Citrus Sinensis ID: 003094

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------85

MARLLAQLTNAPALVPGGRHFQSQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV

cHHHHHHcccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEEEccHHccccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHccccccccHHHcccccccccccccHHHccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHcccccccEEccccccccHHHHHHHcccccccccccccccHHHHHccccccEEEcHHHHccccHHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEccccccccccccccccc

cccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHcccEEEEEEHHHHHHcccccccHHHHHHHHHHHHHHcccEEEEEEHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHcHccHHHHHHHHHHHHHHHHcccccEcccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHcccHccEEEEcHHHHHHHccHHHHcccccccccccccccccHHHcccccEEEEHHHHHHHcHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHHccHHHHHHHcHEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEcccccccccccccccc

MARLLAQLtnapalvpggrhfqsqnagksrrNVKMMSymqpsasrissfsglrrsnaldtftcdfHSTVAVSLssrrgksgragGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLEnlgadpsniRTQVIRMVGEsteavgagvgggssgnkmptleeYGTNLTKlaeegkldpvvgrqpQIERVVQILGrrtknnpcligepgvgKTAIAEGLAQriasgdvpdtiegkkVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAanilkpslargelqciGATTLDEYRKHiekdpalerrfqpvkvpepsvdETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKneavrgqdfekageLRDREMDLKAQISALVDKGKemskaeteagdvgpvvtEVDIQHIVSAwtgipvekvstdESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARvglknpnrpiasfifsgptgvgkSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSkligsppgyvgyteggqlteavrrrpytVVLFDEIEKAHPDVFNMMLQILedgrltdskgrtvdfKNTLLIMTSNvgssviekggrrigfdldydekdssynRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVeegynpsygarpLRRAIMRLLEDSMAEKMLAREIkegdsvivdvdsdgnvtvlngssgapesladplpvv

marllaqltnapalvpggrhfqsqnagksrrnVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTvavslssrrgksgragGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLenlgadpsnirTQVIRMVGESTeavgagvgggssgnkmpTLEEYGTNLTKLAEegkldpvvgrqpqIERVVQilgrrtknnpcligepGVGKTAIAEGLAQriasgdvpdtiegkkvitldmgllvagTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEkdpalerrfqpvkvpepsvdetIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQitkekneavrgqdfekagelrdremDLKAQISALVDKGKEMSKAeteagdvgpvvTEVDIQHIvsawtgipvekvstdeSDRLLKMEETlhkrvigqdeavKAISRAIRRarvglknpnrpiasfifsgptgvGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSkligsppgyvGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEdgrltdskgRTVDFkntllimtsnvgssviekggrrigfdldydekdssynrIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEvfdrlktkdielqvterfrervveegynpsygarplrRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVlngssgapesladplpvv

MARLLAQLTNAPALVPGGRHFQSQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVAVslssrrgksgraggFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesteavgagvgggssgNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLigagaaegaidaaniLKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQvterfrervveeGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEgdsvivdvdsdgnvTVLNGSSGAPESLADPLPVV

********************************************************ALDTFTCDFHSTVAVSL*******GRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVG****************************************VVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIE******************VDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEA**************************************************************************VGPVVTEVDIQHIVSAWTGIPVEKVS*******L***ETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLE****************SVIVDV**************************

**R**************************RRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTV***************************EKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQ******************************YGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRL*******************T******V**QDFEKAGELR********************************VVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR********************VTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGN*********************

MARLLAQLTNAPALVPGGRHFQSQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVA***********RAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVD*************DVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV

*ARLLAQLTNAPALVPGGRHFQSQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES****************MPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMS*******DVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGS**************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARLLAQLTNAPALVPGGRHFQSQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSNALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYxxxxxxxxxxxxxxxxxxxxxILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		848	2.2.26 [Sep-21-2011]
Q9FI56		929	Chaperone protein ClpC1,	yes	no	0.900	0.822	0.915	0.0
P31541		926	ATP-dependent Clp proteas	N/A	no	0.902	0.826	0.919	0.0
P35100		922	Chaperone protein ClpC, c	N/A	no	0.902	0.829	0.910	0.0
P31542		923	ATP-dependent Clp proteas	N/A	no	0.902	0.828	0.928	0.0
Q7F9I1		918	Chaperone protein ClpC1,	yes	no	0.902	0.833	0.903	0.0
Q2QVG9		919	Chaperone protein ClpC2,	yes	no	0.897	0.828	0.900	0.0
P46523		874	ATP-dependent Clp proteas	N/A	no	0.898	0.871	0.888	0.0
Q9SXJ7		952	Chaperone protein ClpC2,	no	no	0.903	0.804	0.866	0.0
Q53LY0		932	Chaperone protein ClpC3,	no	no	0.897	0.816	0.755	0.0
Q1XDF4		821	ATP-dependent Clp proteas	N/A	no	0.880	0.909	0.722	0.0

>sp\|Q9FI56\|CLPC1_ARATH Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana GN=CLPC1 PE=1 SV=1	Back alignment and function desciption

 Score = 1390 bits (3598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/771 (91%), Positives = 738/771 (95%), Gaps = 7/771 (0%)

Query: 81  GRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLE 140
           GR  GFV  A+   FT +A +V+ L+ EEAR+LGHNYIGSEHLLLGLLREGEGVAARVLE
Sbjct: 161 GRGSGFV--AVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE 218

Query: 141 NLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVV 200
           NLGADPSNIRTQVIRMVGE+ E V A VGGGSS NKMPTLEEYGTNLTKLAEEGKLDPVV
Sbjct: 219 NLGADPSNIRTQVIRMVGENNE-VTANVGGGSSSNKMPTLEEYGTNLTKLAEEGKLDPVV 277

Query: 201 GRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLD 260
           GRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVP+TIEGKKVITLD
Sbjct: 278 GRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLD 337

Query: 261 MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPS 320
           MGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILFIDEVHTLIGAGAAEGAIDAANILKP+
Sbjct: 338 MGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPA 397

Query: 321 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHK 380
           LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEP+VDETIQILKGLRERYEIHHK
Sbjct: 398 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHK 457

Query: 381 LRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQI 440
           LRYTDE+LV+AAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQ+PEEARELEKELRQI
Sbjct: 458 LRYTDESLVAAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQVPEEARELEKELRQI 517

Query: 441 TKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQ 500
           TKEKNEAVRGQDFEKAG LRDRE++L+A++SA+  KGKEMSKAE+E G+ GP+VTE DIQ
Sbjct: 518 TKEKNEAVRGQDFEKAGTLRDREIELRAEVSAIQAKGKEMSKAESETGEEGPMVTESDIQ 577

Query: 501 HIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRP 560
           HIVS+WTGIPVEKVSTDESDRLLKMEETLHKR+IGQDEAVKAISRAIRRARVGLKNPNRP
Sbjct: 578 HIVSSWTGIPVEKVSTDESDRLLKMEETLHKRIIGQDEAVKAISRAIRRARVGLKNPNRP 637

Query: 561 IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT 620
           IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT
Sbjct: 638 IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT 697

Query: 621 EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT 680
           EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT
Sbjct: 698 EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT 757

Query: 681 SNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL 740
           SNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL
Sbjct: 758 SNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL 817

Query: 741 TKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLE 800
           TKLEVKEIADI+LKEVF+RLK K+IELQVTERF+ERVV+EGYNPSYGARPLRRAIMRLLE
Sbjct: 818 TKLEVKEIADILLKEVFERLKKKEIELQVTERFKERVVDEGYNPSYGARPLRRAIMRLLE 877

Query: 801 DSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAP----ESLADPLPV 847
           DSMAEKMLAREIKEGDSVIVDVD++GNVTVLNG SG P    E   D LPV
Sbjct: 878 DSMAEKMLAREIKEGDSVIVDVDAEGNVTVLNGGSGTPTTSLEEQEDSLPV 928

Molecular chaperone that hydrolyzes ATP and is associated with the chloroplast protein import apparatus. May function as the motor for chloroplast protein translocation, as translocation requires ATP hydrolysis in the stroma. May interact with a clpP-like protease involved in degradation of denatured proteins in the chloroplast. Involved in the regulation of chlorophyll b biosynthesis through the destabilization of chlorophyllide a oxygenase (CAO) protein in response to the accumulation of chlorophyll b. Involved in leaf iron homeostasis.
Arabidopsis thaliana (taxid: 3702)

>sp\|P31541\|CLPAA_SOLLC ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic OS=Solanum lycopersicum GN=CD4A PE=3 SV=1	Back alignment and function description

>sp\|P35100\|CLPC_PEA Chaperone protein ClpC, chloroplastic OS=Pisum sativum PE=2 SV=1	Back alignment and function description

>sp\|P31542\|CLPAB_SOLLC ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1	Back alignment and function description

>sp\|Q7F9I1\|CLPC1_ORYSJ Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2	Back alignment and function description

>sp\|Q2QVG9\|CLPC2_ORYSJ Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2	Back alignment and function description

>sp\|P46523\|CLPA_BRANA ATP-dependent Clp protease ATP-binding subunit clpA homolog, chloroplastic (Fragment) OS=Brassica napus GN=CLPA PE=2 SV=1	Back alignment and function description

>sp\|Q9SXJ7\|CLPC2_ARATH Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana GN=CLPC2 PE=2 SV=1	Back alignment and function description

>sp\|Q53LY0\|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1	Back alignment and function description

>sp\|Q1XDF4\|CLPC_PORYE ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Porphyra yezoensis GN=clpC PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		848
356516495		922	PREDICTED: chaperone protein ClpC, chlor	0.902	0.829	0.936	0.0
356508861		922	PREDICTED: chaperone protein ClpC, chlor	0.902	0.829	0.933	0.0
255540075		924	ATP-dependent clp protease, putative [Ri	0.903	0.829	0.934	0.0
225456471		923	PREDICTED: ATP-dependent Clp protease AT	0.902	0.828	0.945	0.0
449470390		924	PREDICTED: chaperone protein ClpC, chlor	0.902	0.827	0.945	0.0
18423214		929	ATP-dependent Clp protease ATP-binding s	0.900	0.822	0.915	0.0
356513459		919	PREDICTED: chaperone protein ClpC, chlor	0.902	0.832	0.919	0.0
399212		926	RecName: Full=ATP-dependent Clp protease	0.902	0.826	0.919	0.0
461753		922	RecName: Full=Chaperone protein ClpC, ch	0.902	0.829	0.910	0.0
399213		923	RecName: Full=ATP-dependent Clp protease	0.902	0.828	0.928	0.0

>gi\|356516495\|ref\|XP_003526929.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

 Score = 1417 bits (3668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/767 (93%), Positives = 741/767 (96%), Gaps = 2/767 (0%)

Query: 81  GRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLE 140
           GR  GFV  A+   FT +A +V+ L+ EEAR+LGHNYIGSEHLLLGLLREGEGVAARVLE
Sbjct: 158 GRGSGFV--AVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE 215

Query: 141 NLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVV 200
           NLGADP+NIRTQVIRMVGES ++V A VG GSSGNKMPTLEEYGTNLTKLAEEGKLDPVV
Sbjct: 216 NLGADPTNIRTQVIRMVGESADSVTATVGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVV 275

Query: 201 GRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLD 260
           GRQPQIERV QILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLD
Sbjct: 276 GRQPQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 335

Query: 261 MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPS 320
           MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKP+
Sbjct: 336 MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPA 395

Query: 321 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHK 380
           LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEP+VDETIQILKGLRERYEIHHK
Sbjct: 396 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHK 455

Query: 381 LRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQI 440
           LRYTDEALV+AAQLSYQYISDRFLPDKAIDLIDEAGSRVRL+HAQLPEEAREL+KE+RQI
Sbjct: 456 LRYTDEALVAAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLQHAQLPEEARELDKEVRQI 515

Query: 441 TKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQ 500
            KEK EAVR QDFEKAGELRDREMDLKAQIS LV+KGKEMSKAETEAGD GP+VTE DIQ
Sbjct: 516 IKEKEEAVRNQDFEKAGELRDREMDLKAQISTLVEKGKEMSKAETEAGDEGPIVTEADIQ 575

Query: 501 HIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRP 560
           HIVS+WTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRP
Sbjct: 576 HIVSSWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRP 635

Query: 561 IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT 620
           IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT
Sbjct: 636 IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT 695

Query: 621 EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT 680
           EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT
Sbjct: 696 EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT 755

Query: 681 SNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL 740
           SNVGSSVIEKGGR+IGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL
Sbjct: 756 SNVGSSVIEKGGRKIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQL 815

Query: 741 TKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLE 800
           TKLEVKEIADIMLKEVFDRLK KDIELQVTERFR+RVVEEGYNPSYGARPLRRAIMRLLE
Sbjct: 816 TKLEVKEIADIMLKEVFDRLKVKDIELQVTERFRDRVVEEGYNPSYGARPLRRAIMRLLE 875

Query: 801 DSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPV 847
           DSMAEKMLAREIKEGDSVIVDVDSDGNV VLNGSSGAPESL + LPV
Sbjct: 876 DSMAEKMLAREIKEGDSVIVDVDSDGNVIVLNGSSGAPESLPETLPV 922

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356508861\|ref\|XP_003523172.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 1 [Glycine max] gi\|356508863\|ref\|XP_003523173.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|255540075\|ref\|XP_002511102.1\| ATP-dependent clp protease, putative [Ricinus communis] gi\|223550217\|gb\|EEF51704.1\| ATP-dependent clp protease, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225456471\|ref\|XP_002284518.1\| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449470390\|ref\|XP_004152900.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis sativus] gi\|449505877\|ref\|XP_004162592.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|18423214|ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis thaliana] gi|75170759|sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 1; AltName: Full=Casein lytic proteinase C1; AltName: Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein IRON-RESCUED MUTANT 1; Flags: Precursor gi|9758239|dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis thaliana] gi|20856956|gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana] gi|110742601|dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana] gi|332008628|gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356513459\|ref\|XP_003525431.1\| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|399212\|sp\|P31541.1\|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic; Flags: Precursor gi\|170433\|gb\|AAA34160.1\| ATP-dependent protease (CD4A) [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|461753\|sp\|P35100.1\|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; AltName: Full=Casein lytic proteinase C; Flags: Precursor gi\|169128\|gb\|AAA33680.1\| nuclear encoded precursor to chloroplast protein [Pisum sativum]	Back alignment and taxonomy information

>gi\|399213\|sp\|P31542.1\|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic; Flags: Precursor gi\|170435\|gb\|AAA34161.1\| ATP-dependent protease (CD4B) [Solanum lycopersicum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		848
TAIR\|locus:2157383		929	CLPC1 "CLPC homologue 1" [Arab	0.886	0.809	0.842	0.0
TAIR\|locus:2099433		952	HSP93-III [Arabidopsis thalian	0.889	0.792	0.801	0.0
UNIPROTKB\|Q3A9N1		811	CHY_2348 "Negative regulator o	0.838	0.876	0.576	1.4e-229
TIGR_CMR\|CHY_2348		811	CHY_2348 "negative regulator o	0.838	0.876	0.576	1.4e-229
UNIPROTKB\|Q81VV9		811	BAS0081 "Negative regulator of	0.837	0.875	0.554	1.4e-220
TIGR_CMR\|BA_0080		811	BA_0080 "negative regulator of	0.837	0.875	0.554	1.4e-220
UNIPROTKB\|P0A522		848	clpC "Probable ATP-dependent C	0.832	0.832	0.540	1.3e-213
UNIPROTKB\|Q724I0		820	LMOf2365_0244 "ClpC ATPase" [L	0.834	0.863	0.540	7.2e-213
TIGR_CMR\|DET_0057		824	DET_0057 "ATP-dependent Clp pr	0.830	0.854	0.525	1.6e-206
TIGR_CMR\|DET_1413		812	DET_1413 "chaperone ClpB" [Deh	0.831	0.868	0.502	3.4e-187

TAIR\|locus:2157383 CLPC1 "CLPC homologue 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3158 (1116.7 bits), Expect = 0., Sum P(2) = 0.
 Identities = 638/757 (84%), Positives = 664/757 (87%)

Query:    95 FTEKAIKVIMLAQEEARRLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVI 154
             FT +A +V+ L+ EEAR+LGHNYIGS             VAARVLENLGADPSNIRTQVI
Sbjct:   173 FTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVI 232

Query:   155 RMXXXXXXXXXXXXXXXXXXNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILG 214
             RM                  NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILG
Sbjct:   233 RMVGENNEVTANVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILG 291

Query:   215 RRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEF 274
             RRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVP+TIEGKKVITLDMGLLVAGTKYRGEF
Sbjct:   292 RRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEF 351

Query:   275 EERLKKLMEEIKQSDEIILFIDEVHTLXXXXXXXXXXXXXXXLKPSLARGELQCIGATTL 334
             EERLKKLMEEI+QSDEIILFIDEVHTL               LKP+LARGELQCIGATTL
Sbjct:   352 EERLKKLMEEIRQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTL 411

Query:   335 DEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQL 394
             DEYRKHIEKDPALERRFQPVKVPEP+VDETIQILKGLRERYEIHHKLRYTDE+LV+AAQL
Sbjct:   412 DEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDESLVAAAQL 471

Query:   395 SYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFE 454
             SYQYISDRFLPDKAIDLIDEAGSRVRLRHAQ+PEEARELEKELRQITKEKNEAVRGQDFE
Sbjct:   472 SYQYISDRFLPDKAIDLIDEAGSRVRLRHAQVPEEARELEKELRQITKEKNEAVRGQDFE 531

Query:   455 KAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKV 514
             KAG LRDRE++L+A++SA+  KGKEMSKAE+E G+ GP+VTE DIQHIVS+WTGIPVEKV
Sbjct:   532 KAGTLRDREIELRAEVSAIQAKGKEMSKAESETGEEGPMVTESDIQHIVSSWTGIPVEKV 591

Query:   515 STDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK 574
             STDESDRLLKMEETLHKR+IGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK
Sbjct:   592 STDESDRLLKMEETLHKRIIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK 651

Query:   575 SELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY 634
             SELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY
Sbjct:   652 SELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY 711

Query:   635 TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR 694
             TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR
Sbjct:   712 TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR 771

Query:   695 IGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLK 754
             IGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADI+LK
Sbjct:   772 IGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADILLK 831

Query:   755 EVFDRLKTKDIELQXXXXXXXXXXXXGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE 814
             EVF+RLK K+IELQ            GYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE
Sbjct:   832 EVFERLKKKEIELQVTERFKERVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE 891

Query:   815 XXXXXXXXXXXXXXTVLNGSSGAP----ESLADPLPV 847
                           TVLNG SG P    E   D LPV
Sbjct:   892 GDSVIVDVDAEGNVTVLNGGSGTPTTSLEEQEDSLPV 928

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003677 "DNA binding" evidence=IEA

GO:0004518 "nuclease activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0006289 "nucleotide-excision repair" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016887 "ATPase activity" evidence=ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0019538 "protein metabolic process" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009532 "plastid stroma" evidence=IDA

GO:0005739 "mitochondrion" evidence=IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0009658 "chloroplast organization" evidence=IMP

GO:0031897 "Tic complex" evidence=TAS

GO:0045037 "protein import into chloroplast stroma" evidence=IMP

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0005618 "cell wall" evidence=IDA

GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IMP

GO:0045036 "protein targeting to chloroplast" evidence=IMP

GO:0005829 "cytosol" evidence=RCA

GO:0009706 "chloroplast inner membrane" evidence=IDA

GO:0009902 "chloroplast relocation" evidence=RCA

GO:0010027 "thylakoid membrane organization" evidence=RCA

GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA

GO:0034660 "ncRNA metabolic process" evidence=RCA

GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA

GO:0042793 "transcription from plastid promoter" evidence=RCA

GO:0009536 "plastid" evidence=IDA

GO:0004176 "ATP-dependent peptidase activity" evidence=IDA

TAIR\|locus:2099433 HSP93-III [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3A9N1 CHY_2348 "Negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_2348 CHY_2348 "negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

UNIPROTKB\|Q81VV9 BAS0081 "Negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis (taxid:1392)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_0080 BA_0080 "negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|P0A522 clpC "Probable ATP-dependent Clp protease ATP-binding subunit" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

UNIPROTKB\|Q724I0 LMOf2365_0244 "ClpC ATPase" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_0057 DET_0057 "ATP-dependent Clp protease, ATP-binding subunit ClpC" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_1413 DET_1413 "chaperone ClpB" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P24428	CLPC_MYCLE	No assigned EC number	0.5710	0.8466	0.8466	yes	no
Q7F9I1	CLPC1_ORYSJ	No assigned EC number	0.9035	0.9021	0.8333	yes	no
Q7CU92	CLPB_AGRT5	No assigned EC number	0.4923	0.8419	0.8169	yes	no
Q2YSD6	CLPC_STAAB	No assigned EC number	0.5712	0.8478	0.8789	yes	no
P35100	CLPC_PEA	No assigned EC number	0.9100	0.9021	0.8297	N/A	no
P51332	CLPC_PORPU	No assigned EC number	0.7211	0.8808	0.9098	N/A	no
Q9FI56	CLPC1_ARATH	No assigned EC number	0.9156	0.9009	0.8223	yes	no
Q74FF1	CLPB_GEOSL	No assigned EC number	0.4936	0.8419	0.8254	yes	no
Q9SXJ7	CLPC2_ARATH	No assigned EC number	0.8669	0.9033	0.8046	no	no
Q9PKA8	CLPC_CHLMU	No assigned EC number	0.5088	0.8242	0.8034	yes	no
P31542	CLPAB_SOLLC	No assigned EC number	0.9283	0.9021	0.8288	N/A	no
P31541	CLPAA_SOLLC	No assigned EC number	0.9193	0.9021	0.8261	N/A	no
Q2G0P5	CLPC_STAA8	No assigned EC number	0.5684	0.8478	0.8789	yes	no
Q1XDF4	CLPC_PORYE	No assigned EC number	0.7224	0.8808	0.9098	N/A	no
Q9TM05	CLPC_CYACA	No assigned EC number	0.7019	0.8820	0.8758	N/A	no
P49574	CLPC_ODOSI	No assigned EC number	0.5325	0.8573	0.8214	N/A	no
P63286	CLPB_ECOL6	No assigned EC number	0.4867	0.8431	0.8343	yes	no
Q72IK9	CLPB_THET2	No assigned EC number	0.5517	0.7535	0.7482	yes	no
P37571	CLPC_BACSU	No assigned EC number	0.5923	0.8537	0.8938	yes	no
Q53LY0	CLPC3_ORYSJ	No assigned EC number	0.7555	0.8974	0.8165	no	no
Q9RA63	CLPB_THET8	No assigned EC number	0.5517	0.7535	0.7482	yes	no
P0A522	CLPC_MYCTU	No assigned EC number	0.5751	0.8466	0.8466	yes	no
P0A523	CLPC_MYCBO	No assigned EC number	0.5751	0.8466	0.8466	yes	no
O84288	CLPC_CHLTR	No assigned EC number	0.5054	0.8242	0.8185	yes	no
Q2QVG9	CLPC2_ORYSJ	No assigned EC number	0.9005	0.8974	0.8280	yes	no
Q8NXY8	CLPC_STAAW	No assigned EC number	0.5671	0.8478	0.8789	yes	no
Q99W78	CLPC_STAAM	No assigned EC number	0.5684	0.8478	0.8789	yes	no
Q4L3I4	CLPC_STAHJ	No assigned EC number	0.5806	0.8502	0.875	yes	no
Q2FJB5	CLPC_STAA3	No assigned EC number	0.5684	0.8478	0.8789	N/A	no
P46523	CLPA_BRANA	No assigned EC number	0.8884	0.8985	0.8718	N/A	no
Q8EU05	CLPB_OCEIH	No assigned EC number	0.6029	0.8584	0.8998	yes	no
Q54316	HLYB_TREHY	No assigned EC number	0.5232	0.8466	0.8671	yes	no
Q8CQ88	CLPC_STAES	No assigned EC number	0.5780	0.8478	0.8800	yes	no
Q7A797	CLPC_STAAN	No assigned EC number	0.5684	0.8478	0.8789	yes	no
Q6GJE4	CLPC_STAAR	No assigned EC number	0.5684	0.8478	0.8789	yes	no
P0C281	CLPC_STAAC	No assigned EC number	0.5684	0.8478	0.8789	yes	no
O78410	CLPC_GUITH	No assigned EC number	0.7336	0.8525	0.8827	yes	no
Q5HRM8	CLPC_STAEQ	No assigned EC number	0.5780	0.8478	0.8800	yes	no
Q49V34	CLPC_STAS1	No assigned EC number	0.5821	0.8478	0.8768	yes	no
Q6GBW3	CLPC_STAAS	No assigned EC number	0.5684	0.8478	0.8789	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.4	0.691
3rd Layer	3.6.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	CLPC1	CLPC1; ATP binding / ATP-dependent peptidase/ ATPase; Encodes a protein that is similar to ATP-dependent Clp protease ATP-binding subunit / ClpC. Involved in protein import into the chloroplast. May provide ATP source that drives the TIC (Translocon at the Inner envelope membrane of Chloroplasts) translocation machinery. (929 aa)
		(Arabidopsis thaliana)
Predicted Functional Partners:
	TIC40	TIC40; chloroplast protein import (Tic40) (447 aa)		•	•	•	0.996
	PCLPP	unknown protein; Encodes the only ClpP (caseinolytic protease) encoded within the plastid genom [...] (196 aa)				•	0.989
	TIC110	TIC110 (TRANSLOCON AT THE INNER ENVELOPE MEMBRANE OF CHLOROPLASTS 110); Encodes a protein thoug [...] (1016 aa)			•	•	0.986
	CLPP6	CLPP6; serine-type endopeptidase; One of several nuclear-encoded ClpPs (caseinolytic protease). [...] (271 aa)	•			•	0.983
	CLPX	CLPX; ATP binding / ATPase/ nucleoside-triphosphatase/ nucleotide binding / protein binding; CL [...] (579 aa)				•	0.926
	CLPR1	CLPR1; serine-type endopeptidase; Encodes a ClpP-related sequence. Though similar to ClpP prote [...] (387 aa)	•			•	0.844
	CLPP4	CLPP4 (CLP PROTEASE P4); serine-type endopeptidase; One of several nuclear-encoded ClpPs (casei [...] (292 aa)				•	0.840
	VAR2	VAR2 (VARIEGATED 2); ATP-dependent peptidase/ ATPase/ metallopeptidase/ zinc ion binding; Metal [...] (695 aa)	•			•	0.834
	CLPP3	CLPP3; serine-type endopeptidase; One of several nuclear-encoded ClpPs (caseinolytic protease). [...] (309 aa)				•	0.833
	TIC20	TIC20 (TRANSLOCON AT THE INNER ENVELOPE MEMBRANE OF CHLOROPLASTS 20); Tic20 is believed to func [...] (274 aa)				•	0.821

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		848
CHL00095		821	CHL00095, clpC, Clp protease ATP binding subunit	0.0
COG0542		786	COG0542, clpA, ATP-binding subunits of Clp proteas	0.0
TIGR03346		852	TIGR03346, chaperone_ClpB, ATP-dependent chaperone	0.0
PRK10865		857	PRK10865, PRK10865, protein disaggregation chapero	0.0
TIGR02639		730	TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi	0.0
TIGR03345		852	TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp	0.0
PRK11034		758	PRK11034, clpA, ATP-dependent Clp protease ATP-bin	5e-96
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	8e-88
PRK11034		758	PRK11034, clpA, ATP-dependent Clp protease ATP-bin	2e-82
pfam10431		81	pfam10431, ClpB_D2-small, C-terminal, D2-small dom	4e-27
smart01086		90	smart01086, ClpB_D2-small, C-terminal, D2-small do	1e-25
CHL00095		821	CHL00095, clpC, Clp protease ATP binding subunit	3e-21
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	4e-21
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	6e-18
pfam02861		53	pfam02861, Clp_N, Clp amino terminal domain	1e-16
smart00382		148	smart00382, AAA, ATPases associated with a variety	1e-14
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	7e-14
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	7e-12
COG0542		786	COG0542, clpA, ATP-binding subunits of Clp proteas	9e-12
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	4e-10
smart00382		148	smart00382, AAA, ATPases associated with a variety	2e-09
TIGR03346		852	TIGR03346, chaperone_ClpB, ATP-dependent chaperone	6e-09
TIGR02902		531	TIGR02902, spore_lonB, ATP-dependent protease LonB	3e-07
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	6e-07
pfam02151		36	pfam02151, UVR, UvrB/uvrC motif	3e-06
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	5e-06
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	3e-05
PRK05298		652	PRK05298, PRK05298, excinuclease ABC subunit B; Pr	6e-05
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	9e-05
TIGR02397		355	TIGR02397, dnaX_nterm, DNA polymerase III, subunit	1e-04
pfam13401		124	pfam13401, AAA_22, AAA domain	1e-04
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	2e-04
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	3e-04
TIGR00382		413	TIGR00382, clpX, endopeptidase Clp ATP-binding reg	5e-04
pfam13401		124	pfam13401, AAA_22, AAA domain	6e-04
pfam13191		154	pfam13191, AAA_16, AAA ATPase domain	0.001
TIGR02640		262	TIGR02640, gas_vesic_GvpN, gas vesicle protein Gvp	0.001
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	0.002
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	0.002
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	0.002
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	0.002
COG0556		663	COG0556, UvrB, Helicase subunit of the DNA excisio	0.003
PRK05896		605	PRK05896, PRK05896, DNA polymerase III subunits ga	0.003
TIGR00678		188	TIGR00678, holB, DNA polymerase III, delta' subuni	0.003

>gnl\|CDD\|214361 CHL00095, clpC, Clp protease ATP binding subunit	Back alignment and domain information

 Score = 1204 bits (3118), Expect = 0.0
 Identities = 528/752 (70%), Positives = 633/752 (84%), Gaps = 10/752 (1%)

Query: 81  GRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLE 140
           GR  GFV   +   FT +A +V+ ++ EEAR LGHNYIG+EHLLL LL EGEGVAARVLE
Sbjct: 68  GRGTGFVAVEI--PFTPRAKRVLEMSLEEARDLGHNYIGTEHLLLALLEEGEGVAARVLE 125

Query: 141 NLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVV 200
           NLG D S IR+ ++ ++GE  EA+   +G   S +K PTLEE+GTNLTK A +G LDPV+
Sbjct: 126 NLGVDLSKIRSLILNLIGEIIEAI---LGAEQSRSKTPTLEEFGTNLTKEAIDGNLDPVI 182

Query: 201 GRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLD 260
           GR+ +IERV+QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI + DVPD +E K VITLD
Sbjct: 183 GREKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRIVNRDVPDILEDKLVITLD 242

Query: 261 MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPS 320
           +GLL+AGTKYRGEFEERLK++ +EI++++ IIL IDEVHTLIGAGAAEGAIDAANILKP+
Sbjct: 243 IGLLLAGTKYRGEFEERLKRIFDEIQENNNIILVIDEVHTLIGAGAAEGAIDAANILKPA 302

Query: 321 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHK 380
           LARGELQCIGATTLDEYRKHIEKDPALERRFQPV V EPSV+ETI+IL GLR RYE HH 
Sbjct: 303 LARGELQCIGATTLDEYRKHIEKDPALERRFQPVYVGEPSVEETIEILFGLRSRYEKHHN 362

Query: 381 LRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQI 440
           L  +D+AL +AA+LS QYI+DRFLPDKAIDL+DEAGSRVRL +++LP  AREL+KELR+I
Sbjct: 363 LSISDKALEAAAKLSDQYIADRFLPDKAIDLLDEAGSRVRLINSRLPPAARELDKELREI 422

Query: 441 TKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQ 500
            K+K+EA+R QDFE A +LRDREM+++AQI+A+     +  K E E     PVVTE DI 
Sbjct: 423 LKDKDEAIREQDFETAKQLRDREMEVRAQIAAI----IQSKKTEEEKRLEVPVVTEEDIA 478

Query: 501 HIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRP 560
            IVSAWTGIPV K++  ES++LL MEETLHKR+IGQDEAV A+S+AIRRARVGLKNPNRP
Sbjct: 479 EIVSAWTGIPVNKLTKSESEKLLHMEETLHKRIIGQDEAVVAVSKAIRRARVGLKNPNRP 538

Query: 561 IASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYT 620
           IASF+FSGPTGVGK+EL KALA+Y+FGSE+AMIRLDMSE+ME+HTVSKLIGSPPGYVGY 
Sbjct: 539 IASFLFSGPTGVGKTELTKALASYFFGSEDAMIRLDMSEYMEKHTVSKLIGSPPGYVGYN 598

Query: 621 EGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMT 680
           EGGQLTEAVR++PYTVVLFDEIEKAHPD+FN++LQIL+DGRLTDSKGRT+DFKNTL+IMT
Sbjct: 599 EGGQLTEAVRKKPYTVVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMT 658

Query: 681 SNVGSSVIEKGGRRIGFDL-DYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQ 739
           SN+GS VIE     +GF+L +    +  Y R+ +LV EELKQ+FRPEFLNRLDE+IVFRQ
Sbjct: 659 SNLGSKVIETNSGGLGFELSENQLSEKQYKRLSNLVNEELKQFFRPEFLNRLDEIIVFRQ 718

Query: 740 LTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLL 799
           LTK +V EIA+IMLK +F RL  + I+L+VTER +  ++EEGYNP YGARPLRRAIMRLL
Sbjct: 719 LTKNDVWEIAEIMLKNLFKRLNEQGIQLEVTERIKTLLIEEGYNPLYGARPLRRAIMRLL 778

Query: 800 EDSMAEKMLAREIKEGDSVIVDVDSDGNVTVL 831
           ED +AE++L+ +IK GD +IVDV+ +  V +L
Sbjct: 779 EDPLAEEVLSFKIKPGDIIIVDVNDEKEVKIL 810

Length = 821

>gnl\|CDD\|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB	Back alignment and domain information

>gnl\|CDD\|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>gnl\|CDD\|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>gnl\|CDD\|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein	Back alignment and domain information

>gnl\|CDD\|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein	Back alignment and domain information

>gnl\|CDD\|214361 CHL00095, clpC, Clp protease ATP binding subunit	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|217254 pfam02861, Clp_N, Clp amino terminal domain	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB	Back alignment and domain information

>gnl\|CDD\|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|145355 pfam02151, UVR, UvrB/uvrC motif	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|233847 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|221970 pfam13191, AAA_16, AAA ATPase domain	Back alignment and domain information

>gnl\|CDD\|131688 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235638 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|233087 TIGR00678, holB, DNA polymerase III, delta' subunit	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		848
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	100.0
CHL00095		821	clpC Clp protease ATP binding subunit	100.0
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	100.0
PRK10865		857	protein disaggregation chaperone; Provisional	100.0
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	100.0
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	100.0
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	100.0
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.98
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.98
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.97
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.97
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.94
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.93
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.93
COG2204		464	AtoC Response regulator containing CheY-like recei	99.93
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	99.92
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.91
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	99.91
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.91
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.91
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.91
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.9
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.9
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.89
CHL00195		489	ycf46 Ycf46; Provisional	99.89
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.88
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.88
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.88
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.88
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.87
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.87
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.87
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.87
CHL00195		489	ycf46 Ycf46; Provisional	99.86
CHL00181		287	cbbX CbbX; Provisional	99.86
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.86
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.86
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.86
PRK15424		538	propionate catabolism operon regulatory protein Pr	99.85
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.85
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.85
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	99.85
COG1221		403	PspF Transcriptional regulators containing an AAA-	99.84
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.84
PRK05022		509	anaerobic nitric oxide reductase transcription reg	99.84
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.82
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.82
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	99.82
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.82
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.81
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	99.81
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.81
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	99.81
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.81
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.8
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.8
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.8
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	99.8
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.8
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.8
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.8
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.8
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.8
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.79
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.79
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.79
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	99.79
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.78
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.78
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.78
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.78
KOG2028		554	consensus ATPase related to the helicase subunit o	99.78
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.78
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.78
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.78
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.77
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.77
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	99.77
CHL00176		638	ftsH cell division protein; Validated	99.76
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.76
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	99.76
CHL00181		287	cbbX CbbX; Provisional	99.76
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.75
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.75
CHL00095		821	clpC Clp protease ATP binding subunit	99.75
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	99.75
PRK13342		413	recombination factor protein RarA; Reviewed	99.75
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.74
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	99.74
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.74
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.74
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.74
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.74
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.74
PLN03025		319	replication factor C subunit; Provisional	99.73
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	99.73
PRK15115		444	response regulator GlrR; Provisional	99.73
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.73
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.73
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	99.73
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.73
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.72
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.72
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.72
CHL00206		2281	ycf2 Ycf2; Provisional	99.71
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.71
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.71
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.71
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.71
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.7
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.7
PRK13341		725	recombination factor protein RarA/unknown domain f	99.7
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.69
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.69
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.69
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.69
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.69
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.69
PLN03025		319	replication factor C subunit; Provisional	99.68
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.68
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.68
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.68
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	99.68
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.68
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.68
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.68
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.68
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.67
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.67
PRK10365		441	transcriptional regulatory protein ZraR; Provision	99.67
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.67
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.67
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.66
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.66
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK04132		846	replication factor C small subunit; Provisional	99.66
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.65
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.65
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.65
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	99.65
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.64
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.64
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.64
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.64
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.64
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.64
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.64
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.64
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.63
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.63
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	99.63
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.63
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.63
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.63
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.63
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.63
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.63
PHA02544		316	44 clamp loader, small subunit; Provisional	99.63
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.62
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.62
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.62
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.62
PRK12402		337	replication factor C small subunit 2; Reviewed	99.62
KOG2028		554	consensus ATPase related to the helicase subunit o	99.62
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.62
PRK04195		482	replication factor C large subunit; Provisional	99.62
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.61
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.61
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.61
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.61
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.61
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.61
PRK13342		413	recombination factor protein RarA; Reviewed	99.6
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.6
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.6
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.6
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.6
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.6
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.59
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.59
PF00004		132	AAA: ATPase family associated with various cellula	99.59
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.59
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.59
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.59
PRK13341		725	recombination factor protein RarA/unknown domain f	99.59
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.59
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.58
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.58
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.58
PRK12402		337	replication factor C small subunit 2; Reviewed	99.58
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.58
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.58
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.57
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.57
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.57
CHL00176		638	ftsH cell division protein; Validated	99.57
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.57
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.57
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.57
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.56
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.56
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.56
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.56
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.56
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.55
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.55
PRK08084		235	DNA replication initiation factor; Provisional	99.54
PRK04195		482	replication factor C large subunit; Provisional	99.54
PHA02544		316	44 clamp loader, small subunit; Provisional	99.54
PRK13531		498	regulatory ATPase RavA; Provisional	99.53
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.53
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.53
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.53
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.53
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.53
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.52
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.52
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.51
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.51
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.51
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.5
CHL00206		2281	ycf2 Ycf2; Provisional	99.49
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.49
PHA02244		383	ATPase-like protein	99.49
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.49
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.49
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.49
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.48
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.48
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.48
PRK06893		229	DNA replication initiation factor; Validated	99.47
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.47
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	99.47
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.46
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.46
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.46
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.46
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.45
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.45
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.45
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.44
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.44
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.44
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.43
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.43
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.43
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.42
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.42
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.42
PRK05642		234	DNA replication initiation factor; Validated	99.42
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.42
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.42
PRK12422		445	chromosomal replication initiation protein; Provis	99.41
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.41
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.41
COG0714		329	MoxR-like ATPases [General function prediction onl	99.4
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.4
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.4
PF00004		132	AAA: ATPase family associated with various cellula	99.4
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.4
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.39
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.39
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.38
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.38
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.38
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.38
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.38
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.38
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	99.37
PRK08727		233	hypothetical protein; Validated	99.37
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.36
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.36
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.36
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.36
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.36
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.35
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.35
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.34
COG0606		490	Predicted ATPase with chaperone activity [Posttran	99.34
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.34
COG4650		531	RtcR Sigma54-dependent transcription regulator con	99.34
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.34
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.34
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.34
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.33
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.33
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.33
PRK06893		229	DNA replication initiation factor; Validated	99.33
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	99.33
PRK08084		235	DNA replication initiation factor; Provisional	99.32
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.32
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.32
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.31
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.31
PF07726		131	AAA_3: ATPase family associated with various cellu	99.3
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.3
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.3
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.3
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.29
PRK13765		637	ATP-dependent protease Lon; Provisional	99.29
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.29
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.29
PRK06871		325	DNA polymerase III subunit delta'; Validated	99.28
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	99.28
PRK08727		233	hypothetical protein; Validated	99.26
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	99.26
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.26
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.26
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.25
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.25
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.25
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	99.25
PRK07993		334	DNA polymerase III subunit delta'; Validated	99.24
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.24
PRK06090		319	DNA polymerase III subunit delta'; Validated	99.24
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.24
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	99.23
PRK06620		214	hypothetical protein; Validated	99.23
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.22
PRK06964		342	DNA polymerase III subunit delta'; Validated	99.22
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.21
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.21
smart00350		509	MCM minichromosome maintenance proteins.	99.21
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.21
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.2
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.2
PRK09087		226	hypothetical protein; Validated	99.2
PRK10865		857	protein disaggregation chaperone; Provisional	99.2
PRK05642		234	DNA replication initiation factor; Validated	99.18
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.18
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	99.17
PRK12422		445	chromosomal replication initiation protein; Provis	99.16
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.16
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.16
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.15
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.15
PRK09862		506	putative ATP-dependent protease; Provisional	99.14
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	99.14
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.14
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.14
PRK13531		498	regulatory ATPase RavA; Provisional	99.13
PRK04132		846	replication factor C small subunit; Provisional	99.13
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.13
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.13
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.11
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	99.1
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.1
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.09
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.09
PF10431		81	ClpB_D2-small: C-terminal, D2-small domain, of Clp	99.09
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.09
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.08
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.08
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.08
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.07
PRK07993		334	DNA polymerase III subunit delta'; Validated	99.07
PHA02244		383	ATPase-like protein	99.07
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.07
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.07
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.06
PRK06620		214	hypothetical protein; Validated	99.06
COG0714		329	MoxR-like ATPases [General function prediction onl	99.04
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.04
smart00350		509	MCM minichromosome maintenance proteins.	99.04
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.04
PRK05917		290	DNA polymerase III subunit delta'; Validated	99.04
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.04
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.03
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.02
PRK08699		325	DNA polymerase III subunit delta'; Validated	99.01
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	99.01
PRK06871		325	DNA polymerase III subunit delta'; Validated	99.0
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	98.99
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	98.99
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	98.98
PRK15424		538	propionate catabolism operon regulatory protein Pr	98.98
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.98
PRK07276		290	DNA polymerase III subunit delta'; Validated	98.98
PRK09087		226	hypothetical protein; Validated	98.96
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	98.96
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	98.95
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.95
PRK06964		342	DNA polymerase III subunit delta'; Validated	98.95
COG2204		464	AtoC Response regulator containing CheY-like recei	98.95
PF07726		131	AAA_3: ATPase family associated with various cellu	98.95
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	98.94
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	98.93
PRK05022		509	anaerobic nitric oxide reductase transcription reg	98.92
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.91
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	98.91
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	98.91
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	98.9
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	98.89
PRK05818		261	DNA polymerase III subunit delta'; Validated	98.89
PRK06090		319	DNA polymerase III subunit delta'; Validated	98.88
COG1221		403	PspF Transcriptional regulators containing an AAA-	98.87
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.85
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.85
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	98.83
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.82
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.8
PRK07132		299	DNA polymerase III subunit delta'; Validated	98.79
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.78
KOG1969		877	consensus DNA replication checkpoint protein CHL12	98.77
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.76
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.76
PRK12377		248	putative replication protein; Provisional	98.75
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	98.74
KOG1514		767	consensus Origin recognition complex, subunit 1, a	98.73
COG5245		3164	DYN1 Dynein, heavy chain [Cytoskeleton]	98.73
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.71
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	98.71
smart00382		148	AAA ATPases associated with a variety of cellular	98.7
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.7
COG1241		682	MCM2 Predicted ATPase involved in replication cont	98.7
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.7
PRK13765		637	ATP-dependent protease Lon; Provisional	98.69
PF02861		53	Clp_N: Clp amino terminal domain; InterPro: IPR004	98.69
PRK08116		268	hypothetical protein; Validated	98.68
COG0593		408	DnaA ATPase involved in DNA replication initiation	98.67
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.65
PRK12377		248	putative replication protein; Provisional	98.63
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	98.62
PF13173		128	AAA_14: AAA domain	98.61
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	98.59
PRK05917		290	DNA polymerase III subunit delta'; Validated	98.59
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	98.59
PRK09862		506	putative ATP-dependent protease; Provisional	98.59
smart00382		148	AAA ATPases associated with a variety of cellular	98.58
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	98.54
PRK08116		268	hypothetical protein; Validated	98.54
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.53
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.53
PRK15455		644	PrkA family serine protein kinase; Provisional	98.52
PRK07952		244	DNA replication protein DnaC; Validated	98.51
PF13173		128	AAA_14: AAA domain	98.51
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	98.49
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	98.48
PRK07952		244	DNA replication protein DnaC; Validated	98.47
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	98.47
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.47
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	98.46
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.44
PRK08181		269	transposase; Validated	98.42
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	98.41
PRK06835		329	DNA replication protein DnaC; Validated	98.4
PRK15115		444	response regulator GlrR; Provisional	98.4
PRK07276		290	DNA polymerase III subunit delta'; Validated	98.4
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.39
PRK07132		299	DNA polymerase III subunit delta'; Validated	98.38
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.37
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.37
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	98.37
PRK06526		254	transposase; Provisional	98.35
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	98.35
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	98.35
KOG1808		1856	consensus AAA ATPase containing von Willebrand fac	98.33
PRK06581		263	DNA polymerase III subunit delta'; Validated	98.32
PRK06526		254	transposase; Provisional	98.3
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.29
PF05729		166	NACHT: NACHT domain	98.27
KOG3595		1395	consensus Dyneins, heavy chain [Cytoskeleton]	98.27
PRK06835		329	DNA replication protein DnaC; Validated	98.27
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	98.25
PRK06921		266	hypothetical protein; Provisional	98.25
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.24
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.24
PRK08181		269	transposase; Validated	98.22
PF12780		268	AAA_8: P-loop containing dynein motor region D4; I	98.2
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	98.2
PRK05818		261	DNA polymerase III subunit delta'; Validated	98.2
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.2
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	98.2
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	98.19
PHA00729		226	NTP-binding motif containing protein	98.18
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.17
COG1241		682	MCM2 Predicted ATPase involved in replication cont	98.17
PRK09183		259	transposase/IS protein; Provisional	98.17
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	98.15
PRK08939		306	primosomal protein DnaI; Reviewed	98.14
PRK10365		441	transcriptional regulatory protein ZraR; Provision	98.14
PF05729		166	NACHT: NACHT domain	98.13
KOG1514		767	consensus Origin recognition complex, subunit 1, a	98.11
PRK09183		259	transposase/IS protein; Provisional	98.1
PRK08939		306	primosomal protein DnaI; Reviewed	98.1
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	98.07
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	98.04
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	98.03
PRK06921		266	hypothetical protein; Provisional	98.03
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	98.02
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	98.02

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=4.8e-113  Score=976.47  Aligned_cols=703  Identities=57%  Similarity=0.923  Sum_probs=646.6

Q ss_pred             HhhHHHHHHHHHHHHHHHHhCCCCcCHHHHHHHHhhCCCchHHHHHHHcCCChHHHHHHHHHHhccccccccCCCCCCCC
Q 003094           94 RFTEKAIKVIMLAQEEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVGAGVGGGSS  173 (848)
Q Consensus        94 ~~t~~a~~~l~~A~~~A~~~~~~~i~~eHlLlall~~~~~~a~~iL~~~gv~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  173 (848)
                      .+|+...++++.|..+|+..++.+|+++|||+|++.++++.+..+|...+++...+...+.. +......     ....+
T Consensus        73 ~~s~~~~~~~~~a~~~a~~~~~~~v~~~~llla~~~~~~~~~~~~l~~~~~~~~~~~~~~~~-~~~~~~~-----~~~~~  146 (786)
T COG0542          73 YLSPRLKRVLERAWLLAQSLGDEYVSTEHLLLALLNEPESVAAYILKKLGVTRKDVEELIEE-LRGGNEV-----DSKNA  146 (786)
T ss_pred             CCCHHHHHHHHHHHHHHHhccCccccHHHHHHHHhcccchHHHHHHHhccCCHHHHHHHHHH-Hhccccc-----CCccc
Confidence            46999999999999999999999999999999999999999999999999999988544433 3322211     11112


Q ss_pred             CCCccchHHhhhhhhhhhhcCCCCCccCChHHHHHHHHHhccCCCCCcEEECCCCCcHHHHHHHHHHHhhCCCCCCCCCC
Q 003094          174 GNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEG  253 (848)
Q Consensus       174 ~~~~~~l~~~~~~l~~~~~~~~ld~iiG~~~~~~~l~~~l~~~~~~~iLL~GppGtGKT~la~~la~~l~~~~~~~~l~~  253 (848)
                      ....+.|++|+.++++.++.+++||+|||++++++++++|.++.++|++|+|+||+|||+++..+|+++..+.||..|.+
T Consensus       147 ~~~~~~L~~y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~  226 (786)
T COG0542         147 EEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKD  226 (786)
T ss_pred             ccchhhHHHHhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCCHHHcC
Confidence            23448999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEEEeCCcccccccccchHHHHHHHHHHHHHhCCCeEEEEcccchhhhCCCCCc-hHHHHHHHhhhhcCCceEEEEee
Q 003094          254 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG-AIDAANILKPSLARGELQCIGAT  332 (848)
Q Consensus       254 ~~v~~~~~~~l~~~~~~~g~~~~~l~~l~~~~~~~~~~IL~IDEid~l~~~~~~~~-~~~~~~~L~~~l~~~~v~vI~at  332 (848)
                      .+++.+|++.+..|++|+|++|++++.+++++++.+++||||||+|.++++|...+ ..|+.|+|++.|.+|++.+||+|
T Consensus       227 ~~i~sLD~g~LvAGakyRGeFEeRlk~vl~ev~~~~~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaLARGeL~~IGAT  306 (786)
T COG0542         227 KRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSKNVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELRCIGAT  306 (786)
T ss_pred             CEEEEecHHHHhccccccCcHHHHHHHHHHHHhcCCCeEEEEechhhhcCCCcccccccchhhhhHHHHhcCCeEEEEec
Confidence            99999999999999999999999999999999998899999999999999988766 59999999999999999999999


Q ss_pred             ChHHHHhhhhcChhhhcccCCCcCCCCCHHHHHHHHHHHHHHHhhhhcCCCChHHHHHHHhhhhcccccCCChhhHHHHH
Q 003094          333 TLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLI  412 (848)
Q Consensus       333 n~~~~~~~~~~d~al~~Rf~~i~~~~p~~~e~~~Il~~~~~~~~~~~~~~~s~~~l~~l~~~s~~~~~~~~~p~~a~~ll  412 (848)
                      |..+|+++++.|+||.|||+.|.+.+|+.++...||+.+.++|+.+|++.|+|+++.+++.++.+|+.+|++|+||+|++
T Consensus       307 T~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~dR~LPDKAIDLi  386 (786)
T COG0542         307 TLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLPDKAIDLL  386 (786)
T ss_pred             cHHHHHHHhhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhcccCCCCchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhHHHHhhcCCchHHHHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHH-HHHHHHHhhhhhhhhhhccCCCC
Q 003094          413 DEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKA-QISALVDKGKEMSKAETEAGDVG  491 (848)
Q Consensus       413 ~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~  491 (848)
                      |+|++++++... .|..++.++.++..+..++..+.++++ +.+..+.+...+++. .+..+.....            .
T Consensus       387 DeA~a~~~l~~~-~p~~l~~~~~~~~~l~~e~~~~~~e~~-~~~k~~~~~~~~~~~~~~~~~~~~~~------------~  452 (786)
T COG0542         387 DEAGARVRLEID-KPEELDELERELAQLEIEKEALEREQD-EKEKKLIDEIIKLKEGRIPELEKELE------------A  452 (786)
T ss_pred             HHHHHHHHhccc-CCcchhHHHHHHHHHHHHHHHHhhhhh-HHHHHHHHHHHHHhhhhhhhHHHHHh------------h
Confidence            999999999988 999999999999999999998888877 333333333333332 1111111110            1


Q ss_pred             CccCHHHHHHHHHHhhCCCCcccCcchHHHHHHHHHHhhccccChHHHHHHHHHHHHHHHccCCCCCCCceEEEeecCCc
Q 003094          492 PVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTG  571 (848)
Q Consensus       492 ~~v~~~di~~~~~~~~g~p~~~~~~~~~~~l~~l~~~l~~~vigq~~~~~~l~~~~~~~~~~~~~~~~p~~~lLl~Gp~G  571 (848)
                       .|++++|..+++.|+|+|+.++...+...+.++++.|.+.|+||++|+..|.+++++.+.|+..|++|.+++||.||+|
T Consensus       453 -~v~~~~Ia~vv~~~TgIPv~~l~~~e~~kll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTG  531 (786)
T COG0542         453 -EVDEDDIAEVVARWTGIPVAKLLEDEKEKLLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTG  531 (786)
T ss_pred             -ccCHHHHHHHHHHHHCCChhhhchhhHHHHHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCc
Confidence             2999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHhcCCCCceEEecccccccccchhcccCCCCCCcccccccchhHHHHcCCCeEEEEcCCCcCChHHHH
Q 003094          572 VGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFN  651 (848)
Q Consensus       572 tGKT~lA~~la~~l~~~~~~~i~i~~~~~~~~~~~~~l~g~~~g~~g~~~~~~l~~~~~~~~~~Vl~lDEid~l~~~~~~  651 (848)
                      ||||++|++||..+|+.+.+++++|||+|++.|++++|+|+|||||||.+++.|++++++.|++||+||||+|+||+++|
T Consensus       532 VGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~n  611 (786)
T COG0542         532 VGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFN  611 (786)
T ss_pred             ccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCcEEEcCCCceeecCCeEEEEecCCCchhhhccCcccccccCCCcccccHHHHHHHHHHHHHhhcChhhhhcc
Q 003094          652 MMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRL  731 (848)
Q Consensus       652 ~Ll~~le~g~~~~~~g~~v~~~~~iiI~tsN~~~~~i~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ll~R~  731 (848)
                      .|||+||+|+++|+.|++|+|+|++||||||.|+..+...   .++     .....+..+++.+.+.+.++|+|+|++|+
T Consensus       612 ilLQVlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~---~~~-----~~~~~~~~~~~~v~~~l~~~F~PEFLNRi  683 (786)
T COG0542         612 LLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRD---ADG-----DDFADKEALKEAVMEELKKHFRPEFLNRI  683 (786)
T ss_pred             HHHHHhcCCeeecCCCCEEecceeEEEEecccchHHHHhh---ccc-----cccchhhhHHHHHHHHHHhhCCHHHHhhc
Confidence            9999999999999999999999999999999999987653   111     12234567788899999999999999999


Q ss_pred             CeEEEcCCCCHHHHHHHHHHHHHHHHHHHhcCCCeEeecHHHHHHHHHccCCCCCCchHHHHHHHHHHHHHHHHHHHccc
Q 003094          732 DEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLARE  811 (848)
Q Consensus       732 d~~i~f~~l~~~el~~I~~~~l~~~~~~~~~~~~~l~i~~~a~~~l~~~~~~~~~g~r~L~~~i~~~l~~~l~~~~l~~~  811 (848)
                      |.+|+|.||+.+++.+|++.+|.++..++..+++.+.+++++.++|++.||++.||+|+|+|.|++.++++|++.+|.+.
T Consensus       684 d~II~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~i~~~La~~iL~g~  763 (786)
T COG0542         684 DEIIPFNPLSKEVLERIVDLQLNRLAKRLAERGITLELSDEAKDFLAEKGYDPEYGARPLRRAIQQEIEDPLADEILFGK  763 (786)
T ss_pred             ccEEeccCCCHHHHHHHHHHHHHHHHHHHHhCCceEEECHHHHHHHHHhccCCCcCchHHHHHHHHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999988999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCEEEEEEcCC
Q 003094          812 IKEGDSVIVDVDSD  825 (848)
Q Consensus       812 ~~~~~~~~v~~~~~  825 (848)
                      +..|.++.|+++++
T Consensus       764 ~~~~~~v~v~~~~~  777 (786)
T COG0542         764 IEDGGTVKVDVDDE  777 (786)
T ss_pred             cCCCcEEEEEecCc
Confidence            99999999999973

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation []	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton]	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

Homologous Structure Templates