Citrus Sinensis ID: 003353


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------
MIRRVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLIGKAM
cccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHccccccHHccccccccccccHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHcHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHcccccccHHcccccccccccccc
cccHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHccccccEEEEcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHccccccccEcccc
mirrvkklcprnlylsltknpnfrypfhsnfihhldfnhkfikntsfssrldygetqnFVKDaiffrkpnyvrsycsgksgdgekcneWTEEIEYldesgsviytgkgirsvepgfddhvmvggikkpflNASAVAKIVEVVNrwkwgpeleTQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAkrqswyvpgdecYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFkkvldsdckidtQSYNVLMTLFLnkglpykaFEIYESmekgecsldgstyelMIPSLAKSGRLDAAIKLFQEMkernfrpsfNIFASLVDSmgkagrldTSMKVYMEmqgcghrpsapMYVSLIESYAKAGKLDTALRLWDEMriagfrpnfgLFTMIIESHAKSGKLDIAMSIFTDmeragflptpstySCLLEMHASSGQVDSAMKLYNSMtsaglrpglSTYTALLTLLAKRKLVDVAAKILLEMKTmgysvdvsaSDVLMVYIKDGSVDHALRWLRFMgssgirtnnFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCglftgpeqrkqpvLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYenklfpkaiVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYygvvprriklvtgpTLKIVIAQMLSsvespfevskvvlrapgdsvmeWFKKPIVQQFLLNEIPSRADILMHKMnilfpcsapelrslsppkpligkam
mirrvkklcprnlYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDaiffrkpnyvrsycsgksgdgekcNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMlssvespfeVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPcsapelrslsppkpligkam
MIRRVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYtalltllakrklVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFvnvllnylvlMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLIGKAM
*****KKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHAS***V*SAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCS******************
*******LCPRNLYLS*********PFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPE**SLSPPKPLIG***
MIRRVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLIGKAM
MIRRVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLIG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRRVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLIGKAM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query827 2.2.26 [Sep-21-2011]
Q9SAK0836 Pentatricopeptide repeat- yes no 0.989 0.978 0.775 0.0
Q8GYP6860 Pentatricopeptide repeat- no no 0.546 0.525 0.280 4e-50
Q9SSF9855 Pentatricopeptide repeat- no no 0.525 0.508 0.285 1e-48
Q9M907 871 Pentatricopeptide repeat- no no 0.649 0.616 0.231 4e-39
P0C894761 Putative pentatricopeptid no no 0.674 0.733 0.241 1e-37
Q9LW84642 Pentatricopeptide repeat- no no 0.552 0.711 0.228 5e-36
Q9SZ521112 Pentatricopeptide repeat- no no 0.432 0.321 0.275 7e-36
Q8L844709 Pentatricopeptide repeat- no no 0.436 0.509 0.262 5e-34
Q9SIC9918 Pentatricopeptide repeat- no no 0.643 0.579 0.227 2e-33
Q9S7Q2862 Pentatricopeptide repeat- no no 0.717 0.687 0.223 1e-32
>sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 Back     alignment and function desciption
 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/836 (77%), Positives = 727/836 (86%), Gaps = 18/836 (2%)

Query: 1   MIR-RVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRL-DYGETQN 58
           MIR R  K+ PRN+  +L+++     P     I     N K   + SF+ RL  Y   +N
Sbjct: 1   MIRGRTAKVIPRNVIFTLSRSSISESPL----ISPSRINPKLAGSFSFNIRLLSYFTVRN 56

Query: 59  -FVKDAIFFRKPNYV----------RSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGK 107
            F  D    R PN+V          R +CS K G  E    WTEE+EYLDESGSV+++GK
Sbjct: 57  GFCPDCSVPRDPNFVGLTTQCRSIVRRFCSEKIGSSESSG-WTEEVEYLDESGSVLHSGK 115

Query: 108 GIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHI 167
           GIRSVEPG DDHVMVGG+KKP++NAS+VAKIVEVV RWKWGPELETQLDKLQFVP MVHI
Sbjct: 116 GIRSVEPGLDDHVMVGGLKKPYMNASSVAKIVEVVQRWKWGPELETQLDKLQFVPNMVHI 175

Query: 168 TQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDS 227
           TQ+LK++ + D +LSLFRWAK+Q WY+P DECYV+LFD LN+ RDF G+ SLF+EMV DS
Sbjct: 176 TQSLKIVKEVDAALSLFRWAKKQPWYLPSDECYVVLFDGLNQGRDFVGIQSLFEEMVQDS 235

Query: 228 SKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPY 287
           S +G   F+AYN+VIQYLAKA+KLE+++CCFKK  +S CKIDTQ+YN LM LFLNKGLPY
Sbjct: 236 SSHGDLSFNAYNQVIQYLAKAEKLEVAFCCFKKAQESGCKIDTQTYNNLMMLFLNKGLPY 295

Query: 288 KAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLV 347
           KAFEIYESMEK +  LDGSTYEL+IPSLAKSGRLDAA KLFQ+MKER  RPSF++F+SLV
Sbjct: 296 KAFEIYESMEKTDSLLDGSTYELIIPSLAKSGRLDAAFKLFQQMKERKLRPSFSVFSSLV 355

Query: 348 DSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFR 407
           DSMGKAGRLDTSMKVYMEMQG GHRPSA M+VSLI+SYAKAGKLDTALRLWDEM+ +GFR
Sbjct: 356 DSMGKAGRLDTSMKVYMEMQGFGHRPSATMFVSLIDSYAKAGKLDTALRLWDEMKKSGFR 415

Query: 408 PNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKL 467
           PNFGL+TMIIESHAKSGKL++AM++F DME+AGFLPTPSTYSCLLEMHA SGQVDSAMK+
Sbjct: 416 PNFGLYTMIIESHAKSGKLEVAMTVFKDMEKAGFLPTPSTYSCLLEMHAGSGQVDSAMKI 475

Query: 468 YNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKD 527
           YNSMT+AGLRPGLS+Y +LLTLLA ++LVDVA KILLEMK MGYSVDV ASDVLM+YIKD
Sbjct: 476 YNSMTNAGLRPGLSSYISLLTLLANKRLVDVAGKILLEMKAMGYSVDVCASDVLMIYIKD 535

Query: 528 GSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLY 587
            SVD AL+WLRFMGSSGI+TNNFI+RQLFESCMKN LY+SA+PLLET V SA KVDLVLY
Sbjct: 536 ASVDLALKWLRFMGSSGIKTNNFIIRQLFESCMKNGLYDSARPLLETLVHSAGKVDLVLY 595

Query: 588 TSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGID 647
           TS+LAHLVRCQDE  ER LM+ILSATKHKAHAF+CGLFTGPEQRKQPVL+FVREF+ GID
Sbjct: 596 TSILAHLVRCQDEDKERQLMSILSATKHKAHAFMCGLFTGPEQRKQPVLTFVREFYQGID 655

Query: 648 YELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL 707
           YELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL
Sbjct: 656 YELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL 715

Query: 708 SVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL 767
           SVGAALIAV+HTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL
Sbjct: 716 SVGAALIAVVHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL 775

Query: 768 RAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLI 823
           RAPG+ VMEWFKKPIVQQFLLNEIPSR+DILMHKMN++FP SAPELRS+SPPKPL+
Sbjct: 776 RAPGELVMEWFKKPIVQQFLLNEIPSRSDILMHKMNVMFPSSAPELRSMSPPKPLM 831





Arabidopsis thaliana (taxid: 3702)
>sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 Back     alignment and function description
>sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 Back     alignment and function description
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function description
>sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
224112321785 predicted protein [Populus trichocarpa] 0.939 0.989 0.842 0.0
255582603841 pentatricopeptide repeat-containing prot 0.985 0.969 0.784 0.0
15219388836 pentatricopeptide repeat-containing prot 0.989 0.978 0.775 0.0
225446845844 PREDICTED: pentatricopeptide repeat-cont 0.974 0.954 0.781 0.0
297839813832 EMB2217 [Arabidopsis lyrata subsp. lyrat 0.984 0.978 0.770 0.0
356573733752 PREDICTED: pentatricopeptide repeat-cont 0.904 0.994 0.830 0.0
449442096823 PREDICTED: pentatricopeptide repeat-cont 0.925 0.929 0.794 0.0
302143554765 unnamed protein product [Vitis vinifera] 0.879 0.950 0.771 0.0
357165906775 PREDICTED: pentatricopeptide repeat-cont 0.886 0.945 0.582 0.0
414585491787 TPA: hypothetical protein ZEAMMB73_91798 0.885 0.930 0.588 0.0
>gi|224112321|ref|XP_002316152.1| predicted protein [Populus trichocarpa] gi|222865192|gb|EEF02323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1380 bits (3573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/779 (84%), Positives = 717/779 (92%), Gaps = 2/779 (0%)

Query: 45  TSFSSRLDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIY 104
            S S ++   ++ N V +    +  ++VR+YC+GK+G+     EWTE+IEYLDESGSVIY
Sbjct: 4   NSISPKVSPSKSPNLVSNGGHVKANSFVRNYCAGKNGEA-GSGEWTEDIEYLDESGSVIY 62

Query: 105 TGKGIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKM 164
           +GKGIRSVEPG DDHVM+GG+KKP LNASAVAKIVEVV RWKWGPELETQLDKLQFVP M
Sbjct: 63  SGKGIRSVEPGVDDHVMIGGLKKPILNASAVAKIVEVVKRWKWGPELETQLDKLQFVPNM 122

Query: 165 VHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMV 224
            H+ QALK+IN+SD  LSLF+WAKRQ+WYVP DECYVMLFD LN+SRDFDG+ SLFDEMV
Sbjct: 123 THVVQALKIINESDALLSLFKWAKRQTWYVPNDECYVMLFDGLNQSRDFDGIQSLFDEMV 182

Query: 225 HDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKG 284
            DS K+    FSAYNRV++YLAKA+KLE+S+CCFKKV DS CKIDT++YN+LM LFLNKG
Sbjct: 183 CDSIKSATQ-FSAYNRVLKYLAKAEKLEVSFCCFKKVQDSGCKIDTETYNILMKLFLNKG 241

Query: 285 LPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFA 344
           LPYKAFEIYE+ME   CSLD STYELMIPSLAKSGRLDAA KLFQEMKERNFRPS  IF+
Sbjct: 242 LPYKAFEIYETMEAAHCSLDVSTYELMIPSLAKSGRLDAAFKLFQEMKERNFRPSLGIFS 301

Query: 345 SLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIA 404
           SLVDSMGKAGRL+TSMKVYMEMQG G RPSA MYVSLIESY KAGKLD ALRLWDEM+IA
Sbjct: 302 SLVDSMGKAGRLETSMKVYMEMQGLGLRPSAIMYVSLIESYTKAGKLDAALRLWDEMKIA 361

Query: 405 GFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSA 464
           GFRPNFGL+T+IIESHAKSGKLDIAMSIF DME+AGFLPTPSTYS LLEMHA+SGQVD+A
Sbjct: 362 GFRPNFGLYTLIIESHAKSGKLDIAMSIFRDMEKAGFLPTPSTYSSLLEMHAASGQVDAA 421

Query: 465 MKLYNSMTSAGLRPGLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVY 524
           MKLYNSMT+AGLRPGLSTYTALLTLLA +KLVDVAAKILLEMK MG+SVDVSASDVLMVY
Sbjct: 422 MKLYNSMTNAGLRPGLSTYTALLTLLAHKKLVDVAAKILLEMKAMGFSVDVSASDVLMVY 481

Query: 525 IKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDL 584
           IKDGSVD +LRWLRFM SSGIRTNNFI+RQLFESCMKN LYESAKPLLETYV SAAKVDL
Sbjct: 482 IKDGSVDLSLRWLRFMSSSGIRTNNFIIRQLFESCMKNGLYESAKPLLETYVNSAAKVDL 541

Query: 585 VLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFH 644
           +LYTS+LA+LVRCQ+EQNERHLMAILSAT+HKAHAF+CGLFTGPEQRKQPVLSFVREFF 
Sbjct: 542 ILYTSILAYLVRCQEEQNERHLMAILSATRHKAHAFMCGLFTGPEQRKQPVLSFVREFFQ 601

Query: 645 GIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDV 704
           GIDYELEEGAA+YFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDV
Sbjct: 602 GIDYELEEGAAKYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDV 661

Query: 705 RNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSK 764
           RNLSVGAAL+AV+HTLHRFRKRMLYYGV+PRRIKLVTGPTL+IV+AQMLSSVESPFEVSK
Sbjct: 662 RNLSVGAALVAVVHTLHRFRKRMLYYGVIPRRIKLVTGPTLRIVVAQMLSSVESPFEVSK 721

Query: 765 VVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLI 823
           VVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMH++NILFP SAPE+RSLSPPKPLI
Sbjct: 722 VVLRAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHRLNILFPTSAPEIRSLSPPKPLI 780




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255582603|ref|XP_002532083.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528243|gb|EEF30297.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15219388|ref|NP_178067.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200795|sp|Q9SAK0.1|PP132_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79490, mitochondrial; AltName: Full=Protein EMBRYO DEFECTIVE 2217; Flags: Precursor gi|4835759|gb|AAD30226.1|AC007202_8 T8K14.9 [Arabidopsis thaliana] gi|332198129|gb|AEE36250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225446845|ref|XP_002279656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297839813|ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] gi|297333629|gb|EFH64047.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356573733|ref|XP_003555011.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449442096|ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] gi|449490234|ref|XP_004158545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302143554|emb|CBI22115.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357165906|ref|XP_003580534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|414585491|tpg|DAA36062.1| TPA: hypothetical protein ZEAMMB73_917988 [Zea mays] gi|414585492|tpg|DAA36063.1| TPA: hypothetical protein ZEAMMB73_917988 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query827
TAIR|locus:2206385836 EMB2217 "embryo defective 2217 0.989 0.978 0.754 0.0
TAIR|locus:2027212855 AT1G74750 [Arabidopsis thalian 0.524 0.507 0.282 1.3e-40
TAIR|locus:2151281819 AT5G02860 [Arabidopsis thalian 0.494 0.499 0.259 1.8e-33
TAIR|locus:21167721112 PGR3 "AT4G31850" [Arabidopsis 0.431 0.321 0.271 1.7e-32
TAIR|locus:2093472642 AT3G16010 [Arabidopsis thalian 0.447 0.576 0.244 3.5e-31
TAIR|locus:2077637 871 AT3G06920 "AT3G06920" [Arabido 0.558 0.530 0.234 4.3e-31
TAIR|locus:2157607709 AT5G42310 [Arabidopsis thalian 0.429 0.500 0.259 5.1e-29
TAIR|locus:2024301606 AT1G09820 "AT1G09820" [Arabido 0.506 0.691 0.247 6e-29
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.505 0.559 0.252 1.2e-27
TAIR|locus:2027166862 PTAC2 "plastid transcriptional 0.483 0.464 0.234 4.5e-26
TAIR|locus:2206385 EMB2217 "embryo defective 2217" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3232 (1142.8 bits), Expect = 0., P = 0.
 Identities = 631/836 (75%), Positives = 707/836 (84%)

Query:     1 MIR-RVKKLCPRNLYLSLTKNPNFRYPFHSNFIHHLDFNHKFIKNTSFSSRL-DYGETQN 58
             MIR R  K+ PRN+  +L+++     P     I     N K   + SF+ RL  Y   +N
Sbjct:     1 MIRGRTAKVIPRNVIFTLSRSSISESPL----ISPSRINPKLAGSFSFNIRLLSYFTVRN 56

Query:    59 -FVKDAIFFRKPNYV----------RSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGK 107
              F  D    R PN+V          R +CS K G  E    WTEE+EYLDESGSV+++GK
Sbjct:    57 GFCPDCSVPRDPNFVGLTTQCRSIVRRFCSEKIGSSESSG-WTEEVEYLDESGSVLHSGK 115

Query:   108 GIRSVEPGFDDHVMVGGIKKPFLNASAVAKIVEVVNRWKWGPELETQLDKLQFVPKMVHI 167
             GIRSVEPG DDHVMVGG+KKP++NAS+VAKIVEVV RWKWGPELETQLDKLQFVP MVHI
Sbjct:   116 GIRSVEPGLDDHVMVGGLKKPYMNASSVAKIVEVVQRWKWGPELETQLDKLQFVPNMVHI 175

Query:   168 TQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDS 227
             TQ+LK++ + D +LSLFRWAK+Q WY+P DECYV+LFD LN+ RDF G+ SLF+EMV DS
Sbjct:   176 TQSLKIVKEVDAALSLFRWAKKQPWYLPSDECYVVLFDGLNQGRDFVGIQSLFEEMVQDS 235

Query:   228 SKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPY 287
             S +G   F+AYN+VIQYLAKA+KLE+++CCFKK  +S CKIDTQ+YN LM LFLNKGLPY
Sbjct:   236 SSHGDLSFNAYNQVIQYLAKAEKLEVAFCCFKKAQESGCKIDTQTYNNLMMLFLNKGLPY 295

Query:   288 KAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLV 347
             KAFEIYESMEK +  LDGSTYEL+IPSLAKSGRLDAA KLFQ+MKER  RPSF++F+SLV
Sbjct:   296 KAFEIYESMEKTDSLLDGSTYELIIPSLAKSGRLDAAFKLFQQMKERKLRPSFSVFSSLV 355

Query:   348 DSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFR 407
             DSMGKAGRLDTSMKVYMEMQG GHRPSA M+VSLI+SYAKAGKLDTALRLWDEM+ +GFR
Sbjct:   356 DSMGKAGRLDTSMKVYMEMQGFGHRPSATMFVSLIDSYAKAGKLDTALRLWDEMKKSGFR 415

Query:   408 PNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKL 467
             PNFGL+TMIIESHAKSGKL++AM++F DME+AGFLPTPSTYSCLLEMHA SGQVDSAMK+
Sbjct:   416 PNFGLYTMIIESHAKSGKLEVAMTVFKDMEKAGFLPTPSTYSCLLEMHAGSGQVDSAMKI 475

Query:   468 YNSMTSAGLRPGLSTYXXXXXXXXXXXXVDVAAKILLEMKTMGYSVDVSASDVLMVYIKD 527
             YNSMT+AGLRPGLS+Y            VDVA KILLEMK MGYSVDV ASDVLM+YIKD
Sbjct:   476 YNSMTNAGLRPGLSSYISLLTLLANKRLVDVAGKILLEMKAMGYSVDVCASDVLMIYIKD 535

Query:   528 GSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLY 587
              SVD AL+WLRFMGSSGI+TNNFI+RQLFESCMKN LY+SA+PLLET V SA KVDLVLY
Sbjct:   536 ASVDLALKWLRFMGSSGIKTNNFIIRQLFESCMKNGLYDSARPLLETLVHSAGKVDLVLY 595

Query:   588 TSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFTGPEQRKQPVLSFVREFFHGID 647
             TS+LAHLVRCQDE  ER LM+ILSATKHKAHAF+CGLFTGPEQRKQPVL+FVREF+ GID
Sbjct:   596 TSILAHLVRCQDEDKERQLMSILSATKHKAHAFMCGLFTGPEQRKQPVLTFVREFYQGID 655

Query:   648 YELEEGAARYFXXXXXXXXXXMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL 707
             YELEEGAARYF          MGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL
Sbjct:   656 YELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQHIAWSLDVRNL 715

Query:   708 SVGAALIAVMHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL 767
             SVGAALIAV+HTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL
Sbjct:   716 SVGAALIAVVHTLHRFRKRMLYYGVVPRRIKLVTGPTLKIVIAQMLSSVESPFEVSKVVL 775

Query:   768 RAPGDSVMEWFKKPIVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPPKPLI 823
             RAPG+ VMEWFKKPIVQQFLLNEIPSR+DILMHKMN++FP SAPELRS+SPPKPL+
Sbjct:   776 RAPGELVMEWFKKPIVQQFLLNEIPSRSDILMHKMNVMFPSSAPELRSMSPPKPLM 831




GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
TAIR|locus:2027212 AT1G74750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093472 AT3G16010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077637 AT3G06920 "AT3G06920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157607 AT5G42310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024301 AT1G09820 "AT1G09820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SAK0PP132_ARATHNo assigned EC number0.77510.98910.9784yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0154007101
hypothetical protein (785 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-26
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-21
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-14
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-14
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-12
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-10
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-09
smart0046380 smart00463, SMR, Small MutS-related domain 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-07
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-06
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-06
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-04
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 7e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 9e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  116 bits (292), Expect = 1e-26
 Identities = 91/411 (22%), Positives = 180/411 (43%), Gaps = 45/411 (10%)

Query: 184 FRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQ 243
           FR+AK      P    + ML  V   S+D DG L                      RV++
Sbjct: 426 FRFAKLIR--NPTLSTFNMLMSVCASSQDIDGAL----------------------RVLR 461

Query: 244 YLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSL 303
            + +A             L +DCK+    Y  L++     G     FE++  M       
Sbjct: 462 LVQEAG------------LKADCKL----YTTLISTCAKSGKVDAMFEVFHEMVNAGVEA 505

Query: 304 DGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVY 363
           +  T+  +I   A++G++  A   +  M+ +N +P   +F +L+ + G++G +D +  V 
Sbjct: 506 NVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVL 565

Query: 364 MEMQGCGHRPSAPMYVS---LIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESH 420
            EM+   H P  P +++   L+++ A AG++D A  ++  +     +    ++T+ + S 
Sbjct: 566 AEMKAETH-PIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSC 624

Query: 421 AKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGL 480
           ++ G  D A+SI+ DM++ G  P    +S L+++   +G +D A ++       G++ G 
Sbjct: 625 SQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGT 684

Query: 481 STYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGS-VDHALRWLRF 539
            +Y++L+   +  K    A ++  ++K++     VS  + L+  + +G+ +  AL  L  
Sbjct: 685 VSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSE 744

Query: 540 MGSSGIRTNNFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSV 590
           M   G+  N      L  +  +    +    LL    E   K +LV+   +
Sbjct: 745 MKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCI 795


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|214676 smart00463, SMR, Small MutS-related domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 827
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.84
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
PRK14574822 hmsH outer membrane protein; Provisional 99.79
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.78
PRK14574822 hmsH outer membrane protein; Provisional 99.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.66
KOG2076895 consensus RNA polymerase III transcription factor 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.63
KOG2076895 consensus RNA polymerase III transcription factor 99.61
KOG2003840 consensus TPR repeat-containing protein [General f 99.57
KOG1915677 consensus Cell cycle control protein (crooked neck 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.49
KOG1915677 consensus Cell cycle control protein (crooked neck 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.45
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG0547606 consensus Translocase of outer mitochondrial membr 99.44
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.39
KOG2003840 consensus TPR repeat-containing protein [General f 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.36
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.36
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.36
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.3
KOG0547606 consensus Translocase of outer mitochondrial membr 99.29
PRK12370553 invasion protein regulator; Provisional 99.28
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
PRK12370553 invasion protein regulator; Provisional 99.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.21
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.21
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.19
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.17
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.16
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.15
PF1304150 PPR_2: PPR repeat family 99.14
KOG1129478 consensus TPR repeat-containing protein [General f 99.13
PF1304150 PPR_2: PPR repeat family 99.12
KOG1129478 consensus TPR repeat-containing protein [General f 99.09
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.09
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.08
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.08
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.07
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.02
PRK11189296 lipoprotein NlpI; Provisional 99.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.98
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.97
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.94
KOG2376652 consensus Signal recognition particle, subunit Srp 98.94
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.94
PRK11189296 lipoprotein NlpI; Provisional 98.92
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.92
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.91
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.9
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.88
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.87
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.82
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.81
KOG2376652 consensus Signal recognition particle, subunit Srp 98.8
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.77
PRK04841903 transcriptional regulator MalT; Provisional 98.76
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.74
KOG1125579 consensus TPR repeat-containing protein [General f 98.69
PLN02789320 farnesyltranstransferase 98.69
PRK04841903 transcriptional regulator MalT; Provisional 98.69
PLN02789320 farnesyltranstransferase 98.69
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.68
KOG1125579 consensus TPR repeat-containing protein [General f 98.67
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.65
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.63
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.62
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.62
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.56
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.54
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.53
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.48
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.46
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.43
PF1285434 PPR_1: PPR repeat 98.38
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.36
KOG1128777 consensus Uncharacterized conserved protein, conta 98.36
PF1285434 PPR_1: PPR repeat 98.35
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.29
KOG1128777 consensus Uncharacterized conserved protein, conta 98.29
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.28
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.2
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.19
PRK10370198 formate-dependent nitrite reductase complex subuni 98.18
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.17
PRK10370198 formate-dependent nitrite reductase complex subuni 98.14
PRK15359144 type III secretion system chaperone protein SscB; 98.13
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.13
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.12
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.12
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.11
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.08
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.03
PRK15359144 type III secretion system chaperone protein SscB; 98.02
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.95
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.9
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.86
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.8
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.79
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.69
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.67
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.6
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.57
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.56
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.54
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.53
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.5
KOG20411189 consensus WD40 repeat protein [General function pr 97.48
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.46
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.4
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.35
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.3
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.29
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.27
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.26
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.24
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.22
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.21
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.19
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.14
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.13
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.11
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.09
KOG0553304 consensus TPR repeat-containing protein [General f 97.07
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.06
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.02
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.01
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.96
COG4700251 Uncharacterized protein conserved in bacteria cont 96.96
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.85
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.83
KOG0553304 consensus TPR repeat-containing protein [General f 96.82
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.76
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.71
PF12688120 TPR_5: Tetratrico peptide repeat 96.61
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.55
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.53
PF12688120 TPR_5: Tetratrico peptide repeat 96.51
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.51
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.47
KOG20411189 consensus WD40 repeat protein [General function pr 96.44
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.43
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.41
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.36
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.32
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.22
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.21
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.19
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.0
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.99
COG4700251 Uncharacterized protein conserved in bacteria cont 95.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.75
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.74
COG3898531 Uncharacterized membrane-bound protein [Function u 95.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.67
PRK10803263 tol-pal system protein YbgF; Provisional 95.44
PF1337173 TPR_9: Tetratricopeptide repeat 95.43
PRK10803263 tol-pal system protein YbgF; Provisional 95.37
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.23
PRK15331165 chaperone protein SicA; Provisional 95.09
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.05
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.99
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.97
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.91
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.88
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.83
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.67
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.55
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.53
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.44
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.43
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.29
PF1337173 TPR_9: Tetratricopeptide repeat 94.25
COG3898531 Uncharacterized membrane-bound protein [Function u 94.23
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.09
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.07
PRK15331165 chaperone protein SicA; Provisional 93.76
KOG1585308 consensus Protein required for fusion of vesicles 93.68
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.68
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 93.59
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.58
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.58
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.56
smart00299140 CLH Clathrin heavy chain repeat homology. 93.53
KOG3941406 consensus Intermediate in Toll signal transduction 93.36
smart00299140 CLH Clathrin heavy chain repeat homology. 93.33
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.3
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.29
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.24
KOG4555175 consensus TPR repeat-containing protein [Function 93.14
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.09
KOG3941406 consensus Intermediate in Toll signal transduction 93.04
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.03
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.92
KOG4555175 consensus TPR repeat-containing protein [Function 92.87
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.79
KOG1258577 consensus mRNA processing protein [RNA processing 92.68
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.54
PF13512142 TPR_18: Tetratricopeptide repeat 92.44
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.37
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.24
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.23
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.1
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.1
PF1342844 TPR_14: Tetratricopeptide repeat 91.96
PRK11906458 transcriptional regulator; Provisional 91.93
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.86
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.78
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.57
KOG1585308 consensus Protein required for fusion of vesicles 91.56
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.49
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.34
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.15
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.13
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.12
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.97
KOG1550552 consensus Extracellular protein SEL-1 and related 90.9
PF1342844 TPR_14: Tetratricopeptide repeat 90.88
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.76
PF13512142 TPR_18: Tetratricopeptide repeat 90.76
PRK11906458 transcriptional regulator; Provisional 90.3
KOG2610491 consensus Uncharacterized conserved protein [Funct 90.08
COG3629280 DnrI DNA-binding transcriptional activator of the 90.04
COG3629280 DnrI DNA-binding transcriptional activator of the 89.74
KOG1941518 consensus Acetylcholine receptor-associated protei 89.42
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 89.4
KOG1550552 consensus Extracellular protein SEL-1 and related 89.36
COG1729262 Uncharacterized protein conserved in bacteria [Fun 89.2
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.8
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.95
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.29
COG4105254 ComL DNA uptake lipoprotein [General function pred 86.09
PRK09687280 putative lyase; Provisional 86.0
smart0046380 SMR Small MutS-related domain. 85.88
PF1343134 TPR_17: Tetratricopeptide repeat 85.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 85.01
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.69
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 84.36
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 83.83
KOG4570418 consensus Uncharacterized conserved protein [Funct 83.82
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.43
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.22
KOG4234271 consensus TPR repeat-containing protein [General f 82.08
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.81
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.78
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.37
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 81.24
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.24
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 80.34
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 80.12
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.7e-72  Score=666.36  Aligned_cols=600  Identities=17%  Similarity=0.261  Sum_probs=536.2

Q ss_pred             HHHHHHHccCChhHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHH
Q 003353          166 HITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYL  245 (827)
Q Consensus       166 ~~~~~l~~~~~~~~Al~~f~~~~~~~~~~p~~~~~~~li~~l~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~~~li~~~  245 (827)
                      .+...+.+.|+.++|+++|++|.+.+-..++...++.++..|.+.|.+++|..+|+.|.       .|+..+|+.++.+|
T Consensus       375 ~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~-------~pd~~Tyn~LL~a~  447 (1060)
T PLN03218        375 DAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIR-------NPTLSTFNMLMSVC  447 (1060)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcC-------CCCHHHHHHHHHHH
Confidence            34455556699999999999999987667888889999999999999999999999885       47899999999999


Q ss_pred             HHcCCHHHHHHHHHHhHhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHhHhCCccCCHHHHHHHHHHHHHcCCHHHHH
Q 003353          246 AKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAI  325 (827)
Q Consensus       246 ~~~g~~~~A~~~~~~m~~~g~~p~~~~~n~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~A~  325 (827)
                      ++.|++++|.++|++|.+.|+.||..+||+||.+|++.|++++|.++|++|.+.|+.||..||+.+|.+|++.|++++|.
T Consensus       448 ~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl  527 (1060)
T PLN03218        448 ASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAF  527 (1060)
T ss_pred             HhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHh--CCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Q 003353          326 KLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQG--CGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRI  403 (827)
Q Consensus       326 ~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~~--~g~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~  403 (827)
                      ++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|..  .|+.||..+|+++|.+|++.|++++|.++|++|.+
T Consensus       528 ~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e  607 (1060)
T PLN03218        528 GAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHE  607 (1060)
T ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999986  67899999999999999999999999999999999


Q ss_pred             cCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHhHHHHHHHHHHHCCCCCCHHHH
Q 003353          404 AGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTY  483 (827)
Q Consensus       404 ~g~~pd~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~  483 (827)
                      .|+.|+..+|+++|.+|++.|++++|.++|++|.+.|+.||..+|+++|.+|++.|++++|.++|++|.+.|+.||..+|
T Consensus       608 ~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~ty  687 (1060)
T PLN03218        608 YNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSY  687 (1060)
T ss_pred             cCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHCCCCchH-hHHHHHHHHHHcCCHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHHc
Q 003353          484 TALLTLLAKRKLVDVAAKILLEMKTMGYSVDV-SASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIVRQLFESCMKN  562 (827)
Q Consensus       484 ~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~-~~~~li~~y~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~ll~~~~~~  562 (827)
                      +++|.+|++.|++++|.++|++|.+.|+.|+. +|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.
T Consensus       688 nsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~  767 (1060)
T PLN03218        688 SSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERK  767 (1060)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHC
Confidence            99999999999999999999999999999995 89999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHh----cC-------------------CHHHHHHHHHHHhhccCchhH
Q 003353          563 ALYESAKPLLETYVESAAKVDLVLYTSVLAHLVR----CQ-------------------DEQNERHLMAILSATKHKAHA  619 (827)
Q Consensus       563 g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a~~~----~g-------------------~~~~a~~l~~~l~~~~~~~~~  619 (827)
                      |++++|.++|++|.+.|+.||..+|++|+..|.+    ++                   ..+.|..+|++|...+..++.
T Consensus       768 G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi~Pd~  847 (1060)
T PLN03218        768 DDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGTLPTM  847 (1060)
T ss_pred             CCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHHCCCCCCH
Confidence            9999999999999999999999999999976432    22                   236788899999998876664


Q ss_pred             HH-hhhccCCccccchhHHHHHHHhhccccccccC-cchhhHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCCceehhhh
Q 003353          620 FL-CGLFTGPEQRKQPVLSFVREFFHGIDYELEEG-AARYFVNVLLNYLVLMGQINRARCVWKVAYENKLFPKAIVFDQH  697 (827)
Q Consensus       620 ~~-~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~n~Li~~l~k~G~~~~A~~v~~~~~~~~~~p~~~~~~~~  697 (827)
                      .. ..++...  ...+....+.++++.+.  ..+. ....+||+||+++++.  .++|..+++.|.+.|+.|+.. +++.
T Consensus       848 ~T~~~vL~cl--~~~~~~~~~~~m~~~m~--~~~~~~~~~~y~~Li~g~~~~--~~~A~~l~~em~~~Gi~p~~~-~~~~  920 (1060)
T PLN03218        848 EVLSQVLGCL--QLPHDATLRNRLIENLG--ISADSQKQSNLSTLVDGFGEY--DPRAFSLLEEAASLGVVPSVS-FKKS  920 (1060)
T ss_pred             HHHHHHHHHh--cccccHHHHHHHHHHhc--cCCCCcchhhhHHHHHhhccC--hHHHHHHHHHHHHcCCCCCcc-cccC
Confidence            32 2222111  22223445566665542  2222 2356799999998432  468999999999999999975 3333


Q ss_pred             hhhhcccCccchHHHHHHHHHHHHHHHHHHHhCCCCCceee--------eecchh---------HHHHHHHHHhccCCCc
Q 003353          698 IAWSLDVRNLSVGAALIAVMHTLHRFRKRMLYYGVVPRRIK--------LVTGPT---------LKIVIAQMLSSVESPF  760 (827)
Q Consensus       698 i~w~~~~~~~~~g~a~~~~~~~~~~~~~~m~~~g~~P~~~~--------~~tg~~---------~~~~~~~~l~~~~~pf  760 (827)
                       .|.+|+|.|+.|+|.+++..|+..+.++.......|....        +-|+.+         +..+|+.+|.+++.||
T Consensus       921 -~~~~d~~~~~~~aa~~~l~~wl~~~~~~~~~g~~lp~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~l~~~~  999 (1060)
T PLN03218        921 -PIVIDAEELPVFAAEVYLLTILKGLKHRLAAGAKLPNVTILLPTEKKEIYTPKGEKTINLAGRVGQAVAALLRRLGLPY  999 (1060)
T ss_pred             -ceEEEcccCcchhHHHHHHHHHHHHHHHHhccCcCCcceeeeccccceeeccCCchhHHHHHHHHHHHHHHHHHhCCCC
Confidence             6999999999999999999999999877655446888776        344333         6788999999999999


Q ss_pred             eec--cceEEecchHHHHhhhc
Q 003353          761 EVS--KVVLRAPGDSVMEWFKK  780 (827)
Q Consensus       761 ~~~--~~~~~~~g~~~~~w~~~  780 (827)
                      ..+  +..+...|.+++.||+-
T Consensus      1000 ~~~~~~g~~~~~~~~~~~wl~~ 1021 (1060)
T PLN03218       1000 QGSESHGKLRINGLSLRRWFQP 1021 (1060)
T ss_pred             CCCCCCCeEEeccHHHHHHhcc
Confidence            984  45999999999999987



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>smart00463 SMR Small MutS-related domain Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query827
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 74.1 bits (180), Expect = 1e-13
 Identities = 32/230 (13%), Positives = 69/230 (30%), Gaps = 18/230 (7%)

Query: 324 AIKLFQEMKERNFRP-----SFNIFASLVDSMGKAGRLDTSMKVYME---------MQGC 369
           A  L ++ + +  R         +     +      RL    ++  +          +  
Sbjct: 27  AKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQA 86

Query: 370 GHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIA 429
              P       L++       LD       +   A             +    + +L +A
Sbjct: 87  PESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLA 146

Query: 430 MSIFT---DMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPGLSTYTAL 486
             +        +   L T   Y+ ++   A  G     + +   +  AGL P L +Y A 
Sbjct: 147 HHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAA 206

Query: 487 LTLLAKR-KLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALR 535
           L  + ++ +      + L +M   G  +    + VL+      +V  A+ 
Sbjct: 207 LQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVH 256


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
3u4t_A272 TPR repeat-containing protein; structural genomics 99.49
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.48
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.48
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.45
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.41
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.39
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.36
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.31
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.15
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.14
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.09
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.04
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.98
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.97
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.89
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.86
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.84
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.84
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.83
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.79
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.78
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.72
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.72
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.69
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.68
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.68
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.68
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.68
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.66
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.65
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.62
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.61
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.61
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.45
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.44
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.43
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.4
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.4
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.36
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.36
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.35
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.31
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.3
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.3
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.3
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.26
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.26
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.22
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.2
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.17
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.16
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.1
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.02
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.01
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.0
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.97
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.96
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.93
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.9
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.9
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.88
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.87
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.82
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.82
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.81
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.8
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.8
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.77
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.73
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.69
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.66
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.65
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.65
3k9i_A117 BH0479 protein; putative protein binding protein, 97.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.58
3k9i_A117 BH0479 protein; putative protein binding protein, 97.56
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.52
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.45
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.44
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.36
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.33
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.31
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.28
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.21
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.13
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.1
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.09
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.93
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.85
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.8
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.52
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.14
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.99
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.82
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.51
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.47
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.28
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.16
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.01
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.67
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.24
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.74
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.06
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.86
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.72
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.14
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.36
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.09
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.55
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.47
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.13
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.41
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 86.36
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.97
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.66
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.23
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.46
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 82.95
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.9e-35  Score=346.13  Aligned_cols=462  Identities=8%  Similarity=-0.013  Sum_probs=330.5

Q ss_pred             HccCChhHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHHHHcCCH
Q 003353          172 KVINDSDTSLSLFRWAKRQSWYVPGDECYVMLFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKL  251 (827)
Q Consensus       172 ~~~~~~~~Al~~f~~~~~~~~~~p~~~~~~~li~~l~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~~~li~~~~~~g~~  251 (827)
                      ...+++++|+.+|+.+..   ..|+..++..++.+|.+.|++++|..+|+++...     +++..+++.++.+|.++|++
T Consensus        95 ~~~g~~~~A~~~~~~~~~---~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-----~~~~~~~~~l~~~~~~~g~~  166 (597)
T 2xpi_A           95 LMQQQYKCAAFVGEKVLD---ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY-----NRSSACRYLAAFCLVKLYDW  166 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHH---HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG-----GTCHHHHHHHHHHHHHTTCH
T ss_pred             HHccCchHHHHHHHHHHh---hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc-----ccchhHHHHHHHHHHHHhhH
Confidence            344455555555554443   2344444445555555555555555555544322     33444555555555555555


Q ss_pred             HHHHHHHHHhHhC---------------CCCCCHHHHHHHHHHHHHcCChhHHHHHHHHhHhCCccCCHHHHHHHHHHHH
Q 003353          252 EMSYCCFKKVLDS---------------DCKIDTQSYNVLMTLFLNKGLPYKAFEIYESMEKGECSLDGSTYELMIPSLA  316 (827)
Q Consensus       252 ~~A~~~~~~m~~~---------------g~~p~~~~~n~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~li~~~~  316 (827)
                      ++|.++|+++...               +...+..+|+.++.+|.+.|++++|+++|++|.+.+.. +...+..+...+.
T Consensus       167 ~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~~~l~~~~~  245 (597)
T 2xpi_A          167 QGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAFDQLVSNHL  245 (597)
T ss_dssp             HHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHTTC
T ss_pred             HHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHHHHHHHhhc
Confidence            5555555422111               11123445555555555555555555555555443211 2223333332222


Q ss_pred             HcCCHHH--HHHH-HHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHH
Q 003353          317 KSGRLDA--AIKL-FQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKVYMEMQGCGHRPSAPMYVSLIESYAKAGKLDT  393 (827)
Q Consensus       317 ~~g~~~~--A~~~-~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~  393 (827)
                      ..+..+.  +..+ +..+...+..+...+|+.++..|.+.|++++|.++|+++.+.  +++..+|+.++.+|.+.|++++
T Consensus       246 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~  323 (597)
T 2xpi_A          246 LTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFID  323 (597)
T ss_dssp             SCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHH
T ss_pred             ccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHH
Confidence            1111111  1111 223333332333344555677888999999999999999865  5799999999999999999999


Q ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHhHHHHHHHHHHH
Q 003353          394 ALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFLPTPSTYSCLLEMHASSGQVDSAMKLYNSMTS  473 (827)
Q Consensus       394 A~~l~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~  473 (827)
                      |+++|+++.+.+.. +..+++.++.+|.+.|++++|.++++++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+
T Consensus       324 A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  401 (597)
T 2xpi_A          324 VLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSST  401 (597)
T ss_dssp             HHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHH
Confidence            99999999987644 77889999999999999999999999998654 34789999999999999999999999999987


Q ss_pred             CCCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCchHhHHHHHHHHHHcCCHHHHHHHHHHHhhCCCCCCHHHH
Q 003353          474 AGLRP-GLSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVLMVYIKDGSVDHALRWLRFMGSSGIRTNNFIV  552 (827)
Q Consensus       474 ~g~~p-d~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~~~~~p~~~~~  552 (827)
                      .  .| +..+|+.++.+|.+.|++++|.++|+++.+.++....++..++.+|.+.|++++|.++|+++.+... .+..+|
T Consensus       402 ~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~  478 (597)
T 2xpi_A          402 M--DPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQ-YDPLLL  478 (597)
T ss_dssp             H--CTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCC-CCHHHH
T ss_pred             h--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CChHHH
Confidence            3  34 5779999999999999999999999999998776667899999999999999999999999987542 367889


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHC----CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHhhccCchhHHHhhhcc
Q 003353          553 RQLFESCMKNALYESAKPLLETYVES----AAKVD--LVLYTSVLAHLVRCQDEQNERHLMAILSATKHKAHAFLCGLFT  626 (827)
Q Consensus       553 ~~ll~~~~~~g~~~~A~~~~~~m~~~----g~~pd--~~t~~~ll~a~~~~g~~~~a~~l~~~l~~~~~~~~~~~~~l~~  626 (827)
                      ..++..|.+.|++++|+++|+++.+.    +..|+  ..+|..+..+|.+.|++++|...++.+....+           
T Consensus       479 ~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p-----------  547 (597)
T 2xpi_A          479 NELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLST-----------  547 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSS-----------
T ss_pred             HHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCC-----------
Confidence            99999999999999999999999886    66787  78999999999999999999998877653211           


Q ss_pred             CCccccchhHHHHHHHhhccccccccCcchhhHHHHHHHHHHcCChhHHHHHHHHHHHCCC
Q 003353          627 GPEQRKQPVLSFVREFFHGIDYELEEGAARYFVNVLLNYLVLMGQINRARCVWKVAYENKL  687 (827)
Q Consensus       627 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~Li~~l~k~G~~~~A~~v~~~~~~~~~  687 (827)
                                                . ...+|..|+.+|.+.|++++|.+.|+++++..+
T Consensus       548 --------------------------~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p  581 (597)
T 2xpi_A          548 --------------------------N-DANVHTAIALVYLHKKIPGLAITHLHESLAISP  581 (597)
T ss_dssp             --------------------------C-CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             --------------------------C-ChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCC
Confidence                                      0 124567999999999999999999999998764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query827
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.12
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.05
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.02
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.85
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.28
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.23
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.2
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.17
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.1
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.08
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.0
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.92
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.8
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.76
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.67
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.63
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.59
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.52
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.36
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.32
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.28
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.28
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.23
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.19
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.12
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.94
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.21
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.34
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.11
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.65
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.09
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.53
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 81.82
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=2.4e-20  Score=201.19  Aligned_cols=382  Identities=13%  Similarity=0.099  Sum_probs=296.3

Q ss_pred             HHHHHHhcCChhHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHhHhCCCCCCHHHHHHHHHHHHH
Q 003353          203 LFDVLNESRDFDGMLSLFDEMVHDSSKNGISLFSAYNRVIQYLAKADKLEMSYCCFKKVLDSDCKIDTQSYNVLMTLFLN  282 (827)
Q Consensus       203 li~~l~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~n~li~~~~~  282 (827)
                      +...+.+.|++++|.+.++++++..    |.+..++..+...|.+.|++++|...|++..+..+. +..+|..+...|.+
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~----p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~   79 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE----PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKE   79 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC----TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC----CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhh
Confidence            3455677888888888888888776    777888888888888888888888888888776544 67788888888888


Q ss_pred             cCChhHHHHHHHHhHhCCccCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHH
Q 003353          283 KGLPYKAFEIYESMEKGECSLDGSTYELMIPSLAKSGRLDAAIKLFQEMKERNFRPSFNIFASLVDSMGKAGRLDTSMKV  362 (827)
Q Consensus       283 ~g~~~~A~~~~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~A~~~  362 (827)
                      .|++++|++.+....+... .+..............+....+........... .................+....+...
T Consensus        80 ~g~~~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (388)
T d1w3ba_          80 RGQLQEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKAC  157 (388)
T ss_dssp             HTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHH
T ss_pred             hcccccccccccccccccc-ccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHH
Confidence            8888888888888876532 344555555555666666666666666665554 34445555666677778888888888


Q ss_pred             HHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHcCCC
Q 003353          363 YMEMQGCGHRPSAPMYVSLIESYAKAGKLDTALRLWDEMRIAGFRPNFGLFTMIIESHAKSGKLDIAMSIFTDMERAGFL  442 (827)
Q Consensus       363 ~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~li~~~~~~g~~~~A~~~~~~m~~~g~~  442 (827)
                      +.+..... +.+...+..+...+...|++++|...+++..+.... +..++..+...+...|++++|...+++....+..
T Consensus       158 ~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~  235 (388)
T d1w3ba_         158 YLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN  235 (388)
T ss_dssp             HHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT
T ss_pred             HHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh
Confidence            87777654 345677778888888888999999888888776433 5677888888888999999999999888876433


Q ss_pred             CCHHHHHHHHHHHHHcCCHhHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCchHhHHHHH
Q 003353          443 PTPSTYSCLLEMHASSGQVDSAMKLYNSMTSAGLRPG-LSTYTALLTLLAKRKLVDVAAKILLEMKTMGYSVDVSASDVL  521 (827)
Q Consensus       443 p~~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd-~~t~~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~~~li  521 (827)
                       +...+..+...+.+.|++++|...|++..+  +.|+ ..++..+...+...|++++|.+.++......+.....+..+.
T Consensus       236 -~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~  312 (388)
T d1w3ba_         236 -HAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLA  312 (388)
T ss_dssp             -CHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHH
T ss_pred             -HHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHH
Confidence             677788888889999999999999999887  3454 567888888899999999999999998887666666778888


Q ss_pred             HHHHHcCCHHHHHHHHHHHhhCCCCCC-HHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCC
Q 003353          522 MVYIKDGSVDHALRWLRFMGSSGIRTN-NFIVRQLFESCMKNALYESAKPLLETYVESAAKVDLVLYTSVLAHLVRCQD  599 (827)
Q Consensus       522 ~~y~~~g~~~~A~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a~~~~g~  599 (827)
                      ..|.+.|++++|++.|++..+..  |+ ..++..+...|.+.|++++|+..|++.++..+. +...|..+..+|.+.||
T Consensus       313 ~~~~~~~~~~~A~~~~~~al~~~--p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~-~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         313 NIKREQGNIEEAVRLYRKALEVF--PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT-FADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHTTTCHHHHHHHHHHHTTSC--TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT-CHHHHHHHHHHHHHTCC
T ss_pred             HHHHHCCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCC
Confidence            89999999999999999988643  44 567778888899999999999999999886554 67788888888877664



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure