Citrus Sinensis ID: 003100

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------85
MSSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKRMHEKKAKEKEKRLLEQEKQLYQARVRSQIRTKLFDKADPDSETNQHKPMSPDEHVKALADRFMKEGAEDLWNEDDGPVKSEQRPRSGAEANQRPRLAGAPIDLRGLISDKRNSVNNSGNLNSGSNVKTRNYSVLSESKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDGSSTRDKAGFDTGNKAKPFARNLGNNRENGDSKNMSEFMKKKCFVGKRRFKRNESSSSDDDSDIDSEDVDEKVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEISKNKLNGNGEKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLRK
ccHHHHHHccccccccHHHEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHcccccEEEEcccHHHHHHHccccccEEcccccEEEEEcHHHHHccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEEEccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHcccccccccccccc
ccEEEEEEccccccHHHHHHEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccHHHccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHccccEEEEEcccHHHHHHHccccEEEEcccEEEEEEcHHHHHHHcccHHHHHHHHHHccHHHcEEEEEccccHHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHcccccEEEEEEHHHccccccccEEEEEEcccccHHHHEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHccccccccccccc
msssvllqrskpltnilwfnrvfarpmgggprtfpgglnkWQWKRMHEKKAKEKEKRLLEQEKQLYQARVRSQIRTklfdkadpdsetnqhkpmspdeHVKALADRFMKEGaedlwneddgpvkseqrprsgaeanqrprlagapidlrglisdkrnsvnnsgnlnsgsnvktrnysvlseskfsdrsksaslifmpnlecndgetvipsrnvMDFVRRAyfsgtdkrnfcrndgsstrdkagfdtgnkakpfarnlgnnrengdsknmSEFMKKKcfvgkrrfkrnessssdddsdidsedvdekVEGWRDvkkmgssaslgkydmkitkrvplksledehdFEEQVELIRKEISKnklngngekkekreeepilsqkrfdecgispltIKALTAAGYIQMTRVQEATLSACLEGKDAVVKaktgtgksiAFLLPAIEAVLKATsssttqlvppiyvlILCPTRELASQIAAEAIALLKNHDGIGVLTLVggtrfkvdqrrlesdpcqilvatpgrlldhienksgLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHtyidtvglgsvetPVKIkqsclvapheLHFQILHHLLKEhilgtpdyKVIVFCSTGMVTSLLYLLLREMKMNVREmysrkpqlYRDRISEEFRASKRLILVTSdvsargmdypdvtsvvqvgippdreQYIHRLgrtgregkegegvlllapWEEYFLddlkdlpldklqlphlnpeiqlQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQsiglqrppplfRKTALKMglkdipgirlrk
msssvllqrskpltnilWFNRVFARPMgggprtfpgglnkWQWKRMHEKKAKEKEKRLLEQEKQLYQARVRSQIRTklfdkadpdsetnqhkpmspdEHVKALADRFMKEGAedlwneddgpvkseqrprsgaeanqrprlagapidLRGLISDKRNsvnnsgnlnsgsnvktrnySVLSeskfsdrsksaslifmpnlecndgetvipsrnvMDFVRRAYfsgtdkrnfcrndgsstrdkagfdtgnkakpfarnlgnnrengdsknmsefMKKKcfvgkrrfkrnessssdddsdidsedvdekvegwrdvkkmgssaslgkydmkitkrvplksledehDFEEQVELIRkeisknklngngekkekreeepilsqkrfdecgiSPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKAtsssttqlvpPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVdqrrlesdpcqilvatpgrlldhieNKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRrqsllfsatmpkevRRISQLVLKREHTYidtvglgsveTPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREmysrkpqlyrDRISEEFRASKRLILVtsdvsargmdypdvtsvvqvgippdrEQYIHRLgrtgregkegEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFaqsiglqrppplfrktalkmglkdipgirlrk
MSSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKRMHekkakekekrlleqekqlyqARVRSQIRTKLFDKADPDSETNQHKPMSPDEHVKALADRFMKEGAEDLWNEDDGPVKSEQRPRSGAEANQRPRLAGAPIDLRGLISDKRnsvnnsgnlnsgsnvKTRNYSVLSESKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDGSSTRDKAGFDTGNKAKPFARNLGNNRENGDSKNMSEFMKKKCFVGKRRFKRNessssdddsdidsedvdeKVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEISknklngngekkekreeePILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHrlgrtgregkegegVLLLAPWEEYFlddlkdlpldklqlphlNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLRK
***********PLTNILWFNRVFARPMGGGPRTFPGGLNKWQWK****************************************************************************************************************************************************LIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNF******************************************************************************************************************************************************FDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVL************PIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMG***********
*************TNILWFNRVFARPMGGGPRTFPGGLNKWQW********************QLYQARVR*********************************************************************************************************************************************************************************************************************************************************************************************************************FDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATS****QLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLD*********************IDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPL*************PGI****
********RSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKR**********KRLLEQEKQLYQARVRSQIRTKLFDK***************DEHVKALADRFMKEGAEDLWNEDD****************QRPRLAGAPIDLRGLISDKRNSVNNSGNLNSGSNVKTRNYSVLSESKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDGSSTRDKAGFDTGNKAKPFARNLGNNRENGDSKNMSEFMKKKCFVGKRR**********************KVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEISKNKLNG************ILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLRK
*SSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKRMHEKKAKEKEKRLLEQEKQLYQARVRSQIRTKLFD*******************VKALADRFMKEGAEDLWNEDDGPV***********************************************************************************************************************************************************************************************************************EDE**FEEQVEL*R**I*KNK**************P**SQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQIRTKLFDKADPDSETNQHKPMSPDEHVKALADRFMKEGAEDLWNEDDGPVKSEQRPRSGAEANQRPRLAGAPIDLRGLISDKRNSVNNSGNLNSGSNVKTRNYSVLSESKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDGSSTRDKAGFDTGNKAKPFARNLGNNRENGDSKNMSEFMKKKCFVGKRRFKRNESSSSDDDSDIDSEDVDEKVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEISKNKLNGNGEKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query848 2.2.26 [Sep-21-2011]
Q9C8S9798 Probable DEAD-box ATP-dep yes no 0.932 0.991 0.582 0.0
O80792845 Putative DEAD-box ATP-dep yes no 0.910 0.913 0.580 0.0
Q6K7R9811 DEAD-box ATP-dependent RN yes no 0.931 0.974 0.536 0.0
Q9FNM7850 DEAD-box ATP-dependent RN no no 0.587 0.585 0.573 1e-170
Q9FFQ1716 DEAD-box ATP-dependent RN no no 0.564 0.668 0.580 1e-166
Q0DBU5547 DEAD-box ATP-dependent RN no no 0.633 0.981 0.530 1e-161
Q94C75563 DEAD-box ATP-dependent RN no no 0.555 0.836 0.581 1e-161
Q5ZBH5594 DEAD-box ATP-dependent RN no no 0.554 0.791 0.548 1e-156
Q0JL73536 DEAD-box ATP-dependent RN no no 0.547 0.865 0.555 1e-151
Q0UG00550 ATP-dependent RNA helicas N/A no 0.543 0.838 0.357 3e-68
>sp|Q9C8S9|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48 OS=Arabidopsis thaliana GN=RH48 PE=3 SV=1 Back     alignment and function desciption
 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/855 (58%), Positives = 628/855 (73%), Gaps = 64/855 (7%)

Query: 1   MSSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKRMHEKKAKEKEKRLLE 60
           M S +L +RS  +T  LW NR+ +R MGGGPRTFPGGLNKWQWKRMHEKKA+EKE +LL+
Sbjct: 1   MYSLILRERSGSITGSLW-NRISSRNMGGGPRTFPGGLNKWQWKRMHEKKAREKENKLLD 59

Query: 61  QEKQLYQARVRSQIRTKLFDKADPDSET----NQHKPMSPDEHVKALADRFMKEGAEDLW 116
           QEKQLY+AR+R++IR K++   D   +T      H PMSP EH+K LADRFMK GAED W
Sbjct: 60  QEKQLYEARIRTEIRAKMWGNPDSGEKTAKSKQSHGPMSPKEHIKTLADRFMKAGAEDFW 119

Query: 117 NEDDGPV-KSEQRPRSGAEANQRPRLAGAPIDLRGLISDKRNSVNNSGNLNSGSNVKTRN 175
           NE+DGPV KS+Q  RSG+++      + +PID+R L+S   +S+  +    S      R 
Sbjct: 120 NENDGPVKKSDQGSRSGSDSIDST--SNSPIDVRRLVSATCDSMGKNRVFGSSR----RG 173

Query: 176 YSVLSESKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDG 235
           +S +S  K ++ S            C++G+         DF                   
Sbjct: 174 FSSMSRFKRNESS------------CDEGD---------DF------------------- 193

Query: 236 SSTRDKAGFDTGNKAKPFARNLGNNREN-GDSKNMSEFMKKKCFVGKRRFKRNESSSSDD 294
               D    DT     PF+      +E    S+++   ++ K   G+R+F++N+SS+   
Sbjct: 194 ----DAKKLDT---LSPFSPKFAGTKEKVKSSRSVVGVIRNKGLFGRRKFRKNDSSTE-- 244

Query: 295 DSDIDSEDVDEKVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKE 354
             D D E  + K+ GW D++K GSSASLG +D+K+TKRV     ++E      +  +R++
Sbjct: 245 -EDSDEEGDEGKMIGWMDMRKTGSSASLGNHDIKLTKRVNRNVTDEELYPPLDINTVRED 303

Query: 355 ISKNKLNGNGEKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACL 414
           +SK K   N  ++++   + I S KRFDE  ISPLT+KAL+A+G ++MTRVQ+ATLS CL
Sbjct: 304 LSKRKSVDNVMEEKQEPHDSIYSAKRFDESCISPLTLKALSASGILKMTRVQDATLSECL 363

Query: 415 EGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSST-TQLVPPIYVLILCPTRELASQIAA 473
           +GKDA+VKAKTGTGKS+AFLLPAIE VLKA +S      V PI+ LILCPTRELASQIAA
Sbjct: 364 DGKDALVKAKTGTGKSMAFLLPAIETVLKAMNSGKGVNKVAPIFALILCPTRELASQIAA 423

Query: 474 EAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLM 533
           E  ALLK HDGIGV TL+GGTRFK+DQ+RLES+PCQIL+ATPGRLLDHIENKSGL+ RLM
Sbjct: 424 EGKALLKFHDGIGVQTLIGGTRFKLDQQRLESEPCQILIATPGRLLDHIENKSGLTSRLM 483

Query: 534 GLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTY 593
            LK+ ++DEAD LLDLGFR+DVE I+DCLPR+RQSLLFSAT+PKEVRR+SQLVLKR+H+Y
Sbjct: 484 ALKLFIVDEADLLLDLGFRRDVEKIIDCLPRQRQSLLFSATIPKEVRRVSQLVLKRDHSY 543

Query: 594 IDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLL 653
           IDT+GLG VET  K++QSC+VAPHE HF ++ HLLKEHI  TPDYK+IVFCSTGMVTSL+
Sbjct: 544 IDTIGLGCVETHDKVRQSCIVAPHESHFHLVPHLLKEHINNTPDYKIIVFCSTGMVTSLM 603

Query: 654 YLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVG 713
           Y LLREMK+NVRE+++RKPQL+R R+S+EF+ S RLILVTSDVSARGM+YPDVT V+QVG
Sbjct: 604 YTLLREMKLNVREIHARKPQLHRTRVSDEFKESNRLILVTSDVSARGMNYPDVTLVIQVG 663

Query: 714 IPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQM 773
           IP DREQYIHRLGRTGREGK GEG+LL+APWE YFLD+LKDLPL+ +  P L+  ++ Q+
Sbjct: 664 IPSDREQYIHRLGRTGREGKGGEGLLLIAPWERYFLDELKDLPLEPIPAPDLDSIVKHQV 723

Query: 774 DNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTA 833
           D  MAKID ++KEAAYHAWLGYYNS+RE GRDKTTL ELAN+F  SIGL++PP LFR+TA
Sbjct: 724 DQSMAKIDTSIKEAAYHAWLGYYNSVRETGRDKTTLAELANRFCHSIGLEKPPALFRRTA 783

Query: 834 LKMGLKDIPGIRLRK 848
           +KMGLK I GI +RK
Sbjct: 784 VKMGLKGISGIPIRK 798

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|O80792|RH33_ARATH Putative DEAD-box ATP-dependent RNA helicase 33 OS=Arabidopsis thaliana GN=RH33 PE=3 SV=1 Back     alignment and function description
>sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 Back     alignment and function description
>sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 Back     alignment and function description
>sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 Back     alignment and function description
>sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 Back     alignment and function description
>sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 Back     alignment and function description
>sp|Q0UG00|MS116_PHANO ATP-dependent RNA helicase MSS116, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSS116 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
255537383771 dead box ATP-dependent RNA helicase, put 0.898 0.988 0.643 0.0
449452480813 PREDICTED: putative DEAD-box ATP-depende 0.935 0.975 0.614 0.0
224074899798 predicted protein [Populus trichocarpa] 0.922 0.979 0.644 0.0
224053943784 predicted protein [Populus trichocarpa] 0.910 0.984 0.628 0.0
15221724798 putative DEAD-box ATP-dependent RNA heli 0.932 0.991 0.582 0.0
15226161845 putative DEAD-box ATP-dependent RNA heli 0.910 0.913 0.580 0.0
297837071808 hypothetical protein ARALYDRAFT_893124 [ 0.943 0.990 0.581 0.0
297837065793 hypothetical protein ARALYDRAFT_315081 [ 0.919 0.983 0.549 0.0
413939551818 putative DEAD-box ATP-dependent RNA heli 0.941 0.975 0.543 0.0
242067048823 hypothetical protein SORBIDRAFT_04g03793 0.936 0.964 0.538 0.0
>gi|255537383|ref|XP_002509758.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223549657|gb|EEF51145.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/851 (64%), Positives = 654/851 (76%), Gaps = 89/851 (10%)

Query: 2   SSSVLLQRSKPLTNILWFNRVFARPMGGGPRTFPGGLNKWQWKRMHEKKAKEKEKRLLEQ 61
           S SV+L+RSK +++ L   R+F R MGGGPRTFPGGLNKWQWKR+HEK+AKEKEK LLEQ
Sbjct: 4   SISVILRRSKTVSDHLQ-TRIFTRLMGGGPRTFPGGLNKWQWKRLHEKRAKEKEKSLLEQ 62

Query: 62  EKQLYQARVRSQIRTKLFDKADPDSETNQHKPMSPDEHVKALADRFMKEGAEDLWNEDDG 121
           EKQLYQAR+RSQIR+KL  + D +  TN +   SP +H+KALADRFMKEGAEDLWNEDDG
Sbjct: 63  EKQLYQARIRSQIRSKLAGEPDSNPNTNNYSATSPKDHIKALADRFMKEGAEDLWNEDDG 122

Query: 122 PVKSEQRPRSGAEANQRPRLAGAPIDLRGLISDKRNSVNNSGNLNSGSNVKTRNYSVLSE 181
           P+ S Q P+S    NQR    G         S++R      G++N+  +++         
Sbjct: 123 PLTS-QLPKS----NQRSGSIG---------SNQR-----PGSINTPIDLR--------- 154

Query: 182 SKFSDRSKSASLIFMPNLECNDGETVIPSRNVMDFVRRAYFSGTDKRNFCRNDGSSTRDK 241
                                  + ++ +R+V +F   +Y + T  R +  N        
Sbjct: 155 -----------------------KVMLEARSVHNFENLSY-NYTKTREYSVN-------- 182

Query: 242 AGFDTGNKAKPFARNLGNNRENGDSKNMSEFMKKKCFVGK--RRFKRNESSSSDDDSDID 299
             F+ G K                  N S+ +KK+  + +  RRF+RNESSS +DD D D
Sbjct: 183 -SFNLGQK----------------QSNESDNLKKRGLISQKVRRFRRNESSSGEDDGDYD 225

Query: 300 SEDVDEKVEGWRDVKKM-GSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEI-SK 357
            ++  EK    R+V+++ GS A+LGKYD+KI+KRVPLK LE+E DFE     IR E+ +K
Sbjct: 226 CDNEREK--KGRNVREIIGSRAALGKYDVKISKRVPLKELEEETDFE----FIRYELENK 279

Query: 358 NKLNGNG-EKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEG 416
            KL+ N  EK E  E+E IL Q+RFDECGISPLT+KALT AGY+QMTRVQEATLSACLEG
Sbjct: 280 MKLDRNDREKSEIDEQESILGQRRFDECGISPLTVKALTTAGYVQMTRVQEATLSACLEG 339

Query: 417 KDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAI 476
           KDA+VKAKTGTGKS AFLLPAIEAVLKA SS+    V PIYVLILCPTRELASQIAAEA 
Sbjct: 340 KDALVKAKTGTGKSAAFLLPAIEAVLKAKSSNVKPRVSPIYVLILCPTRELASQIAAEAN 399

Query: 477 ALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLK 536
           A+LK HDGI V TLVGGTRFK DQ+RLE +PCQI+VATPGRLLDHIENK GLSV LMGLK
Sbjct: 400 AMLKYHDGISVQTLVGGTRFKDDQKRLEMNPCQIIVATPGRLLDHIENKGGLSVHLMGLK 459

Query: 537 MLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDT 596
           ML+LDEADHLLDLGFRKDVE I+DCLPR R SL+FSAT+PKEVRRISQLVLKREH +IDT
Sbjct: 460 MLILDEADHLLDLGFRKDVEKIIDCLPRERHSLMFSATIPKEVRRISQLVLKREHAFIDT 519

Query: 597 VGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLL 656
           VGLGSVETP K+KQ  +V PHELHFQ++HH LKEHIL TPDYKVIVFC+TGMVTSL+Y L
Sbjct: 520 VGLGSVETPSKVKQFSVVVPHELHFQVVHHFLKEHILQTPDYKVIVFCTTGMVTSLMYTL 579

Query: 657 LREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPP 716
           LREMKMNV+E++SRKPQLYR R+S+EFR S+R ILV+SDVSARGM+YPDVT V+QVG+P 
Sbjct: 580 LREMKMNVKEIHSRKPQLYRTRVSDEFRESRRSILVSSDVSARGMNYPDVTLVIQVGLPT 639

Query: 717 DREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQMDNH 776
           DREQYIHRLGRTGREGK+GEG+LLLAPWEEYFLD+L+DLPLDKL +P ++PE +L++++ 
Sbjct: 640 DREQYIHRLGRTGREGKDGEGILLLAPWEEYFLDELEDLPLDKLPIPDIDPETKLKVEDS 699

Query: 777 MAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKM 836
           M+KID++VKEAAYHAWLGYYNSIR+IGRDKTTLVELAN+F +SIGLQRPPPLFRKTALKM
Sbjct: 700 MSKIDSSVKEAAYHAWLGYYNSIRKIGRDKTTLVELANRFCESIGLQRPPPLFRKTALKM 759

Query: 837 GLKDIPGIRLR 847
           GLK+IPGIR+R
Sbjct: 760 GLKNIPGIRIR 770

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449452480|ref|XP_004143987.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase 33-like [Cucumis sativus] gi|449495891|ref|XP_004159976.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase 33-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074899|ref|XP_002304481.1| predicted protein [Populus trichocarpa] gi|222841913|gb|EEE79460.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224053943|ref|XP_002298050.1| predicted protein [Populus trichocarpa] gi|222845308|gb|EEE82855.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15221724|ref|NP_176514.1| putative DEAD-box ATP-dependent RNA helicase 48 [Arabidopsis thaliana] gi|75333533|sp|Q9C8S9.1|RH48_ARATH RecName: Full=Probable DEAD-box ATP-dependent RNA helicase 48 gi|12324351|gb|AAG52143.1|AC022355_4 putative RNA helicase; 42376-45543 [Arabidopsis thaliana] gi|332195955|gb|AEE34076.1| putative DEAD-box ATP-dependent RNA helicase 48 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15226161|ref|NP_178818.1| putative DEAD-box ATP-dependent RNA helicase 33 [Arabidopsis thaliana] gi|75318697|sp|O80792.1|RH33_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA helicase 33 gi|3327394|gb|AAC26676.1| putative RNA helicase [Arabidopsis thaliana] gi|330251036|gb|AEC06130.1| putative DEAD-box ATP-dependent RNA helicase 33 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297837071|ref|XP_002886417.1| hypothetical protein ARALYDRAFT_893124 [Arabidopsis lyrata subsp. lyrata] gi|297332258|gb|EFH62676.1| hypothetical protein ARALYDRAFT_893124 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297837065|ref|XP_002886414.1| hypothetical protein ARALYDRAFT_315081 [Arabidopsis lyrata subsp. lyrata] gi|297332255|gb|EFH62673.1| hypothetical protein ARALYDRAFT_315081 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|413939551|gb|AFW74102.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea mays] Back     alignment and taxonomy information
>gi|242067048|ref|XP_002454813.1| hypothetical protein SORBIDRAFT_04g037930 [Sorghum bicolor] gi|241934644|gb|EES07789.1| hypothetical protein SORBIDRAFT_04g037930 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
TAIR|locus:2038431798 AT1G63250 [Arabidopsis thalian 0.735 0.781 0.584 1.6e-228
TAIR|locus:2054688845 AT2G07750 [Arabidopsis thalian 0.741 0.744 0.581 2.3e-188
TAIR|locus:2159517850 PDE340 "PIGMENT DEFECTIVE 340" 0.766 0.764 0.453 1.2e-138
TAIR|locus:2159527563 STRS2 "STRESS RESPONSE SUPPRES 0.621 0.936 0.499 3.5e-130
UNIPROTKB|Q2KEF1568 MGCH7_ch7g1085 "Putative uncha 0.528 0.788 0.350 2e-63
ASPGD|ASPL0000028276567 AN5623 [Emericella nidulans (t 0.525 0.786 0.331 3.4e-54
UNIPROTKB|E2RC35 871 DDX10 "Uncharacterized protein 0.523 0.509 0.322 4e-53
MGI|MGI:1924841 875 Ddx10 "DEAD (Asp-Glu-Ala-Asp) 0.505 0.490 0.325 1.2e-52
RGD|1308990 874 Ddx10 "DEAD (Asp-Glu-Ala-Asp) 0.505 0.490 0.325 1.5e-52
UNIPROTKB|Q08DT0 876 DDX10 "Uncharacterized protein 0.525 0.509 0.317 1e-51
TAIR|locus:2038431 AT1G63250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1822 (646.4 bits), Expect = 1.6e-228, Sum P(2) = 1.6e-228
 Identities = 371/635 (58%), Positives = 459/635 (72%)

Query:   218 RRAYFSGTD-KRNFCRNDGSSTRDKAGFDTGNKAKPFARNLGNNREN-GDSKNMSEFMKK 275
             RR + S +  KRN    D     D    DT     PF+      +E    S+++   ++ 
Sbjct:   171 RRGFSSMSRFKRNESSCDEGDDFDAKKLDT---LSPFSPKFAGTKEKVKSSRSVVGVIRN 227

Query:   276 KCFVGKRRFKRNXXXXXXXXXXXXXXXXXXKVEGWRDVKKMGSSASLGKYDMKITKRVPL 335
             K   G+R+F++N                  K+ GW D++K GSSASLG +D+K+TKRV  
Sbjct:   228 KGLFGRRKFRKNDSSTEEDSDEEGDEG---KMIGWMDMRKTGSSASLGNHDIKLTKRVN- 283

Query:   336 KSLEDEHDFEE-QVELIRKEISXXXXXXXXXXXXXXXXXPILSQKRFDECGISPLTIKAL 394
             +++ DE  +    +  +R+++S                  I S KRFDE  ISPLT+KAL
Sbjct:   284 RNVTDEELYPPLDINTVREDLSKRKSVDNVMEEKQEPHDSIYSAKRFDESCISPLTLKAL 343

Query:   395 TAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSST-TQLV 453
             +A+G ++MTRVQ+ATLS CL+GKDA+VKAKTGTGKS+AFLLPAIE VLKA +S      V
Sbjct:   344 SASGILKMTRVQDATLSECLDGKDALVKAKTGTGKSMAFLLPAIETVLKAMNSGKGVNKV 403

Query:   454 PPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVA 513
              PI+ LILCPTRELASQIAAE  ALLK HDGIGV TL+GGTRFK+DQ+RLES+PCQIL+A
Sbjct:   404 APIFALILCPTRELASQIAAEGKALLKFHDGIGVQTLIGGTRFKLDQQRLESEPCQILIA 463

Query:   514 TPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSA 573
             TPGRLLDHIENKSGL+ RLM LK+ ++DEAD LLDLGFR+DVE I+DCLPR+RQSLLFSA
Sbjct:   464 TPGRLLDHIENKSGLTSRLMALKLFIVDEADLLLDLGFRRDVEKIIDCLPRQRQSLLFSA 523

Query:   574 TMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSCLVAPHELHFQILHHLLKEHIL 633
             T+PKEVRR+SQLVLKR+H+YIDT+GLG VET  K++QSC+VAPHE HF ++ HLLKEHI 
Sbjct:   524 TIPKEVRRVSQLVLKRDHSYIDTIGLGCVETHDKVRQSCIVAPHESHFHLVPHLLKEHIN 583

Query:   634 GTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVT 693
              TPDYK+IVFCSTGMVTSL+Y LLREMK+NVRE+++RKPQL+R R+S+EF+ S RLILVT
Sbjct:   584 NTPDYKIIVFCSTGMVTSLMYTLLREMKLNVREIHARKPQLHRTRVSDEFKESNRLILVT 643

Query:   694 SDVSARGMDYPDVTSVVQVGIPPDREQYIHXXXXXXXXXXXXXXVLLLAPWEEYFXXXXX 753
             SDVSARGM+YPDVT V+QVGIP DREQYIH              +LL+APWE YF     
Sbjct:   644 SDVSARGMNYPDVTLVIQVGIPSDREQYIHRLGRTGREGKGGEGLLLIAPWERYFLDELK 703

Query:   754 XXXXXXXXXXXXNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGRDKTTLVELA 813
                         +  ++ Q+D  MAKID ++KEAAYHAWLGYYNS+RE GRDKTTL ELA
Sbjct:   704 DLPLEPIPAPDLDSIVKHQVDQSMAKIDTSIKEAAYHAWLGYYNSVRETGRDKTTLAELA 763

Query:   814 NKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLRK 848
             N+F  SIGL++PP LFR+TA+KMGLK I GI +RK
Sbjct:   764 NRFCHSIGLEKPPALFRRTAVKMGLKGISGIPIRK 798
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
TAIR|locus:2054688 AT2G07750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159517 PDE340 "PIGMENT DEFECTIVE 340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159527 STRS2 "STRESS RESPONSE SUPPRESSOR 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KEF1 MGCH7_ch7g1085 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000028276 AN5623 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC35 DDX10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1924841 Ddx10 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308990 Ddx10 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DT0 DDX10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O80792RH33_ARATH3, ., 6, ., 4, ., 1, 30.58040.91030.9136yesno
Q6K7R9RH48_ORYSJ3, ., 6, ., 4, ., 1, 30.53610.93160.9741yesno
Q9C8S9RH48_ARATH3, ., 6, ., 4, ., 1, 30.58240.93270.9912yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.III.588.1
hypothetical protein (798 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.8412.1.1
annotation not avaliable (96 aa)
  •     0.505
eugene3.68280001
hypothetical protein (65 aa)
  •     0.505
estExt_fgenesh4_pg.C_1310004
hypothetical protein (402 aa)
  •     0.464
grail3.10933000101
annotation not avaliable (102 aa)
  •     0.432

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-101
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-73
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 9e-73
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-55
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-55
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-54
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 7e-53
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-52
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-50
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-46
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-44
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 6e-41
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-39
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-37
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-33
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 5e-23
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-18
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-16
COG1205 851 COG1205, COG1205, Distinct helicase family with a 8e-15
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-13
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 5e-10
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-09
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-09
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 4e-07
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 3e-05
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 5e-04
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 8e-04
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 0.002
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  324 bits (832), Expect = e-101
 Identities = 148/396 (37%), Positives = 208/396 (52%), Gaps = 20/396 (5%)

Query: 354 EISKNKLNGNGEKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSAC 413
                KL         R EE       F   G+SP  ++AL   G+ + T +Q A +   
Sbjct: 6   YDRFVKLKSAHNVALSRGEEKT--PPEFASLGLSPELLQALKDLGFEEPTPIQLAAIPLI 63

Query: 414 LEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAA 473
           L G+D + +A+TGTGK+ AFLLP ++ +LK+              LIL PTRELA QIA 
Sbjct: 64  LAGRDVLGQAQTGTGKTAAFLLPLLQKILKSVERKYVS------ALILAPTRELAVQIAE 117

Query: 474 EAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLM 533
           E   L KN  G+ V  + GG   +     L+     I+VATPGRLLD I+      + L 
Sbjct: 118 ELRKLGKNLGGLRVAVVYGGVSIRKQIEALK-RGVDIVVATPGRLLDLIKRGK---LDLS 173

Query: 534 GLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKR-EHT 592
           G++ LVLDEAD +LD+GF  D+E I+  LP  RQ+LLFSATMP ++R +++  L      
Sbjct: 174 GVETLVLDEADRMLDMGFIDDIEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEI 233

Query: 593 YIDTVGLGSVETPVKIKQSCLVAPHELH-FQILHHLLKEHILGTPDYKVIVFCSTGMVTS 651
            +         T  KIKQ  L    E    ++L  LLK+   G    +VIVF  T  +  
Sbjct: 234 EVSVEK--LERTLKKIKQFYLEVESEEEKLELLLKLLKDEDEG----RVIVFVRTKRLVE 287

Query: 652 LLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQ 711
            L   LR+    V  ++   PQ  RDR  E+F+  +  +LV +DV+ARG+D PDV+ V+ 
Sbjct: 288 ELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVIN 347

Query: 712 VGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEY 747
             +P D E Y+HR+GRTGR G++G  +  +   EE 
Sbjct: 348 YDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEEEV 383

Length = 513
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 848
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 100.0
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.98
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.98
KOG0354 746 consensus DEAD-box like helicase [General function 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.96
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.96
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.96
PRK09694878 helicase Cas3; Provisional 99.96
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.96
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.95
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.95
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.95
PRK04914 956 ATP-dependent helicase HepA; Validated 99.95
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.95
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.94
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.94
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.94
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.94
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.93
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.93
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.93
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.91
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.91
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.91
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.91
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.88
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.85
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.85
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.84
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.84
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.83
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.82
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.82
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.82
PRK05298652 excinuclease ABC subunit B; Provisional 99.81
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.81
COG4096 875 HsdR Type I site-specific restriction-modification 99.8
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.8
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.78
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.78
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.77
smart00487201 DEXDc DEAD-like helicases superfamily. 99.77
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.76
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.73
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.73
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.7
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.68
KOG1123776 consensus RNA polymerase II transcription initiati 99.67
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.67
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.66
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.63
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.63
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.63
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.62
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.62
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.62
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.6
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.59
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.56
COG4889 1518 Predicted helicase [General function prediction on 99.54
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.54
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.53
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.52
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.5
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.48
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.46
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.44
smart0049082 HELICc helicase superfamily c-terminal domain. 99.44
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.43
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.4
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.35
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.34
PRK14873665 primosome assembly protein PriA; Provisional 99.3
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.27
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.18
KOG4439901 consensus RNA polymerase II transcription terminat 99.17
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.07
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.99
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.98
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 98.97
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.91
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.91
COG0610 962 Type I site-specific restriction-modification syst 98.9
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.88
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.69
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.39
PRK15483 986 type III restriction-modification system StyLTI en 98.38
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.3
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.12
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.05
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.01
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.91
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.9
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.89
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.77
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.65
PRK10536262 hypothetical protein; Provisional 97.53
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.42
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.41
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.38
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.38
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.34
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.27
KOG1803649 consensus DNA helicase [Replication, recombination 97.2
PF1324576 AAA_19: Part of AAA domain 97.14
KOG1001674 consensus Helicase-like transcription factor HLTF/ 97.09
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.06
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.99
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.9
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.88
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.74
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.51
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.47
KOG18051100 consensus DNA replication helicase [Replication, r 96.42
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.34
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.33
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.27
PF1395965 DUF4217: Domain of unknown function (DUF4217) 96.24
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.16
PRK14974336 cell division protein FtsY; Provisional 96.15
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.13
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.12
KOG1131 755 consensus RNA polymerase II transcription initiati 96.0
PRK08181269 transposase; Validated 95.92
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.88
PRK04296190 thymidine kinase; Provisional 95.88
TIGR00376637 DNA helicase, putative. The gene product may repre 95.85
PRK06526254 transposase; Provisional 95.85
PRK06921266 hypothetical protein; Provisional 95.81
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.81
PHA02533534 17 large terminase protein; Provisional 95.75
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.63
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.55
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.5
PRK07952244 DNA replication protein DnaC; Validated 95.47
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.45
smart00382148 AAA ATPases associated with a variety of cellular 95.34
KOG0383696 consensus Predicted helicase [General function pre 95.33
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.22
PRK11054684 helD DNA helicase IV; Provisional 95.15
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.89
PF13871278 Helicase_C_4: Helicase_C-like 94.77
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.72
PRK08116268 hypothetical protein; Validated 94.7
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.65
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 94.6
PRK12377248 putative replication protein; Provisional 94.54
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 94.54
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.54
PRK08727233 hypothetical protein; Validated 94.53
PRK06835329 DNA replication protein DnaC; Validated 94.26
PRK06893229 DNA replication initiation factor; Validated 94.23
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.13
PRK05642234 DNA replication initiation factor; Validated 94.1
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.05
cd01124187 KaiC KaiC is a circadian clock protein primarily f 93.97
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 93.94
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.84
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 93.81
PRK00149450 dnaA chromosomal replication initiation protein; R 93.69
PRK14087450 dnaA chromosomal replication initiation protein; P 93.64
KOG0298 1394 consensus DEAD box-containing helicase-like transc 93.64
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 93.62
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.53
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 93.5
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 93.4
PRK07471365 DNA polymerase III subunit delta'; Validated 93.4
PRK12402337 replication factor C small subunit 2; Reviewed 93.39
PRK14086617 dnaA chromosomal replication initiation protein; P 93.32
PRK05580 679 primosome assembly protein PriA; Validated 93.31
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.12
PTZ001121164 origin recognition complex 1 protein; Provisional 93.05
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.03
PHA02544316 44 clamp loader, small subunit; Provisional 92.8
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 92.76
PRK08084235 DNA replication initiation factor; Provisional 92.69
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 92.69
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.66
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 92.62
PRK08769319 DNA polymerase III subunit delta'; Validated 92.6
PHA03368738 DNA packaging terminase subunit 1; Provisional 92.54
PRK09183259 transposase/IS protein; Provisional 92.53
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 92.46
TIGR00595 505 priA primosomal protein N'. All proteins in this f 92.46
PRK04195482 replication factor C large subunit; Provisional 92.42
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.4
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.37
PRK12422445 chromosomal replication initiation protein; Provis 92.29
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.29
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 92.25
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 92.18
PLN03025319 replication factor C subunit; Provisional 92.18
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 92.17
PRK14088440 dnaA chromosomal replication initiation protein; P 91.99
PRK13833323 conjugal transfer protein TrbB; Provisional 91.79
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.76
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.75
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.73
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 91.58
PRK00771437 signal recognition particle protein Srp54; Provisi 91.57
PHA03333 752 putative ATPase subunit of terminase; Provisional 91.57
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.57
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.52
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 91.51
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 91.47
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 91.46
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 91.35
PRK14873 665 primosome assembly protein PriA; Provisional 91.34
PF13173128 AAA_14: AAA domain 91.32
PRK05707328 DNA polymerase III subunit delta'; Validated 91.29
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.17
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 91.16
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 91.02
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 91.02
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 90.95
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 90.73
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 90.72
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.64
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 90.62
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 90.57
PRK09112351 DNA polymerase III subunit delta'; Validated 90.46
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 90.36
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 90.34
PF00004132 AAA: ATPase family associated with various cellula 90.32
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 90.3
PRK06871325 DNA polymerase III subunit delta'; Validated 90.28
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 90.26
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 90.25
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 90.18
TIGR00064272 ftsY signal recognition particle-docking protein F 90.04
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 89.79
PRK11331459 5-methylcytosine-specific restriction enzyme subun 89.78
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 89.72
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 89.6
COG3973747 Superfamily I DNA and RNA helicases [General funct 89.59
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 89.52
PRK05973237 replicative DNA helicase; Provisional 89.42
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 89.08
COG1198 730 PriA Primosomal protein N' (replication factor Y) 89.01
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 89.0
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 88.88
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 88.81
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 88.79
PRK08939306 primosomal protein DnaI; Reviewed 88.68
PRK00440319 rfc replication factor C small subunit; Reviewed 88.68
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 88.52
COG3972660 Superfamily I DNA and RNA helicases [General funct 88.43
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 88.37
TIGR02928365 orc1/cdc6 family replication initiation protein. M 88.36
PRK06090319 DNA polymerase III subunit delta'; Validated 88.25
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 88.23
CHL00181287 cbbX CbbX; Provisional 88.13
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 87.97
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 87.8
PRK13341 725 recombination factor protein RarA/unknown domain f 87.48
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 87.48
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 87.47
PF05729166 NACHT: NACHT domain 87.43
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 87.43
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 87.3
PRK08533230 flagellar accessory protein FlaH; Reviewed 87.22
cd03115173 SRP The signal recognition particle (SRP) mediates 87.16
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 87.15
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 87.13
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 87.07
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 86.96
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 86.89
PTZ00293211 thymidine kinase; Provisional 86.88
PRK06964342 DNA polymerase III subunit delta'; Validated 86.87
COG0470325 HolB ATPase involved in DNA replication [DNA repli 86.82
PRK10867433 signal recognition particle protein; Provisional 86.77
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 86.74
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 86.73
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 86.67
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.67
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 86.64
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 86.58
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 86.39
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 86.3
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.29
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 86.22
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 86.11
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 86.09
PRK11823446 DNA repair protein RadA; Provisional 86.03
COG2256436 MGS1 ATPase related to the helicase subunit of the 85.94
PRK10416318 signal recognition particle-docking protein FtsY; 85.93
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 85.92
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 85.88
PRK06067234 flagellar accessory protein FlaH; Validated 85.87
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 85.84
COG0593408 DnaA ATPase involved in DNA replication initiation 85.79
PHA03372668 DNA packaging terminase subunit 1; Provisional 85.77
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 85.74
cd03239178 ABC_SMC_head The structural maintenance of chromos 85.74
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 85.69
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 85.67
PRK10689 1147 transcription-repair coupling factor; Provisional 85.48
PRK07993334 DNA polymerase III subunit delta'; Validated 85.47
PRK13342413 recombination factor protein RarA; Reviewed 85.27
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 84.97
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 84.96
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 84.86
PRK13851344 type IV secretion system protein VirB11; Provision 84.84
PHA00729226 NTP-binding motif containing protein 84.72
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.64
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 84.6
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 84.58
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 84.56
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 84.48
TIGR00959428 ffh signal recognition particle protein. This mode 84.43
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 84.39
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 84.3
PRK08699325 DNA polymerase III subunit delta'; Validated 84.25
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 84.21
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 84.13
KOG2028554 consensus ATPase related to the helicase subunit o 84.08
PRK03992389 proteasome-activating nucleotidase; Provisional 83.88
TIGR00767415 rho transcription termination factor Rho. Members 83.68
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 83.56
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 83.2
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 83.19
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 82.99
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 82.76
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.67
COG0552340 FtsY Signal recognition particle GTPase [Intracell 82.66
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 82.6
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 82.5
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 82.48
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 82.23
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 82.21
PRK13897606 type IV secretion system component VirD4; Provisio 82.19
PRK09087226 hypothetical protein; Validated 82.15
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 82.01
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 81.97
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 81.57
cd03246173 ABCC_Protease_Secretion This family represents the 81.49
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 81.46
KOG0347 731 consensus RNA helicase [RNA processing and modific 81.42
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 81.39
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 81.36
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 81.35
COG4626546 Phage terminase-like protein, large subunit [Gener 81.25
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 81.21
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 81.19
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 81.16
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 80.99
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 80.8
PRK07940394 DNA polymerase III subunit delta'; Validated 80.58
PF1355562 AAA_29: P-loop containing region of AAA domain 80.4
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 80.37
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 80.21
COG1618179 Predicted nucleotide kinase [Nucleotide transport 80.17
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-82  Score=687.70  Aligned_cols=464  Identities=47%  Similarity=0.696  Sum_probs=431.7

Q ss_pred             CCcccccCcccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHhCCCCEEEEcCCCCcchHHHHHHHHHHHHHhCCCCCCCC
Q 003100          373 EPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQL  452 (848)
Q Consensus       373 ~~~~~~~~f~~l~l~~~l~~~L~~~g~~~~t~iQ~~aI~~il~g~dvIv~a~TGSGKTlaflLPil~~l~~~~~~~~~~~  452 (848)
                      .++.....|+++.|++.++++++.+||..||++|+.+|+.++.|+|+++.|.||||||+||+||+++.+++.....+   
T Consensus        76 ~s~~~~~~f~~~~LS~~t~kAi~~~GF~~MT~VQ~~ti~pll~gkDvl~~AKTGtGKTlAFLiPaie~l~k~~~~~r---  152 (543)
T KOG0342|consen   76 DSITTTFRFEEGSLSPLTLKAIKEMGFETMTPVQQKTIPPLLEGKDVLAAAKTGTGKTLAFLLPAIELLRKLKFKPR---  152 (543)
T ss_pred             cchhhhhHhhccccCHHHHHHHHhcCccchhHHHHhhcCccCCCccceeeeccCCCceeeehhHHHHHHHhcccCCC---
Confidence            34555678999999999999999999999999999999999999999999999999999999999999998876544   


Q ss_pred             CCCeEEEEEcCcHHHHHHHHHHHHHHhhcCCCceEEEEeCCcchhHhhhhhhcCCCcEEEeChHHHHHHHHhccCccccc
Q 003100          453 VPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRL  532 (848)
Q Consensus       453 ~~~~~vLIL~PTreLa~Qi~~~l~~l~~~~~~i~v~~l~gg~~~~~~~~~l~~~~~~IIV~TPgrLl~~L~~~~~~~~~l  532 (848)
                       .++.+||||||||||.|++.++++++.+++++.+.+++||.+...++..+.+ +++|+|+|||||++||++.+++.  .
T Consensus       153 -~~~~vlIi~PTRELA~Q~~~eak~Ll~~h~~~~v~~viGG~~~~~e~~kl~k-~~niliATPGRLlDHlqNt~~f~--~  228 (543)
T KOG0342|consen  153 -NGTGVLIICPTRELAMQIFAEAKELLKYHESITVGIVIGGNNFSVEADKLVK-GCNILIATPGRLLDHLQNTSGFL--F  228 (543)
T ss_pred             -CCeeEEEecccHHHHHHHHHHHHHHHhhCCCcceEEEeCCccchHHHHHhhc-cccEEEeCCchHHhHhhcCCcch--h
Confidence             5789999999999999999999999999989999999999999999999987 79999999999999999998754  4


Q ss_pred             CCccEEEEecccccccccchhhHHHHHHhcCccceeEEEeccCChHHHHHHHHHhccceEEEeecCCCcccccceeeccc
Q 003100          533 MGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREHTYIDTVGLGSVETPVKIKQSC  612 (848)
Q Consensus       533 ~~l~~lVIDEAH~ll~~gf~~~l~~Il~~l~~~~Q~ll~SATl~~~v~~l~~~~l~~~~~~i~~~~~~~~~~~~~v~q~~  612 (848)
                      ..++++|+||||+++++||+..+.+|+..+|+.+|+++||||.+.+|+.+++..++.++.++++++.....++..+.|.|
T Consensus       229 r~~k~lvlDEADrlLd~GF~~di~~Ii~~lpk~rqt~LFSAT~~~kV~~l~~~~L~~d~~~v~~~d~~~~~The~l~Qgy  308 (543)
T KOG0342|consen  229 RNLKCLVLDEADRLLDIGFEEDVEQIIKILPKQRQTLLFSATQPSKVKDLARGALKRDPVFVNVDDGGERETHERLEQGY  308 (543)
T ss_pred             hccceeEeecchhhhhcccHHHHHHHHHhccccceeeEeeCCCcHHHHHHHHHhhcCCceEeecCCCCCcchhhcccceE
Confidence            56799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCChhhHHHHHHHHHHHHhhCCCCceEEEEEecchHHHHHHHHHHHhccceeeecCCcchhhHHHHHHHHhcCCceEEE
Q 003100          613 LVAPHELHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREMKMNVREMYSRKPQLYRDRISEEFRASKRLILV  692 (848)
Q Consensus       613 ~~~~~~~k~~~L~~lL~~~~~~~~~~kiLVF~~s~~~a~~l~~~L~~~~~~v~~lhg~ls~~~R~~i~~~F~~G~~~VLV  692 (848)
                      ++++.+.++..++.+|+++..   .+++||||+|+..+.+++.+|+...++|..|||+++|..|..++..|++.+..|||
T Consensus       309 vv~~~~~~f~ll~~~LKk~~~---~~KiiVF~sT~~~vk~~~~lL~~~dlpv~eiHgk~~Q~kRT~~~~~F~kaesgIL~  385 (543)
T KOG0342|consen  309 VVAPSDSRFSLLYTFLKKNIK---RYKIIVFFSTCMSVKFHAELLNYIDLPVLEIHGKQKQNKRTSTFFEFCKAESGILV  385 (543)
T ss_pred             EeccccchHHHHHHHHHHhcC---CceEEEEechhhHHHHHHHHHhhcCCchhhhhcCCcccccchHHHHHhhcccceEE
Confidence            999999999999999998753   38999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCccccccCCCCCeeEEcCCCCChhHHHHHhhccCCCCCCceEEEEeCcchhhHHHHhccCCCCcCCCCCCChHHHHH
Q 003100          693 TSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDLPLDKLQLPHLNPEIQLQ  772 (848)
Q Consensus       693 aTdvl~rGlDip~V~~VI~yd~P~s~~~yiQRiGRaGR~G~~G~~i~l~~~~e~~~l~~L~~~~l~~~~~~~~~~~~~~~  772 (848)
                      ||||++||+|||+|++|||||+|.++.+||||+|||||.|..|.+++|+.|+|.+|+++|+++++++++++...++..+.
T Consensus       386 cTDVaARGlD~P~V~~VvQ~~~P~d~~~YIHRvGRTaR~gk~G~alL~l~p~El~Flr~LK~lpl~~~e~~~~~~~~v~~  465 (543)
T KOG0342|consen  386 CTDVAARGLDIPDVDWVVQYDPPSDPEQYIHRVGRTAREGKEGKALLLLAPWELGFLRYLKKLPLEEFEFPPLKPEDVQS  465 (543)
T ss_pred             ecchhhccCCCCCceEEEEeCCCCCHHHHHHHhccccccCCCceEEEEeChhHHHHHHHHhhCCCcccCCCCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988877666


Q ss_pred             HHHHHHHHhHHHHHHH---HHHHHHHHHHHHhhccCcccHHHHHHHHHHHcCCCCCCCCCHHHHHhcCCCCCCCceec
Q 003100          773 MDNHMAKIDNNVKEAA---YHAWLGYYNSIREIGRDKTTLVELANKFAQSIGLQRPPPLFRKTALKMGLKDIPGIRLR  847 (848)
Q Consensus       773 ~~~~l~~~~~~~~e~~---~~s~l~~y~~~~~~~~~~~~~~~l~~~la~s~GL~~~P~v~~~~~~k~gl~~~pgl~i~  847 (848)
                      +...|...+..+++++   |.+|++||+++........+..+++ ++|+|||++.||.++..+..+||+++.+|++.+
T Consensus       466 ~~~~li~~~y~~~~aak~ay~syl~~y~s~slk~~~~~~~l~La-~~~~s~gf~~pp~v~~~i~~~~~~k~~~~~~~~  542 (543)
T KOG0342|consen  466 QLEKLISKNYSLKEAAKEAYKSYLGAYNSHSLKDIFNVNLLELA-AVAKSFGFSVPPAVDLKIDGKMGLKGNKGLRGR  542 (543)
T ss_pred             HHHHHHHHHhhHHHHHHHHHHhhhhhccchhhhcccccchhhHH-HHHHHcCCCCCccceeeccccccccCCCCCCCC
Confidence            6666655555555554   5669999999876666667889988 999999999999999999999999999999875

>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PF13959 DUF4217: Domain of unknown function (DUF4217) Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-45
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 5e-45
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-44
2vso_A395 Crystal Structure Of A Translation Initiation Compl 7e-37
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 2e-36
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-36
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-36
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-36
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-36
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-36
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 5e-36
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-35
3ly5_A262 Ddx18 Dead-Domain Length = 262 3e-35
1fuu_A394 Yeast Initiation Factor 4a Length = 394 3e-35
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 4e-35
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-34
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-33
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-32
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 6e-32
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 2e-31
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-30
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 7e-28
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-27
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-27
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 7e-26
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 1e-25
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-25
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 7e-25
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 9e-25
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-24
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-24
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 4e-24
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 4e-24
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 5e-24
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 2e-23
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-23
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 3e-23
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 6e-23
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 1e-22
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 5e-21
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-20
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-20
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-18
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-17
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 3e-16
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 6e-15
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 2e-13
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-13
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 3e-12
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 9e-11
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 2e-10
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-10
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-10
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-06
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 3e-06
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 5e-06
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 6e-06
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 7e-06
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 7e-06
2jgn_A185 Ddx3 Helicase Domain Length = 185 7e-05
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-04
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 5e-04
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 7e-04
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 192/350 (54%), Gaps = 24/350 (6%)
Query: 392 KALTAAGYIQMTRVQEATLSACL--EGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSST 449
           KA+T   +  +T VQ+ T+   L  E  D + +AKTGTGK+ AFL+P  + ++     S 
Sbjct: 34  KAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQ 93
Query: 450 TQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGI---GVLTLVGGTRFKVDQRRLESD 506
                 +  +I+ PTR+LA QI AE   +   + G+     ++LVGGT F+    ++   
Sbjct: 94  YM----VKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKL 149
Query: 507 PCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIVDCLPRRR 566
              I++ATPGRL+D +E  S    R +  K  VLDEAD LL++GFR D+E I   L  + 
Sbjct: 150 RPNIVIATPGRLIDVLEKYSNKFFRFVDYK--VLDEADRLLEIGFRDDLETISGILNEKN 207
Query: 567 -------QSLLFSATMPKEVRRISQLVL-KREHTYIDTVGLGSVETPVKIKQSCLVAPHE 618
                  ++LLFSAT+  +V++++  ++ K+E  ++DTV     E   +I QS +++   
Sbjct: 208 SKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 267
Query: 619 LH--FQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLR-EMKMN--VREMYSRKPQ 673
            +  F  + H+ K+      +YK I+F  T   TS L  +L+ E K +  + E + +  Q
Sbjct: 268 ANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQ 327
Query: 674 LYRDRISEEFRASKRLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIH 723
             R  + + F+  +  ILV +DV ARGMD+P+V  V+Q+G+P +   YIH
Sbjct: 328 NKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIH 377
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-163
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-155
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 3e-97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-97
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 3e-96
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 4e-96
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 5e-96
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-95
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-87
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 8e-86
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 4e-85
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-85
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-83
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-78
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-77
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-72
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-70
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 3e-69
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 3e-67
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 5e-66
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-65
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-65
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-65
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-65
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 8e-63
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-62
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-58
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-55
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-54
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 5e-54
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-53
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 9e-28
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 4e-27
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 5e-26
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 5e-25
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 3e-24
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-23
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 5e-23
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-21
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-21
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 4e-13
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 3e-10
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 9e-10
3b6e_A216 Interferon-induced helicase C domain-containing P; 6e-09
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-08
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-07
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-06
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 5e-06
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-05
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-05
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 3e-04
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 7e-05
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 9e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-04
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 3e-04
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-04
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-04
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 9e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  485 bits (1249), Expect = e-163
 Identities = 152/570 (26%), Positives = 267/570 (46%), Gaps = 42/570 (7%)

Query: 300 SEDVDEKVEGWRDVKKMGSSASLGKYDMKITKRVPLKSLEDEHDFEEQVELIRKEISKNK 359
             D +     +   ++  +S            R   +  +DE  F++             
Sbjct: 4   YNDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKT-----------T 52

Query: 360 LNGNGEKKEKREEEPILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACL--EGK 417
            +      ++   + +      +E  +     KA+T   +  +T VQ+ T+   L  E  
Sbjct: 53  FSKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDH 112

Query: 418 DAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIA 477
           D + +AKTGTGK+ AFL+P  + ++     S       +  +I+ PTR+LA QI AE   
Sbjct: 113 DVIARAKTGTGKTFAFLIPIFQHLINTKFDSQ----YMVKAVIVAPTRDLALQIEAEVKK 168

Query: 478 LLKNHDG---IGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMG 534
           +   + G      ++LVGGT F+    ++      I++ATPGRL+D +E  S    R   
Sbjct: 169 IHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFR--F 226

Query: 535 LKMLVLDEADHLLDLGFRKDVENIVDCLPRRR-------QSLLFSATMPKEVRRISQLVL 587
           +   VLDEAD LL++GFR D+E I   L  +        ++LLFSAT+  +V++++  ++
Sbjct: 227 VDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIM 286

Query: 588 K-REHTYIDTVGLGSVETPVKIKQSCLVAP--HELHFQILHHLLKEHILGTPDYKVIVFC 644
             +E  ++DTV     E   +I QS +++       F  + H+ K+      +YK I+F 
Sbjct: 287 NKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFA 346

Query: 645 STGMVTSLLYLLLREMK---MNVREMYSRKPQLYRDRISEEFRASKRLILVTSDVSARGM 701
            T   TS L  +L+      + + E + +  Q  R  + + F+  +  ILV +DV ARGM
Sbjct: 347 PTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGM 406

Query: 702 DYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKDL---PLD 758
           D+P+V  V+Q+G+P +   YIHR+GRT R GKEG  VL +   E  F+ +L+D     + 
Sbjct: 407 DFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIA 466

Query: 759 KLQLPHLNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSI--REIGRDKTTLVELANKF 816
           K +    + EI+ ++   + +   ++ +    + +  Y S        ++  L E+A+ +
Sbjct: 467 KQEKYEPSEEIKSEVLEAVTEEPEDISD-IVISLISSYRSCIKEYRFSERRILPEIASTY 525

Query: 817 AQSIGL-QRPPPLFRKTALKMGLKDIPGIR 845
              +   Q   P+ R+   K+GL   P  +
Sbjct: 526 GVLLNDPQLKIPVSRRFLDKLGLSRSPIGK 555
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.98
3bor_A237 Human initiation factor 4A-II; translation initiat 99.98
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.98
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.98
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.98
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.97
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.97
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.97
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.97
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.97
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.94
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.93
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.93
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.92
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.9
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.9
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.79
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.87
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.86
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.86
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.83
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.81
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.73
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.73
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.66
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.56
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.94
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.84
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.82
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.8
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.67
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.63
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.63
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.24
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.55
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.18
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.12
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.3
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.29
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.24
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.07
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.98
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.86
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.75
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.55
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.24
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.1
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.07
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.0
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.52
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.3
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.22
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.18
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.14
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.02
3bos_A242 Putative DNA replication factor; P-loop containing 92.71
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 92.52
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.52
2qgz_A308 Helicase loader, putative primosome component; str 91.95
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 91.88
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 91.79
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 91.6
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 91.53
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 91.5
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.39
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.27
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.04
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 90.98
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.95
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 90.61
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 90.31
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 90.02
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 90.02
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.98
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 89.66
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.39
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.37
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 89.26
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 89.14
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 88.96
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.59
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.48
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 88.47
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 88.46
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 88.39
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 87.75
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 87.56
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 87.23
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.08
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 86.89
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 85.92
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 85.49
2r6a_A454 DNAB helicase, replicative helicase; replication, 85.01
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 85.0
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 84.98
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 84.31
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 84.27
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 83.71
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 83.7
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 83.53
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 83.49
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 83.45
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 82.61
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 82.53
3pvs_A447 Replication-associated recombination protein A; ma 82.17
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 82.17
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 82.03
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 81.62
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 81.55
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 81.55
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 81.39
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 80.98
2fna_A357 Conserved hypothetical protein; structural genomic 80.82
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 80.72
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 80.33
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
Probab=100.00  E-value=4.8e-58  Score=544.02  Aligned_cols=454  Identities=31%  Similarity=0.477  Sum_probs=359.0

Q ss_pred             CCHHHHHHHHHcCCCCCcHHHHHHHHHHh--CCCCEEEEcCCCCcchHHHHHHHHHHHHHhCCCCCCCCCCCeEEEEEcC
Q 003100          386 ISPLTIKALTAAGYIQMTRVQEATLSACL--EGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVPPIYVLILCP  463 (848)
Q Consensus       386 l~~~l~~~L~~~g~~~~t~iQ~~aI~~il--~g~dvIv~a~TGSGKTlaflLPil~~l~~~~~~~~~~~~~~~~vLIL~P  463 (848)
                      +++.++++|..+||..|+|+|.++|+.++  .++++|++||||+|||++|++|+++.+.......    ..++++|||+|
T Consensus        28 l~~~l~~~l~~~g~~~~~~~Q~~~i~~il~~~~~dvlv~apTGsGKTl~~~lpil~~l~~~~~~~----~~~~~~lvl~P  103 (579)
T 3sqw_A           28 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDS----QYMVKAVIVAP  103 (579)
T ss_dssp             SCHHHHHHHHTTTCSSCCHHHHHHHHHHHCSSSEEEEEECCTTSCHHHHHHHHHHHHHHHTTTSS----TTSCCEEEECS
T ss_pred             CCHHHHHHHHHCCCCCCCHHHHHHHHHHHccCCCeEEEEcCCCcHHHHHHHHHHHHHHHhccccc----cCCCeEEEEcc
Confidence            99999999999999999999999999999  7889999999999999999999999998764321    23457999999


Q ss_pred             cHHHHHHHHHHHHHHhhc---CCCceEEEEeCCcchhHhhhhhhcCCCcEEEeChHHHHHHHHhccCcccccCCccEEEE
Q 003100          464 TRELASQIAAEAIALLKN---HDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVL  540 (848)
Q Consensus       464 TreLa~Qi~~~l~~l~~~---~~~i~v~~l~gg~~~~~~~~~l~~~~~~IIV~TPgrLl~~L~~~~~~~~~l~~l~~lVI  540 (848)
                      |++||.|+++.+.+++..   ...+.+..++|+.........+...+++|+|+||++|++++....  ...+..+++|||
T Consensus       104 tr~La~Q~~~~~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~~IlV~Tp~~l~~~l~~~~--~~~~~~~~~lVi  181 (579)
T 3sqw_A          104 TRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYS--NKFFRFVDYKVL  181 (579)
T ss_dssp             SHHHHHHHHHHHHHHHHHCGGGTTSCEEEECTTSCHHHHHHHHHHHCCSEEEECHHHHHHHHHHHH--HHHCTTCCEEEE
T ss_pred             hHHHHHHHHHHHHHHHhhcccccceEEEEEECCccHHHHHHHHhcCCCCEEEECHHHHHHHHHhcc--ccccccCCEEEE
Confidence            999999999999998743   345678889999888877777766678999999999999987642  234678999999


Q ss_pred             ecccccccccchhhHHHHHHhcCc-------cceeEEEeccCChHHHHHHHHHhccceEE-EeecCCCcccccceeeccc
Q 003100          541 DEADHLLDLGFRKDVENIVDCLPR-------RRQSLLFSATMPKEVRRISQLVLKREHTY-IDTVGLGSVETPVKIKQSC  612 (848)
Q Consensus       541 DEAH~ll~~gf~~~l~~Il~~l~~-------~~Q~ll~SATl~~~v~~l~~~~l~~~~~~-i~~~~~~~~~~~~~v~q~~  612 (848)
                      ||||++++++|...+..|+..++.       .+|+++||||+++.+..++..++..+..+ +.............+.+.+
T Consensus       182 DEah~l~~~gf~~~~~~i~~~l~~~~~~~~~~~~~l~~SAT~~~~v~~~~~~~l~~~~~~~~~~~~~~~~~~~~~i~~~~  261 (579)
T 3sqw_A          182 DEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSV  261 (579)
T ss_dssp             ETHHHHTSTTTHHHHHHHHHHHHHHCSSCTTCCEEEEEESSCCTHHHHHTTTTCCSSEEEEEESSCSSSCSSCTTEEEEE
T ss_pred             EChHHhhcCCCHHHHHHHHHHhhhhhcccccCceEEEEeccCChHHHHHHHHHcCCCceEEEeecCccccccccccceEE
Confidence            999999999999999999887643       67999999999999998888887764433 3322222233334444444


Q ss_pred             ccCCh-h-hHHHHHHHHHHHHhhCCCCceEEEEEecchHHHHHHHHHHHh---ccceeeecCCcchhhHHHHHHHHhcCC
Q 003100          613 LVAPH-E-LHFQILHHLLKEHILGTPDYKVIVFCSTGMVTSLLYLLLREM---KMNVREMYSRKPQLYRDRISEEFRASK  687 (848)
Q Consensus       613 ~~~~~-~-~k~~~L~~lL~~~~~~~~~~kiLVF~~s~~~a~~l~~~L~~~---~~~v~~lhg~ls~~~R~~i~~~F~~G~  687 (848)
                      ..... . .....+..++.......++.++||||+|+..++.++..|...   ++.+..+||+|++.+|..+++.|++|+
T Consensus       262 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iVF~~t~~~~~~l~~~L~~~~~~~~~v~~~hg~~~~~~R~~~~~~F~~g~  341 (579)
T 3sqw_A          262 VISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDE  341 (579)
T ss_dssp             EEESSTTHHHHHHHHHHHHHHHHTTTCCEEEEECSSHHHHHHHHHHHHHHHTTTSCEEEESTTSCHHHHHHHHHHHHHCS
T ss_pred             EEecchhhhHHHHHHHHHHHHhhcCCCCcEEEECCcHHHHHHHHHHHHHhhcCCCcEEEecCCCCHHHHHHHHHHhhcCC
Confidence            44432 2 222333333332222346789999999999999999999987   899999999999999999999999999


Q ss_pred             ceEEEecCCccccccCCCCCeeEEcCCCCChhHHHHHhhccCCCCCCceEEEEeCcchhhHHHHhcc---CCCCcCCCCC
Q 003100          688 RLILVTSDVSARGMDYPDVTSVVQVGIPPDREQYIHRLGRTGREGKEGEGVLLLAPWEEYFLDDLKD---LPLDKLQLPH  764 (848)
Q Consensus       688 ~~VLVaTdvl~rGlDip~V~~VI~yd~P~s~~~yiQRiGRaGR~G~~G~~i~l~~~~e~~~l~~L~~---~~l~~~~~~~  764 (848)
                      ..|||||+++++|||+|+|++||+|++|.++..|+||+|||||.|+.|.|++|+++.|..+++.+++   ..+.......
T Consensus       342 ~~vLVaT~~~~~GiDip~v~~VI~~~~p~s~~~y~Qr~GRagR~g~~g~~i~~~~~~e~~~~~~l~~~~~~~~~~~~~~~  421 (579)
T 3sqw_A          342 SGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYE  421 (579)
T ss_dssp             SEEEEECGGGTSSCCCTTCCEEEEESCCSSTTHHHHHHTTSSCTTCCEEEEEEEEGGGHHHHHHHHHHHCCCCCEEEEEC
T ss_pred             CeEEEEcchhhcCCCcccCCEEEEcCCCCCHHHhhhhccccccCCCCceEEEEEcccHHHHHHHHHHHhCCCcccccCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999888864   3444333333


Q ss_pred             CChHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhcc-Cccc-HHHHHHHHHHHcCCCC-CCCCCHHHHHhcCCCCC
Q 003100          765 LNPEIQLQMDNHMAKIDNNVKEAAYHAWLGYYNSIREIGR-DKTT-LVELANKFAQSIGLQR-PPPLFRKTALKMGLKDI  841 (848)
Q Consensus       765 ~~~~~~~~~~~~l~~~~~~~~e~~~~s~l~~y~~~~~~~~-~~~~-~~~l~~~la~s~GL~~-~P~v~~~~~~k~gl~~~  841 (848)
                      ........+...+..... .....+.+|+.||.......+ ...+ +..+++.++..++.+. .|.+.++++.+|||++.
T Consensus       422 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~gl~~~  500 (579)
T 3sqw_A          422 PSEEIKSEVLEAVTEEPE-DISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRS  500 (579)
T ss_dssp             CCHHHHHHHHHHCCCCHH-HHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHTTCTTCCEEECHHHHHHHTCTTC
T ss_pred             ccHHHHHHHHHHHHhhHH-HHHHHHHHHHHHHHHHHHHhCCCcccHHHHHHHHHHHHhCCCCCCCccchhHHHhcCCCCC
Confidence            344444443333322112 234567899999988754332 3233 4677778888778875 46689999999999999


Q ss_pred             CCcee
Q 003100          842 PGIRL  846 (848)
Q Consensus       842 pgl~i  846 (848)
                      ||+.+
T Consensus       501 ~~~~~  505 (579)
T 3sqw_A          501 PIGKA  505 (579)
T ss_dssp             HHHHH
T ss_pred             CCcee
Confidence            99854
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 848
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 6e-40
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 9e-35
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 7e-34
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-33
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-33
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-33
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-32
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 1e-29
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-27
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-27
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-25
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-19
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-18
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-18
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-18
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-16
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 5e-16
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 3e-13
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 5e-13
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 8e-13
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-12
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 3e-12
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-11
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-09
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 1e-09
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 9e-09
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 1e-08
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 4e-06
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  144 bits (364), Expect = 6e-40
 Identities = 70/209 (33%), Positives = 115/209 (55%), Gaps = 16/209 (7%)

Query: 381 FDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGK-DAVVKAKTGTGKSIAFLLPAIE 439
           F+E  +S   + A+   G+ + T +Q   +   L  + + V +A+TG+GK+ +F +P IE
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLIE 65

Query: 440 AVLKATSSSTTQLVPPIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVD 499
                           I  +IL PTRELA Q+A E I  LK +  + +  + GG      
Sbjct: 66  ---------LVNENNGIEAIILTPTRELAIQVADE-IESLKGNKNLKIAKIYGGKAIYPQ 115

Query: 500 QRRLESDPCQILVATPGRLLDHIENKSGLSVRLMGLKMLVLDEADHLLDLGFRKDVENIV 559
            + L++    I+V TPGR+LDHI   +   + L  +K  +LDEAD +L++GF KDVE I+
Sbjct: 116 IKALKN--ANIVVGTPGRILDHINRGT---LNLKNVKYFILDEADEMLNMGFIKDVEKIL 170

Query: 560 DCLPRRRQSLLFSATMPKEVRRISQLVLK 588
           +   + ++ LLFSATMP+E+  +++  + 
Sbjct: 171 NACNKDKRILLFSATMPREILNLAKKYMG 199
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.94
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.94
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.93
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.92
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.91
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.9
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.9
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.88
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.88
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.86
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.82
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.73
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.68
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.68
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.66
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.65
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.64
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.64
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.63
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.63
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.61
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.58
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.51
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.3
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.29
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.21
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.17
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.99
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.9
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.61
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.45
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.36
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.85
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.08
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.69
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.1
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.85
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.56
d2qy9a2211 GTPase domain of the signal recognition particle r 95.54
d1okkd2207 GTPase domain of the signal recognition particle r 95.27
d1vmaa2213 GTPase domain of the signal recognition particle r 95.21
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.85
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.67
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.0
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.92
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.16
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 93.06
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.03
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.69
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.24
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.64
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.5
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.28
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 91.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.95
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 90.01
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 89.61
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 88.9
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 88.82
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 87.22
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 84.88
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 84.64
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 83.77
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.18
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 83.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 81.97
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 81.85
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 81.67
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 81.33
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 80.73
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 80.1
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.8e-38  Score=327.57  Aligned_cols=204  Identities=30%  Similarity=0.518  Sum_probs=183.6

Q ss_pred             cccccCcccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHhCCCCEEEEcCCCCcchHHHHHHHHHHHHHhCCCCCCCCCC
Q 003100          375 ILSQKRFDECGISPLTIKALTAAGYIQMTRVQEATLSACLEGKDAVVKAKTGTGKSIAFLLPAIEAVLKATSSSTTQLVP  454 (848)
Q Consensus       375 ~~~~~~f~~l~l~~~l~~~L~~~g~~~~t~iQ~~aI~~il~g~dvIv~a~TGSGKTlaflLPil~~l~~~~~~~~~~~~~  454 (848)
                      .....+|++++|++.++++|.++||..||++|.++||.+++|+|++++|+||||||+||++|+++++....        .
T Consensus        13 ~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~--------~   84 (222)
T d2j0sa1          13 VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV--------R   84 (222)
T ss_dssp             CCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS--------C
T ss_pred             CCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccc--------c
Confidence            34456899999999999999999999999999999999999999999999999999999999998875432        2


Q ss_pred             CeEEEEEcCcHHHHHHHHHHHHHHhhcCCCceEEEEeCCcchhHhhhhhhcCCCcEEEeChHHHHHHHHhccCcccccCC
Q 003100          455 PIYVLILCPTRELASQIAAEAIALLKNHDGIGVLTLVGGTRFKVDQRRLESDPCQILVATPGRLLDHIENKSGLSVRLMG  534 (848)
Q Consensus       455 ~~~vLIL~PTreLa~Qi~~~l~~l~~~~~~i~v~~l~gg~~~~~~~~~l~~~~~~IIV~TPgrLl~~L~~~~~~~~~l~~  534 (848)
                      .+++||++|||+||.|+++.+.++.+. .++.+..++|+.....+...+.. +++|+|+|||+|.+++...   ...+++
T Consensus        85 ~~~~lil~PtreLa~Qi~~~~~~l~~~-~~i~~~~~~g~~~~~~~~~~l~~-~~~Ilv~TPgrl~~~~~~~---~~~~~~  159 (222)
T d2j0sa1          85 ETQALILAPTRELAVQIQKGLLALGDY-MNVQCHACIGGTNVGEDIRKLDY-GQHVVAGTPGRVFDMIRRR---SLRTRA  159 (222)
T ss_dssp             SCCEEEECSSHHHHHHHHHHHHHHTTT-TTCCEEEECTTSCHHHHHHHHHH-CCSEEEECHHHHHHHHHTT---SSCCTT
T ss_pred             CceeEEecchHHHHHHHHHHHHHHhCc-cceeEEEEeecccchhhHHHhcc-CCeEEeCCCCcHHhccccc---cccccc
Confidence            357999999999999999999998765 47999999999988877666654 4899999999999998776   466889


Q ss_pred             ccEEEEecccccccccchhhHHHHHHhcCccceeEEEeccCChHHHHHHHHHhccce
Q 003100          535 LKMLVLDEADHLLDLGFRKDVENIVDCLPRRRQSLLFSATMPKEVRRISQLVLKREH  591 (848)
Q Consensus       535 l~~lVIDEAH~ll~~gf~~~l~~Il~~l~~~~Q~ll~SATl~~~v~~l~~~~l~~~~  591 (848)
                      ++++|+||||+|++.||...+..|+..+++.+|+++||||+++++..+++.++++|.
T Consensus       160 l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv  216 (222)
T d2j0sa1         160 IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPI  216 (222)
T ss_dssp             CCEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCE
T ss_pred             ceeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCE
Confidence            999999999999999999999999999999999999999999999999999987643
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure