~aAv~LS~RYI~dR~LPDKAIDLiDeA~a~~~l~~~-~p~~l---------~~~~~~~~~l~~e~~~~~~e~~~~~  428 (786)
T COG0542         359 DEALVAAVTLSDRYIPDRFLPDKAIDLLDEAGARVRLEID-KPEEL---------DELERELAQLEIEKEALEREQDEKE  428 (786)
T ss_pred             HHHHHHHHHHHHhhcccCCCCchHHHHHHHHHHHHHhccc-CCcch---------hHHHHHHHHHHHHHHHHhhhhhHHH
Confidence            9999999999999999999999999999999999999877 65532         2222222222222211111111   


Q ss_pred             ---ccchhhhccCCcchhHHhccCCCCCCCCCCCccCHhHHHHHHHhHhCCCcccCCHHHHHHHHHHHHHHhccccccHH
Q 003088          560 ---KYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDE  636 (849)
Q Consensus       560 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~g~~~~~~~~~~~~~~~~l~~~l~~~i~Gq~~  636 (849)
                         .+....+..  ......++++       .. .|+.++|+++++.|+|+|+.++...+...+.++++.|.++|+||++
T Consensus       429 k~~~~~~~~~~~--~~~~~~~~~~-------~~-~v~~~~Ia~vv~~~TgIPv~~l~~~e~~kll~le~~L~~rViGQd~  498 (786)
T COG0542         429 KKLIDEIIKLKE--GRIPELEKEL-------EA-EVDEDDIAEVVARWTGIPVAKLLEDEKEKLLNLERRLKKRVIGQDE  498 (786)
T ss_pred             HHHHHHHHHHhh--hhhhhHHHHH-------hh-ccCHHHHHHHHHHHHCCChhhhchhhHHHHHHHHHHHhcceeChHH
Confidence               000000000  0000011111       01 2999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCCCCCCCCccceeecCCCCchHHHHHHHHHHhcCCCCceeEeeccccccccccccccCCCCCccc
Q 003088          637 AVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVG  716 (849)
Q Consensus       637 ~i~~l~~~l~~~~~g~~~~~~p~~~lL~~Gp~GtGKt~lA~~la~~l~~~~~~~i~i~~~~~~~~~~~~~l~g~~~g~vg  716 (849)
                      ++..+.+++++++.|+..|++|.+++||.||+|+|||++|++||..+|+++.+++++|||+|+++|++++|+|+||||||
T Consensus       499 AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVG  578 (786)
T COG0542         499 AVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVG  578 (786)
T ss_pred             HHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCcchhHHHHhCCCeEEEEeCccccCHHHHHHHHHHhhcCeeecCCCceeecCCeEEEEecCCCchhhhcccCCcccc
Q 003088          717 YEEGGLLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGF  796 (849)
Q Consensus       717 ~~~~~~l~~~i~~~~~~vl~lDEid~l~~~~~~~Ll~~le~g~~~~~~g~~~~~~~~~iI~tsn~~~~~l~~~~~~~~gf  796 (849)
                      |+++|.|+++++++|++||+||||+|+||+++|.|||+||+|+++|++|++++|+|++||||||.|+..+.+..    ++
T Consensus       579 yeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~~----~~  654 (786)
T COG0542         579 YEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRDA----DG  654 (786)
T ss_pred             eccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHHHhcCCeeecCCCCEEecceeEEEEecccchHHHHhhc----cc
Confidence            99999999999999999999999999999999999999999999999999999999999999999998876542    11


Q ss_pred             ccccCCcccHHhHHHHHHHHHHhhCChHHhhccccEEEcCCCCHHHHccccCC
Q 003088          797 LLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPLI  849 (849)
Q Consensus       797 ~~~~~~~~~~~~~~~~~~~~l~~~~~pell~R~d~~i~f~pl~~~~~~~I~~l  849 (849)
                          ......+.+...++..++++|+|||++|+|.+|+|.||+++++.+|+++
T Consensus       655 ----~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~~L~~~~l~~Iv~~  703 (786)
T COG0542         655 ----DDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVLERIVDL  703 (786)
T ss_pred             ----cccchhhhHHHHHHHHHHhhCCHHHHhhcccEEeccCCCHHHHHHHHHH
Confidence                1123456678899999999999999999999999999999999999863

>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query849
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-158
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 1e-158
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 2e-92
4hse_A397 Crystal Structure Of Clpb Nbd1 In Complex With Guan 2e-75
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 2e-75
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 2e-75
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 3e-60
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 4e-72
1jbk_A195 Crystal Structure Of The First Nucelotide Binding D 5e-57
2p65_A187 Crystal Structure Of The First Nucleotide Binding D 2e-55
3fh2_A146 The Crystal Structure Of The Probable Atp-Dependent 6e-14
2y1r_A149 Structure Of Meca121 & Clpc N-Domain Complex Length 1e-13
2k77_A146 Nmr Solution Structure Of The Bacillus Subtilis Clp 1e-13
2y1q_A150 Crystal Structure Of Clpc N-Terminal Domain Length 3e-13
3fes_A145 Crystal Structure Of The Atp-Dependent Clp Protease 8e-09
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 3e-04
1g3i_A 444 Crystal Structure Of The Hsluv Protease-Chaperone C 8e-04
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure 
Iteration: 1

 Score =  556 bits (1432), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 334/771 (43%), Positives = 453/771 (58%), Gaps = 107/771 (13%)
Query: 81  VFERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREA 140
           +F RFTERA K +  +Q EA  LG + + T+H+LLGL+ E          GI   KA +A
Sbjct: 2   MFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREG--------EGIAA-KALQA 52
Query: 141 VVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIA 200
           +  +      ++ +    +G+  S    + ++   K+V E +++ +R  G++++  EHI 
Sbjct: 53  L-GLGSEKIQKEVESLIGRGQEMSQT--IHYTPRAKKVIELSMDEARKLGHSYVGTEHIL 109
Query: 201 LGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKTA 260
           LGL    +G A RVL  LGV +N  A   V +L G                 N      A
Sbjct: 110 LGLIREGEGVAARVLNNLGVSLNK-ARQQVLQLLGS----------------NETGSSAA 152
Query: 261 ALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGES 320
              S   T    L+    DLTA A E+ +DPVIGR  EIQR+I++L RRTKNNP+L+GE 
Sbjct: 153 GTNSNANT--PTLDSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEP 210
Query: 321 GVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQK 380
           GVGKTAIAEGLA +I+  EVP  L  KR+M+LDMG      K RGE E R+  ++ EI++
Sbjct: 211 GVGKTAIAEGLAQQIINNEVPEILRDKRVMTLDMG-----TKYRGEFEDRLKKVMDEIRQ 265
Query: 381 SGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFE 440
           +G++ILFID                   +D SN+LKPSL RGELQCI +TT DE+R   E
Sbjct: 266 AGNIILFID-----------------AAIDASNILKPSLARGELQCIGATTLDEYRKYIE 308
Query: 441 KDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDR 500
           KD AL RRFQP+ + +PS +++++IL GLR++YEAHH    T +AI AAV LS RYISDR
Sbjct: 309 KDAALERRFQPIQVDQPSVDESIQILQGLRDRYEAHHRVSITDDAIEAAVKLSDRYISDR 368
Query: 501 YLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLK 560
           +LPDKAIDL+DEAGS+  +  F           + PP+    E +  +   E     + +
Sbjct: 369 FLPDKAIDLIDEAGSKVRLRSF-----------TTPPNLKELEQKLDEVRKEKDAAVQSQ 417
Query: 561 YDDVVASMGDTSEIV---VESSLPSASDD--DEPAVVGPDDIAAVASLWSGIPVQQITAD 615
             +  AS+ DT + +   VE +  S  +    E + V  DDIA V S W+G+PV +I   
Sbjct: 418 EFEKAASLRDTEQRLREQVEDTKKSWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQT 477
Query: 616 ERMLLVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTEL 675
           E   L+ +E  L  RVIGQDEAV A+++AV+R+R GLKDP RP  + +F GPTGVGKTEL
Sbjct: 478 ETDKLLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTEL 537
Query: 676 AKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLL 735
           A++LA   FG E SM+R+DMSEYME+H+ S              GG LTE +RR+P++++
Sbjct: 538 ARALAESIFGDEESMIRIDMSEYMEKHSTS--------------GGQLTEKVRRKPYSVV 583
Query: 736 LLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIG 795
           LLD IEKAHPD+FNILLQV EDG LTDS GR V F+N +++MTSNVG             
Sbjct: 584 LLDAIEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNVG------------- 630
Query: 796 FLLEDNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQL 846
                      A  K  V+ ELK  FRPE +NRIDE++VF SLEK  + ++
Sbjct: 631 -----------ASEKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLTEI 670
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|4HSE|A Chain A, Crystal Structure Of Clpb Nbd1 In Complex With Guanidinium Chloride And Adp Length = 397 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|1JBK|A Chain A, Crystal Structure Of The First Nucelotide Binding Domain Of Clpb Length = 195 Back     alignment and structure
>pdb|2P65|A Chain A, Crystal Structure Of The First Nucleotide Binding Domain Of Chaperone Clpb1, Putative, (Pv089580) From Plasmodium Vivax Length = 187 Back     alignment and structure
>pdb|3FH2|A Chain A, The Crystal Structure Of The Probable Atp-Dependent Protease (Heat Shock Protein) From Corynebacterium Glutamicum Length = 146 Back     alignment and structure
>pdb|2Y1R|A Chain A, Structure Of Meca121 & Clpc N-Domain Complex Length = 149 Back     alignment and structure
>pdb|2K77|A Chain A, Nmr Solution Structure Of The Bacillus Subtilis Clpc N- Domain Length = 146 Back     alignment and structure
>pdb|2Y1Q|A Chain A, Crystal Structure Of Clpc N-Terminal Domain Length = 150 Back     alignment and structure
>pdb|3FES|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Clpc From Clostridium Difficile Length = 145 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|1G3I|A Chain A, Crystal Structure Of The Hsluv Protease-Chaperone Complex Length = 444 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query849
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 0.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 0.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 1e-166
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 1e-131
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 1e-128
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 1e-127
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 8e-88
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 1e-85
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 2e-63
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 1e-33
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 4e-30
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 9e-28
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 9e-11
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 2e-10
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 3e-10
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 1e-05
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 5e-07
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 3e-05
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-06
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-05
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-05
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 3e-05
2chq_A319 Replication factor C small subunit; DNA-binding pr 6e-05
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 7e-05
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 8e-05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 8e-05
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 1e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 1e-04
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 2e-04
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 3e-04
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 5e-04
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 6e-04
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
 Score =  911 bits (2357), Expect = 0.0
 Identities = 319/766 (41%), Positives = 438/766 (57%), Gaps = 101/766 (13%)

Query: 82  FERFTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHP--NGFLESGITIDKARE 139
           F RFTERA K +  +Q EA  LG + + T+H+LLGL+ E            G+  +K ++
Sbjct: 3   FGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLGSEKIQK 62

Query: 140 AVVSIWHSTNNQDTDDAAAQGKPFSSAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHI 199
            V S+               G+    +  + ++   K+V E +++ +R  G++++  EHI
Sbjct: 63  EVESLI--------------GRGQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVGTEHI 108

Query: 200 ALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEGREPSLAKGVRENSISGKT 259
            LGL    +G A RVL  LGV +N      +  L                         +
Sbjct: 109 LLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSN-------------------ETGS 149

Query: 260 AALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGE 319
           +A  +        L+    DLTA A E+ +DPVIGR  EIQR+I++L RRTKNNP+L+GE
Sbjct: 150 SAAGTNSNANTPTLDSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGE 209

Query: 320 SGVGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQ 379
            GVGKTAIAEGLA +I+  EVP  L  KR+M+LDMG      K RGE E R+  ++ EI+
Sbjct: 210 PGVGKTAIAEGLAQQIINNEVPEILRDKRVMTLDMG-----TKYRGEFEDRLKKVMDEIR 264

Query: 380 KSGDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQF 439
           ++G++ILFID                   +D SN+LKPSL RGELQCI +TT DE+R   
Sbjct: 265 QAGNIILFIDA-----------------AIDASNILKPSLARGELQCIGATTLDEYRKYI 307

Query: 440 EKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISD 499
           EKD AL RRFQP+ + +PS +++++IL GLR++YEAHH    T +AI AAV LS RYISD
Sbjct: 308 EKDAALERRFQPIQVDQPSVDESIQILQGLRDRYEAHHRVSITDDAIEAAVKLSDRYISD 367

Query: 500 RYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRL 559
           R+LPDKAIDL+DEAGS+  +  F      +   L +  D+  +E        E  + + L
Sbjct: 368 RFLPDKAIDLIDEAGSKVRLRSFTTPPNLKE--LEQKLDEVRKEKDAAVQSQEFEKAASL 425

Query: 560 KYDDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERML 619
           +  +         ++             E + V  DDIA V S W+G+PV +I   E   
Sbjct: 426 RDTEQRL----REQVEDTKKSWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQTETDK 481

Query: 620 LVGLEEQLKKRVIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSL 679
           L+ +E  L  RVIGQDEAV A+++AV+R+R GLKDP RP  + +F GPTGVGKTELA++L
Sbjct: 482 LLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAL 541

Query: 680 AACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGGLLTEAIRRRPFTLLLLDE 739
           A   FG E SM+R+DMSEYME+H+ S              GG LTE +RR+P++++LLD 
Sbjct: 542 AESIFGDEESMIRIDMSEYMEKHSTS--------------GGQLTEKVRRKPYSVVLLDA 587

Query: 740 IEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLE 799
           IEKAHPD+FNILLQV EDG LTDS GR V F+N +++MTSNVG++               
Sbjct: 588 IEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNVGAS--------------- 632

Query: 800 DNESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQ 845
                     K  V+ ELK  FRPE +NRIDE++VF SLEK  + +
Sbjct: 633 ---------EKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLTE 669
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Length = 468 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Length = 195 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Length = 187 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Length = 146 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Length = 145 Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Length = 150 Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Length = 150 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Length = 143 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Length = 148 Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Length = 148 Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Length = 171 Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Length = 171 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 353 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Length = 250 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Length = 373 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Length = 363 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Length = 376 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query849
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.94
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 99.93
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 99.91
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 99.9
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 99.9
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.9
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.89
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.88
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.88
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.88
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.87
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.87
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 99.87
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.86
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.86
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 99.85
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.85
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.85
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.84
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.83
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.83
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.82
3pvs_A447 Replication-associated recombination protein A; ma 99.81
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.79
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.79
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.78
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 99.78
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.77
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.76
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.76
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.76
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.76
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.75
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.75
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.75
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.75
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.74
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.73
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.73
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.72
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.71
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.71
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.7
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.7
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.7
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.7
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.7
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.69
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.69
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.69
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.69
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.68
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.68
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 99.67
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.67
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.67
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.67
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.66
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.66
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.66
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.65
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.65
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.64
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.63
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.63
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.63
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.62
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.62
3co5_A143 Putative two-component system transcriptional RES 99.62
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.62
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.62
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.62
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.6
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.6
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.59
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.58
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.57
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.57
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.56
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.56
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.56
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.56
2r44_A 331 Uncharacterized protein; putative ATPase, structur 99.56
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.56
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.56
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.55
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.55
3bos_A242 Putative DNA replication factor; P-loop containing 99.54
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.54
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 99.54
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.53
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.52
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.52
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.52
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.52
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.52
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.51
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.51
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.51
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.51
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.51
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.5
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.5
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.49
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.49
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.49
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.48
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.48
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.48
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.45
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.44
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.43
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.42
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.41
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.41
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.41
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 99.4
3pvs_A 447 Replication-associated recombination protein A; ma 99.4
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.38
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.38
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.38
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.35
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.35
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.35
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.34
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.33
2chq_A 319 Replication factor C small subunit; DNA-binding pr 99.32
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.32
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.32
3co5_A143 Putative two-component system transcriptional RES 99.3
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 99.3
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.3
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 99.29
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.29
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 99.29
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.28
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.28
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 99.27
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.26
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 99.26
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.24
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.24
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.23
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.23
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.2
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 99.17
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.17
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.17
3f8t_A 506 Predicted ATPase involved in replication control, 99.15
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 99.15
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.15
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.13
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.12
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.12
3bos_A242 Putative DNA replication factor; P-loop containing 99.1
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.1
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.07
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.99
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.98
2fna_A357 Conserved hypothetical protein; structural genomic 98.93
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.88
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.87
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.78
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 98.77
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 98.73
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.72
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.72
3f8t_A506 Predicted ATPase involved in replication control, 98.72
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 98.71
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.7
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 98.67
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 98.65
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.64
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.63
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.61
2qgz_A308 Helicase loader, putative primosome component; str 98.57
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.55
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 98.47
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.46
2qgz_A308 Helicase loader, putative primosome component; str 98.42
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.42
1tue_A212 Replication protein E1; helicase, replication, E1E 98.27
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.22
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.19
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.14
1tue_A212 Replication protein E1; helicase, replication, E1E 98.13
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.12
2fna_A 357 Conserved hypothetical protein; structural genomic 98.0
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.98
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.97
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.92
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.76
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.76
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.7
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 97.62
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.52
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.5
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.46
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.44
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 97.42
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.34
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.33
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 97.31
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.3
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.3
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 97.26
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.23
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.23
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.1
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.98
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.97
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.94
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.89
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.85
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.8
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.78
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.77
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.69
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.59
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.55
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.54
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.48
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.46
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.45
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.39
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.37
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.36
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.33
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.29
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.28
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.25
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.22
1via_A175 Shikimate kinase; structural genomics, transferase 96.2
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.2
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.19
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.18
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.17
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.16
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.14
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.12
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.11
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.11
2z43_A324 DNA repair and recombination protein RADA; archaea 96.1
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.1
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.08
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.05
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.02
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.01
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.93
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.93
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.91
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.9
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.85
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.83
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.82
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.79
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.78
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.78
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.77
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.76
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.75
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.74
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.73
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.73
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.71
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.7
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.69
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.69
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.67
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.66
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.65
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.65
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.64
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.62
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.61
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.58
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.57
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.55
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.54
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.53
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.52
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.52
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.51
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.49
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.46
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.46
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.46
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.46
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.45
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.45
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.44
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.43
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.41
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.41
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.4
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.4
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 95.39
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.35
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.34
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.34
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.33
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.32
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.32
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.31
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.29
1via_A175 Shikimate kinase; structural genomics, transferase 95.29
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.29
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.27
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.27
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.26
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.25
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 95.25
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.25
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.24
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.21
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.21
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.2
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.2
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.17
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.16
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.14
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.12
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.05
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.05
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.05
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.02
3b6e_A216 Interferon-induced helicase C domain-containing P; 95.01
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.99
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 94.99
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.98
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.9
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.88
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 94.88
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.87
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.87
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.85
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.84
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 94.84
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.82
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.81
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.81
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.8
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.8
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.76
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.76
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.76
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.76
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.75
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.7
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.69
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 94.68
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.66
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.65
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.64
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.64
3io5_A333 Recombination and repair protein; storage dimer, i 94.63
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.63
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.62
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.61
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.57
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.56
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.54
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.54
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.51
3h1t_A 590 Type I site-specific restriction-modification syst 94.49
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.48
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 94.48
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.45
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.45
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.45
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.45
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.42
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.39
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.38
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.36
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.35
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.35
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.33
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.32
3ice_A422 Transcription termination factor RHO; transcriptio 94.29
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.28
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.28
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.27
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.27
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.26
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.26
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 94.22
3io5_A 333 Recombination and repair protein; storage dimer, i 94.21
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.21
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.2
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.2
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.19
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.18
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.17
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.17
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.14
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.13
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.12
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.08
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 94.08
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.07
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.05
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.05
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 94.03
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.99
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.97
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.97
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.95
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.94
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.94
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.91
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 93.91
3r20_A233 Cytidylate kinase; structural genomics, seattle st 93.9
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.86
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.86
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.86
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.85
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.85
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.83
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.81
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.75
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.72
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.68
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.66
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.65
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.64
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.6
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 93.59
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.54
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.51
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 93.43
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.41
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 93.37
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.29
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.29
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.28
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 93.15
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.15
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.14
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.14
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.14
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.14
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 93.12
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.12
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.1
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.08
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 93.06
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.05
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.02
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 93.0
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.0
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.99
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.91
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 92.91
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.89
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.88
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 92.88
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 92.88
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.84
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 92.84
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.84
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.8
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 92.78
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 92.78
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 92.78
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.72
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 92.71
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.7
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.7
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.68
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 92.66
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 92.6
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.59
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.56
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.55
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.54
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.53
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 92.53
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.52
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 92.48
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.47
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.44
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.42
3bor_A237 Human initiation factor 4A-II; translation initiat 92.42
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.42
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.4
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
Probab=100.00  E-value=1.3e-84  Score=794.47  Aligned_cols=659  Identities=41%  Similarity=0.670  Sum_probs=566.9

Q ss_pred             hhHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHhcCCChHHHHHHCCCCHHHHHHHHHHHhhh-CCCCCCcchhccCCCC
Q 003088           85 FTERAVKAVIFSQREAKSLGKDMVFTQHLLLGLIAEDRHPNGFLESGITIDKAREAVVSIWHS-TNNQDTDDAAAQGKPF  163 (849)
Q Consensus        85 ft~~a~~~l~~A~~~A~~~~~~~v~~eHLLlaLl~~~~~~~~l~~~gi~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~  163 (849)
                      ||++|+++|..|+.+|+++||.+|+|||||+|||.++++.++|..+|++++.++.++...+++ .|.           ..
T Consensus         2 ~t~~a~~~l~~A~~~A~~~~h~~i~~eHLLlaLl~~~~~~~iL~~~gvd~~~l~~~l~~~l~~~~p~-----------~~   70 (758)
T 1r6b_X            2 LNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEAFIEQTTPV-----------LP   70 (758)
T ss_dssp             BCHHHHHHHHHHHHHHHHTTBSEECHHHHHHHHTTSHHHHHHHHHTTCCHHHHHHHHHHHHHHHSCB-----------CC
T ss_pred             CCHHHHHHHHHHHHHHHHcCCCCccHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHHHhccCCC-----------CC
Confidence            999999999999999999999999999999999987668899999999999999999999987 432           11


Q ss_pred             C--CCCCCCCCHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHhhhcCCchhhHHHHhhcCCHHHHHHHHHHhhhhcccccC
Q 003088          164 S--SAAKMPFSISTKRVFEAAVEYSRSRGYNFIAPEHIALGLFTVDDGSAGRVLKRLGVDVNHLAAVAVSRLQGELAKEG  241 (849)
Q Consensus       164 ~--~~~~~~~s~~~~~vl~~A~~~a~~~g~~~I~~ehlLlall~~~~~~a~~iL~~~gv~~~~l~~~~~~~~~~~~~~~~  241 (849)
                      +  ....++||+.++++|+.|..+|+.+|++||+++|||+||++++++.+.++|+++|++.+++.+.+.+.....-... 
T Consensus        71 ~~~~~~~~~~s~~~~~vl~~A~~~a~~~~~~~I~~ehlLlall~~~~~~a~~~L~~~gi~~~~l~~~i~~~~~~~~~~~-  149 (758)
T 1r6b_X           71 ASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKDEPTQ-  149 (758)
T ss_dssp             CSSSCCCCEECHHHHHHHHHHHHHHHHHTCSSBCHHHHHHHHTTCTTCHHHHHHHHTTCCHHHHHHHHHTC---------
T ss_pred             CccccCCCCcCHHHHHHHHHHHHHHHHcCCCEeeHHHHHHHHhccccchHHHHHHHcCCCHHHHHHHHHHhhccccccc-
Confidence            1  2356899999999999999999999999999999999999998888999999999999998876643321100000 


Q ss_pred             CCCccccccccccccccccccCCCCCCcchhHHhhhhhhHHHHhhcCCCCccccHHHHHHHHHHHhcCCCCCCeEeCCCC
Q 003088          242 REPSLAKGVRENSISGKTAALKSPGRTRASALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESG  321 (849)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~l~~iiG~~~~i~~l~~~l~~~~~~niLL~GppG  321 (849)
                      .+.   .+...   +++      +.......|++|+.+|++++++++|+++||++++++++.+++.++.++|+||+||||
T Consensus       150 ~~~---~~~~~---~~~------~~~~~~~~l~~~~~~l~~~~~~~~~d~~iGr~~~i~~l~~~l~~~~~~~vlL~G~~G  217 (758)
T 1r6b_X          150 SSD---PGSQP---NSE------EQAGGEERLENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESG  217 (758)
T ss_dssp             -------------------------------CCSSSCBHHHHHHTTCSCCCCSCHHHHHHHHHHHTSSSSCEEEEECCTT
T ss_pred             ccc---ccccc---ccc------ccccchhHHHHHhHhHHHHHhcCCCCCccCCHHHHHHHHHHHhccCCCCeEEEcCCC
Confidence            000   00000   000      000134679999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHHHHhhhCCCCccccCCeEEEeehhhhhccccccchHHHHHHHHHHHHHhcCCeEEEEcCcchhhhCCCCC
Q 003088          322 VGKTAIAEGLAIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKSGDVILFIDEVHTLIGSGTVG  401 (849)
Q Consensus       322 tGKT~la~~la~~l~~~~~p~~~~~~~~~~l~~~~~~~~~~~~g~~e~~l~~l~~~~~~~~~~ILfIDEi~~l~~~~~~~  401 (849)
                      ||||++|+++++.+..+.+|..+.+++++.++++.+..+.+++|+++.+++.+++.+...+++||||||+|.+++.+...
T Consensus       218 tGKT~la~~la~~l~~~~v~~~~~~~~~~~~~~~~l~~~~~~~g~~e~~l~~~~~~~~~~~~~iL~IDEi~~l~~~~~~~  297 (758)
T 1r6b_X          218 VGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAAS  297 (758)
T ss_dssp             SSHHHHHHHHHHHHHHTCSCGGGTTCEEEECCCC---CCCCCSSCHHHHHHHHHHHHSSSSCEEEEETTTTTTTTSCCSS
T ss_pred             CCHHHHHHHHHHHHHhCCCChhhcCCEEEEEcHHHHhccccccchHHHHHHHHHHHHHhcCCeEEEEechHHHhhcCCCC
Confidence            99999999999999999999999999999999999998888999999999999999988778999999999998766542


Q ss_pred             CCCCCccHHHHHHHhhhhcCCCeEEEEccChHHHHHHhhccHHHHhccccEEecCCCHHHHHHHHHHHHHHHHhhcCCcc
Q 003088          402 RGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKF  481 (849)
Q Consensus       402 ~~~~~~~~~~~~~L~~~le~~~i~vI~at~~~~~~~~~~~d~al~~Rf~~i~~~~ps~~e~~~iL~~~~~~~~~~~~~~i  481 (849)
                          ++..++.+.|+++++++.+++|++||..+|.+++.+|++|.+||+.+.|++|+.+++.+||+.+...|+.++++.+
T Consensus       298 ----~~~~~~~~~L~~~l~~~~~~~I~at~~~~~~~~~~~d~aL~~Rf~~i~v~~p~~~e~~~il~~l~~~~~~~~~v~~  373 (758)
T 1r6b_X          298 ----GGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRY  373 (758)
T ss_dssp             ----SCHHHHHHHHSSCSSSCCCEEEEEECHHHHHCCCCCTTSSGGGEEEEECCCCCHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             ----cchHHHHHHHHHHHhCCCeEEEEEeCchHHhhhhhcCHHHHhCceEEEcCCCCHHHHHHHHHHHHHHHHHhcCCCC
Confidence                2477889999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             CHHHHHHHHHhhhcccccCcchhhHHHHHHHHhhHHHHhhhhchhhhhhhhcCCCCchHHHHHHHHHHhHHHHHhccccc
Q 003088          482 TLEAINAAVHLSARYISDRYLPDKAIDLVDEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKY  561 (849)
Q Consensus       482 ~~~~l~~~a~ls~~~~~~r~~p~~ai~ll~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  561 (849)
                      +++++..++.++.+|+.++++|+++++++++|+...++....                                      
T Consensus       374 ~~~al~~~~~~s~~~i~~~~lp~~~i~lld~a~~~~~~~~~~--------------------------------------  415 (758)
T 1r6b_X          374 TAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVS--------------------------------------  415 (758)
T ss_dssp             CHHHHHHHHHHHHHHCTTSCTTHHHHHHHHHHHHHHHHSSSC--------------------------------------
T ss_pred             CHHHHHHHHHHhhhhcccccCchHHHHHHHHHHHHHhccccc--------------------------------------
Confidence            999999999999999999999999999999998766532100                                      


Q ss_pred             chhhhccCCcchhHHhccCCCCCCCCCCCccCHhHHHHHHHhHhCCCcccCCHHHHHHHHHHHHHHhccccccHHHHHHH
Q 003088          562 DDVVASMGDTSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKRVIGQDEAVAAI  641 (849)
Q Consensus       562 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~g~~~~~~~~~~~~~~~~l~~~l~~~i~Gq~~~i~~l  641 (849)
                                               .....|+.+++..+++.|+++|...+.+++...+..+++.+.+.++||+++++.+
T Consensus       416 -------------------------~~~~~v~~~di~~~~~~~~~ip~~~~~~~~~~~l~~l~~~l~~~v~g~~~~~~~l  470 (758)
T 1r6b_X          416 -------------------------KRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAIEAL  470 (758)
T ss_dssp             -------------------------CCCCSCCHHHHHHHHHHHSCCCCCCSSSSHHHHHHHHHHHHTTTSCSCHHHHHHH
T ss_pred             -------------------------ccCCccCHHHHHHHHHHhcCCCccccchhHHHHHHHHHHHHHhhccCHHHHHHHH
Confidence                                     0124689999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCCCCCCCCCccceeecCCCCchHHHHHHHHHHhcCCCCceeEeeccccccccccccccCCCCCccccccCc
Q 003088          642 SRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSMLRLDMSEYMERHTVSKLIGSPPGYVGYEEGG  721 (849)
Q Consensus       642 ~~~l~~~~~g~~~~~~p~~~lL~~Gp~GtGKt~lA~~la~~l~~~~~~~i~i~~~~~~~~~~~~~l~g~~~g~vg~~~~~  721 (849)
                      ..++...+.|+..|.+|.+++||+||||||||++|+++|+.+   +.+|+.++|+++.+.+.++.++|.++||+|+.+++
T Consensus       471 ~~~i~~~~~g~~~~~~p~~~~ll~G~~GtGKT~la~~la~~l---~~~~~~i~~s~~~~~~~~~~l~g~~~g~~g~~~~~  547 (758)
T 1r6b_X          471 TEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKAL---GIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGG  547 (758)
T ss_dssp             HHHHHHHHTTCSCTTSCSEEEEEECSTTSSHHHHHHHHHHHH---TCEEEEEEGGGCSSSSCCSSSCCCCSCSHHHHHTT
T ss_pred             HHHHHHHhcccCCCCCCceEEEEECCCCCcHHHHHHHHHHHh---cCCEEEEechhhcchhhHhhhcCCCCCCcCccccc
Confidence            999999999999999999999999999999999999999998   57899999999999999999999999999999989


Q ss_pred             chhHHHHhCCCeEEEEeCccccCHHHHHHHHHHhhcCeeecCCCceeecCCeEEEEecCCCchhhhcccCCccccccccC
Q 003088          722 LLTEAIRRRPFTLLLLDEIEKAHPDIFNILLQVFEDGHLTDSHGRRVSFKNALIVMTSNVGSTTIAKGRHGSIGFLLEDN  801 (849)
Q Consensus       722 ~l~~~i~~~~~~vl~lDEid~l~~~~~~~Ll~~le~g~~~~~~g~~~~~~~~~iI~tsn~~~~~l~~~~~~~~gf~~~~~  801 (849)
                      .+.++++.++++||||||||++++++++.|+++||+|.+++..|+.+++.+++||+|||.+...+.+   +.+||.... 
T Consensus       548 ~l~~~~~~~~~~vl~lDEi~~~~~~~~~~Ll~~le~~~~~~~~g~~~~~~~~~iI~tsN~~~~~~~~---~~~g~~~~~-  623 (758)
T 1r6b_X          548 LLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETER---KSIGLIHQD-  623 (758)
T ss_dssp             HHHHHHHHCSSEEEEEETGGGSCHHHHHHHHHHHHHSEEEETTTEEEECTTEEEEEEECSSCC-----------------
T ss_pred             hHHHHHHhCCCcEEEEeCccccCHHHHHHHHHHhcCcEEEcCCCCEEecCCeEEEEecCcchhhhhh---cccCccccc-
Confidence            9999999999999999999999999999999999999999999999999999999999998876654   357776422 


Q ss_pred             CcccHHhHHHHHHHHHHhhCChHHhhccccEEEcCCCCHHHHccccC
Q 003088          802 ESTSYAGMKTLVVEELKAYFRPELLNRIDEVVVFRSLEKAQVCQLPL  848 (849)
Q Consensus       802 ~~~~~~~~~~~~~~~l~~~~~pell~R~d~~i~f~pl~~~~~~~I~~  848 (849)
                             ...++...+++.|+|+|++|||.+|.|+||+.+++..|++
T Consensus       624 -------~~~~~~~~~~~~~~~~l~~R~~~~i~~~~l~~~~~~~i~~  663 (758)
T 1r6b_X          624 -------NSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVD  663 (758)
T ss_dssp             -----------CHHHHHHHSCHHHHTTCSEEEECCCCCHHHHHHHHH
T ss_pred             -------hHHHHHHHHHHhcCHHHHhhCCcceeeCCCCHHHHHHHHH
Confidence                   1245566777889999999999999999999999988864
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 849
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 3e-98
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 4e-91
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 1e-77
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 2e-69
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 7e-61
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-34
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 7e-31
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 4e-28
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-05
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 6e-28
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 3e-16
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 8e-04
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 7e-16
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 3e-05
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-13
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-12
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 4e-11
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 7e-05
d1qvra1145 a.174.1.1 (A:4-148) N-terminal domain of ClpB (hea 9e-11
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 1e-10
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-08
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 0.002
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 9e-07
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-06
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 3e-06
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 4e-06
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 9e-06
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-05
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-05
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-04
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-05
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-05
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-05
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 6e-04
d1sxjc2227 c.37.1.20 (C:12-238) Replication factor C3 {Baker' 0.004
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score =  309 bits (793), Expect = 3e-98
 Identities = 169/439 (38%), Positives = 238/439 (54%), Gaps = 56/439 (12%)

Query: 272 ALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGL 331
           ALEQ+ +DLT  A+E  +DPVIGR+ EI+R+IQIL RRTKNNP+L+GE GVGKTAI EGL
Sbjct: 4   ALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGL 63

Query: 332 AIRIVQAEVPVFLLSKRIMSLDMGLLMAGAKERGELEARVTTLISEIQKS-GDVILFIDE 390
           A RIV+ +VP  L  KRI+SL MG L+AGAK RGE E R+  +I E+ +S G+VILFIDE
Sbjct: 64  AQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDE 123

Query: 391 VHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIASTTQDEHRTQFEKDKALARRFQ 450
           +HT++G+     G     +D  N+LKP+L RGEL+ I +TT DE+R + EKD AL RRFQ
Sbjct: 124 LHTVVGA-----GKAEGAVDAGNMLKPALARGELRLIGATTLDEYR-EIEKDPALERRFQ 177

Query: 451 PVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDLV 510
           PV + EP+ E+ + IL GL+EKYE HH  + +  AI AA  LS RYI++R LPDKAIDL+
Sbjct: 178 PVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLI 237

Query: 511 DEAGSRAHIELFKRKKEQQTCILSKPPDDYWQEIRTVQAMHEVVQGSRLKYDDVVASMGD 570
           DEA +R  + L              P +    E + +Q   E     + K  D    +  
Sbjct: 238 DEAAARLRMALES-----------APEEIDALERKKLQLEIEREALKKEKDPDSQERLKA 286

Query: 571 TSEIVVESSLPSASDDDEPAVVGPDDIAAVASLWSGIPVQQITADERMLLVGLEEQLKKR 630
               + + +               ++IA + + W          +    ++    + + R
Sbjct: 287 IEAEIAKLT---------------EEIAKLRAEW----------EREREILRKLREAQHR 321

Query: 631 VIGQDEAVAAISRAVKRSRVGLKDPNRPTAAMLFCGPTGVGKTELAKSLAACYFGSESSM 690
           +   DE    I  A        +  +   AA L  G     + E+            +  
Sbjct: 322 L---DEVRREIELAE-------RQYDLNRAAELRYGELPKLEAEVEALSEK---LRGARF 368

Query: 691 LRLDMSEYMERHTVSKLIG 709
           +RL+++E      VS+  G
Sbjct: 369 VRLEVTEEDIAEIVSRWTG 387
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query849
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.93
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.88
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.88
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 99.88
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.88
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.85
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 99.84
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.83
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.83
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.82
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.82
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.81
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 99.8
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.77
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.76
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.74
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.73
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.71
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.71
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.7
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.68
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.63
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.62
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.6
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.59
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.54
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.53
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.52
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.52
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 99.51
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.5
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.49
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.47
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.47
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.46
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.44
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.43
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.42
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.41
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.41
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.41
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.4
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.38
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.25
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.25
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.2
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.2
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.18
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.14
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.11
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.05
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.99
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.95
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.87
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.86
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.63
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 98.61
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 98.56
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 98.43
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.41
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.08
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.05
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.81
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.71
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.55
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.41
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.39
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.35
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.33
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.27
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.26
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.17
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.14
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.12
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.99
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.98
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.97
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.96
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.96
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.96
d2qy9a2211 GTPase domain of the signal recognition particle r 96.88
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.84
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.84
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.8
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.79
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.75
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.72
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.7
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.55
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.53
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.52
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.51
d1okkd2207 GTPase domain of the signal recognition particle r 96.51
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.5
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.5
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.49
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.48
d1vmaa2213 GTPase domain of the signal recognition particle r 96.48
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.47
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.47
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.46
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.38
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.37
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.36
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.36
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.32
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.32
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.32
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.3
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.29
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.29
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.28
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.26
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.26
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.25
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.23
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.23
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.2
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.19
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.16
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.12
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.1
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.1
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.08
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.07
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.05
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.04
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.03
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.0
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.95
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.91
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.9
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.89
d1okkd2207 GTPase domain of the signal recognition particle r 95.87
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.85
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.82
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.81
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.78
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.76
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.75
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.73
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.71
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.69
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.67
d2qy9a2211 GTPase domain of the signal recognition particle r 95.65
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.6
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.6
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.56
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.55
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.51
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.5
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.5
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.49
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.47
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.42
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.39
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.3
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.29
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.24
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.22
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.21
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.19
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.19
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.12
d1vmaa2213 GTPase domain of the signal recognition particle r 95.05
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.05
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.99
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.98
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.96
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.91
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.87
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.86
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.85
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.79
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.75
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.75
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.69
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.67
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.66
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.6
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.52
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.45
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.39
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.34
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.24
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.1
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.06
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.04
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.97
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.97
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.89
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.82
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.81
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.81
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.75
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.66
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.61
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.43
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.41
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.37
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.37
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.29
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.23
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.19
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.11
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.94
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.94
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.88
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.75
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.6
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 92.47
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.32
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.21
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.8
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.78
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.71
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.56
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.5
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.47
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.36
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.31
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.27
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.13
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.07
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.02
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.97
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.95
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.94
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.87
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.85
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.7
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.61
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.61
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.59
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.5
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.48
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.44
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.33
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.3
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.3
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.3
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.26
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.25
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.18
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.14
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.1
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.1
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.05
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.03
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.83
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.76
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.76
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.6
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.58
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.57
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.51
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.47
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.46
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.45
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.39
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.39
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.32
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.29
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 89.28
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.28
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.2
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.16
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.1
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.08
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.07
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.0
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 88.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.82
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.82
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 88.82
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.82
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.81
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.81
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.66
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.59
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.58
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.54
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.51
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.45
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.43
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.43
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.38
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.34
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.33
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.3
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.29
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.27
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.24
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.16
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.15
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.06
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 88.04
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.02
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.9
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.9
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 87.86
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.84
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.78
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 87.69
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.67
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 87.63
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 87.63
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.56
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.42
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.39
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.36
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.28
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.2
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.02
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.97
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.9
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.87
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.86
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 86.73
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 86.63
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.58
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.57
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.44
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.39
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 86.35
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.34
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.33
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.3
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 86.13
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.12
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 86.04
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 86.0
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 85.77
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 85.73
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.54
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.4
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.39
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.35
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 85.33
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 85.27
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 85.17
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.01
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 84.99
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 84.95
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.83
d1g2912240 Maltose transport protein MalK, N-terminal domain 84.78
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.7
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.65
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 84.57
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 84.52
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 84.33
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.29
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 84.25
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 84.23
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 84.2
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.16
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 84.09
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 84.02
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.93
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 83.88
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 83.81
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.78
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 83.65
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 83.64
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 83.56
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.53
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.48
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.43
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 83.4
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 83.4
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 83.28
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.16
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.14
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.12
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 83.1
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 83.05
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.03
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.68
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 82.68
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 82.67
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.66
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 82.59
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 82.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 82.5
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.39
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 82.3
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.19
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.19
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.17
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 82.12
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 82.1
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 81.99
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 81.96
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 81.89
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 81.83
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 81.8
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 81.75
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 81.64
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.56
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 81.48
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 81.46
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 81.35
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 81.28
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.03
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 81.0
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 80.99
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 80.89
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 80.88
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 80.68
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 80.68
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.62
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 80.57
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 80.51
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 80.42
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 80.38
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 80.29
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 80.24
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 80.23
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 80.17
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 80.17
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 80.16
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 80.09
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 80.07
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.03
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.6e-47  Score=420.97  Aligned_cols=252  Identities=58%  Similarity=0.882  Sum_probs=214.8

Q ss_pred             hhHHhhhhhhHHHHhhcCCCCccccHHHHHHHHHHHhcCCCCCCeEeCCCCChHHHHHHHHHHHhhhCCCCccccCCeEE
Q 003088          271 SALEQFCVDLTARASEELIDPVIGRETEIQRIIQILCRRTKNNPILLGESGVGKTAIAEGLAIRIVQAEVPVFLLSKRIM  350 (849)
Q Consensus       271 ~~l~~~~~~l~~~~~~~~l~~iiG~~~~i~~l~~~l~~~~~~niLL~GppGtGKT~la~~la~~l~~~~~p~~~~~~~~~  350 (849)
                      .+|++||+||+++++.|++|++|||++++++++++|++++++|+||+||||||||++++.||+++..+++|..+.+++++
T Consensus         3 ~~l~~~~~~l~~~a~~g~ld~~~gr~~ei~~~~~~L~r~~k~n~llvG~~GvGKtaiv~~la~~i~~~~vp~~l~~~~i~   82 (387)
T d1qvra2           3 NALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIV   82 (387)
T ss_dssp             SHHHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEEE
T ss_pred             HHHHHHHHHHHHHHHcCCCCCCcCcHHHHHHHHHHHhcCCCCCCeEECCCCCCHHHHHHHHHHHHHhCCCCHHHcCceEE
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeehhhhhccccccchHHHHHHHHHHHHHhc-CCeEEEEcCcchhhhCCCCCCCCCCccHHHHHHHhhhhcCCCeEEEEc
Q 003088          351 SLDMGLLMAGAKERGELEARVTTLISEIQKS-GDVILFIDEVHTLIGSGTVGRGNKGTGLDISNLLKPSLGRGELQCIAS  429 (849)
Q Consensus       351 ~l~~~~~~~~~~~~g~~e~~l~~l~~~~~~~-~~~ILfIDEi~~l~~~~~~~~~~~~~~~~~~~~L~~~le~~~i~vI~a  429 (849)
                      .+|++.+++|++++|+++++++.++.++... +++||||||+|.+++.|..     +++.++.++|+++|++|.+.|||+
T Consensus        83 ~ld~~~l~ag~~~~g~~e~r~~~i~~~~~~~~~~~ilfide~h~l~~~g~~-----~g~~d~a~~Lkp~L~rg~~~~I~~  157 (387)
T d1qvra2          83 SLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKA-----EGAVDAGNMLKPALARGELRLIGA  157 (387)
T ss_dssp             EECC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC------------------------HHHHHTTCCCEEEE
T ss_pred             EeeHhhhhcccCcchhHHHHHHHHHHHhccCCCceEEEeccHHHHhcCCCC-----CCcccHHHHHHHHHhCCCcceeee
Confidence            9999999999999999999999999999875 5789999999999987754     457899999999999999999999


Q ss_pred             cChHHHHHHhhccHHHHhccccEEecCCCHHHHHHHHHHHHHHHHhhcCCccCHHHHHHHHHhhhcccccCcchhhHHHH
Q 003088          430 TTQDEHRTQFEKDKALARRFQPVLISEPSQEDAVRILLGLREKYEAHHNCKFTLEAINAAVHLSARYISDRYLPDKAIDL  509 (849)
Q Consensus       430 t~~~~~~~~~~~d~al~~Rf~~i~~~~ps~~e~~~iL~~~~~~~~~~~~~~i~~~~l~~~a~ls~~~~~~r~~p~~ai~l  509 (849)
                      ||+.+|+. ++.|++|.|||++|.|++|+.++...||+++..+|+.+|++.|+++++..++.++++|+++|++|||||++
T Consensus       158 tT~~ey~~-~e~d~al~rrF~~v~v~ep~~~~~~~il~~~~~~~e~~h~v~~~~~ai~~~v~ls~ryi~~r~~PdKAidl  236 (387)
T d1qvra2         158 TTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDL  236 (387)
T ss_dssp             ECHHHHHH-HTTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHH
T ss_pred             cCHHHHHH-hcccHHHHHhcccccCCCCcHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHhcccccccccChhhHHHH
Confidence            99999987 58899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHHhhhhchhhh
Q 003088          510 VDEAGSRAHIELFKRKKEQ  528 (849)
Q Consensus       510 l~~a~~~~~~~~~~~~~~~  528 (849)
                      +|+||+++++....+|.+.
T Consensus       237 ld~a~a~~~i~~~s~P~el  255 (387)
T d1qvra2         237 IDEAAARLRMALESAPEEI  255 (387)
T ss_dssp             HHHHHHHHHHTTTTHHHHH
T ss_pred             HHHHHHHHHhhccCCcHHH
Confidence            9999999999988887753
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure