Citrus Sinensis ID: 003540
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 812 | ||||||
| 255573018 | 1028 | DNA repair helicase rad5,16, putative [R | 0.614 | 0.485 | 0.623 | 0.0 | |
| 297734859 | 1025 | unnamed protein product [Vitis vinifera] | 0.610 | 0.483 | 0.617 | 1e-169 | |
| 225436359 | 1016 | PREDICTED: putative SWI/SNF-related matr | 0.612 | 0.489 | 0.622 | 1e-169 | |
| 359479470 | 1029 | PREDICTED: putative SWI/SNF-related matr | 0.610 | 0.482 | 0.613 | 1e-168 | |
| 45935136 | 1040 | putative DNA repair protein [Ipomoea tri | 0.603 | 0.471 | 0.582 | 1e-162 | |
| 15242960 | 1029 | DNA/RNA helicase protein RAD5 [Arabidops | 0.614 | 0.484 | 0.574 | 1e-161 | |
| 297812401 | 1029 | hypothetical protein ARALYDRAFT_489124 [ | 0.614 | 0.484 | 0.568 | 1e-157 | |
| 356543536 | 1008 | PREDICTED: putative SWI/SNF-related matr | 0.359 | 0.289 | 0.847 | 1e-157 | |
| 356565705 | 1009 | PREDICTED: putative SWI/SNF-related matr | 0.363 | 0.292 | 0.838 | 1e-154 | |
| 224132088 | 896 | chromatin remodeling complex subunit [Po | 0.322 | 0.292 | 0.851 | 1e-154 |
| >gi|255573018|ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223533174|gb|EEF34931.1| DNA repair helicase rad5,16, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 645 bits (1665), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/518 (62%), Positives = 391/518 (75%), Gaps = 19/518 (3%)
Query: 1 MGTKVTDEVLSTVRSVVGPEFSNMDIIRALHMANHDPAAAINIIFDTPNF------KTPE 54
MG K+TDE+L+TVRS+VGPEFS+MDIIRALH++ +DP+AAINIIFDTPNF +TP
Sbjct: 1 MGNKMTDELLTTVRSIVGPEFSDMDIIRALHLSKNDPSAAINIIFDTPNFNSKLKPQTPY 60
Query: 55 IKPL-------AARRKLIISKENEIRASSENGTLAEAIAEG--YSEGSEWWFVGWGDVPA 105
P+ + ++SKENE R S + + + I + GSEWW+ G GDV
Sbjct: 61 KTPILENPNSNPTKEPKLVSKENENRNISVHNS--DNIEDNCINENGSEWWYAGSGDVAG 118
Query: 106 MSTSKGRKLRRGDEVTFTFPLKSFNSLSSKFPSKSFVRARQAVVPCSEIVRFSTKDAGEI 165
+STSKGRKL+ GD V FTFPLKS N+ +S K+F + RQ CSEIVRFST+D+GE+
Sbjct: 119 LSTSKGRKLKAGDGVIFTFPLKSSNTSNSPSQGKAFGKGRQPATACSEIVRFSTRDSGEV 178
Query: 166 GRIPHEWSRCLLPLVRDKKVEILGCCKSAPEVLGIMDTIVLSIRVYINSSMFRKHHATSL 225
GRIP+EW+RCLLPLVR KKV I G CKSAP++LGIMDTI+LSI VYINS++FR H TSL
Sbjct: 179 GRIPNEWARCLLPLVRYKKVRIEGYCKSAPDILGIMDTILLSISVYINSALFRMHQQTSL 238
Query: 226 KAGSNSAEDSVSLCHPLPNLFRLLGITPFKKAEFTPSDLYTRKRPLDSKDGCGLHASLLH 285
KA SN E+++ HPLPNLFRLLG+TPFKKAEFTP+DLYTRKRPL+SKDG G+ A LLH
Sbjct: 239 KAVSNPTEETI--VHPLPNLFRLLGLTPFKKAEFTPADLYTRKRPLNSKDGSGIPALLLH 296
Query: 286 ANKSKVQSAKVNDVDDVEPISDSDVDNIVGVGYSSEIEEMEPPSTLKCELRPYQKQALHW 345
NKSK QS ++V++ + ISD+D+DNIVGV SSE+EEM+PPSTL+CELRPYQKQAL W
Sbjct: 297 VNKSKNQSKDGSEVENEDSISDTDLDNIVGVRDSSELEEMDPPSTLQCELRPYQKQALQW 356
Query: 346 MVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGILA 405
M QLEKG+ DE AT LHPCWEAY L D+R+LVVYLN FSG+AT+EFPSTLQMARGGILA
Sbjct: 357 MYQLEKGKYTDEGATALHPCWEAYHLADQRQLVVYLNTFSGDATVEFPSTLQMARGGILA 416
Query: 406 DAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISDQSPNLMKKEPKSLSI 465
D+MGLGKT+MTI+LLL HS+RGG S Q SQ S + D SDQ PN K +
Sbjct: 417 DSMGLGKTIMTISLLLAHSERGGTSSTQFMSQLSTENSDVNDTSDQLPNPPKNTKRFSGF 476
Query: 466 DKLIKQTNTLINGGTLIICPMTLLGQWNKLIQKPYEEG 503
DKL+KQ L+NGG L+ICPMTLLGQW I+ + G
Sbjct: 477 DKLMKQKKILVNGGNLLICPMTLLGQWKAEIETHTQPG 514
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297734859|emb|CBI17093.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225436359|ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359479470|ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|45935136|gb|AAS79594.1| putative DNA repair protein [Ipomoea trifida] gi|117166029|dbj|BAF36331.1| hypothetical protein [Ipomoea trifida] | Back alignment and taxonomy information |
|---|
| >gi|15242960|ref|NP_197667.1| DNA/RNA helicase protein RAD5 [Arabidopsis thaliana] gi|60390961|sp|Q9FNI6.1|SM3L2_ARATH RecName: Full=Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2; Short=SMARCA3-like protein 2 gi|10178249|dbj|BAB11681.1| DNA repair protein RAD5 protein [Arabidopsis thaliana] gi|110737306|dbj|BAF00599.1| hypothetical protein [Arabidopsis thaliana] gi|332005687|gb|AED93070.1| DNA/RNA helicase protein RAD5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297812401|ref|XP_002874084.1| hypothetical protein ARALYDRAFT_489124 [Arabidopsis lyrata subsp. lyrata] gi|297319921|gb|EFH50343.1| hypothetical protein ARALYDRAFT_489124 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356543536|ref|XP_003540216.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356565705|ref|XP_003551078.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224132088|ref|XP_002328182.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222837697|gb|EEE76062.1| chromatin remodeling complex subunit [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 812 | ||||||
| TAIR|locus:2162504 | 1029 | RAD5 [Arabidopsis thaliana (ta | 0.612 | 0.482 | 0.581 | 7e-290 | |
| TAIR|locus:2158357 | 1277 | AT5G43530 [Arabidopsis thalian | 0.363 | 0.231 | 0.633 | 4.3e-191 | |
| ASPGD|ASPL0000056426 | 1202 | AN0044 [Emericella nidulans (t | 0.428 | 0.289 | 0.284 | 2.4e-55 | |
| POMBASE|SPAC13G6.01c | 1133 | rad8 "ubiquitin-protein ligase | 0.300 | 0.215 | 0.294 | 3e-43 | |
| CGD|CAL0004569 | 1084 | orf19.2097 [Candida albicans ( | 0.284 | 0.213 | 0.284 | 2.9e-41 | |
| DICTYBASE|DDB_G0272082 | 1838 | DDB_G0272082 "CHR group protei | 0.150 | 0.066 | 0.392 | 1.1e-38 | |
| UNIPROTKB|H7C5K0 | 425 | HLTF "Helicase-like transcript | 0.346 | 0.661 | 0.326 | 1e-35 | |
| MGI|MGI:1196437 | 1003 | Hltf "helicase-like transcript | 0.343 | 0.278 | 0.305 | 1e-32 | |
| UNIPROTKB|E2R9I5 | 1007 | HLTF "Uncharacterized protein" | 0.343 | 0.277 | 0.299 | 7.2e-32 | |
| UNIPROTKB|F1MLM2 | 1009 | HLTF "Uncharacterized protein" | 0.337 | 0.271 | 0.300 | 7.3e-32 |
| TAIR|locus:2162504 RAD5 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1448 (514.8 bits), Expect = 7.0e-290, Sum P(2) = 7.0e-290
Identities = 303/521 (58%), Positives = 370/521 (71%)
Query: 1 MGTKVTDEVLSTVRSVVGPEFSNMDIIRALHMANHDPAAAINIIFDTPNFKTPEIK-PLA 59
MGTKV+D+++STVRSVVG ++S+MDIIRALHMANHDP AAINIIFDTP+F P++ P
Sbjct: 1 MGTKVSDDLVSTVRSVVGSDYSDMDIIRALHMANHDPTAAINIIFDTPSFAKPDVATPTP 60
Query: 60 ARRKLIISKENEIRASS--ENGTLA---------EAIAEGYSE---GSEWWFVGWGDVPA 105
+ ++ ++ + ++G++ E++ G E G+EWWFVG ++
Sbjct: 61 SGSNGGKRVDSGLKGCTFGDSGSVGANHRVEEENESVNGGGEESVSGNEWWFVGCSELAG 120
Query: 106 MSTSKGRKLRRGDEVTFTFPLKSFNSLSSKFPSK-SFVRARQAVVPCSEIVRFSTKDAGE 164
+ST KGRKL+ GDE+ FTFP S P K F R R A+ S+IVRFSTKD+GE
Sbjct: 121 LSTCKGRKLKSGDELVFTFP-HSKGLKPETTPGKRGFGRGRPALRGASDIVRFSTKDSGE 179
Query: 165 IGRIPHEWSRCLLPLVRDKKVEILGCCKSAPEVLGIMDTIVLSIRVYINSSMFRKHHATS 224
IGRIP+EW+RCLLPLVRDKK+ I G CKSAPE L IMDTI+LS+ VYINSSMF+KH ATS
Sbjct: 180 IGRIPNEWARCLLPLVRDKKIRIEGSCKSAPEALSIMDTILLSVSVYINSSMFQKHSATS 239
Query: 225 LKAGSNSAEDSVSLCHPLPNLFRLLGITPFKKAEFTPSDLYTRKRPLDSKDGCGLHASLL 284
K SN+AE+S + HPLPNLFRLLG+ PFKKAEFTP D Y++KRPL SKDG + SLL
Sbjct: 240 FKTASNTAEES--MFHPLPNLFRLLGLIPFKKAEFTPEDFYSKKRPLSSKDGSAIPTSLL 297
Query: 285 HANKSKVQSAKVNDVDDVEPISDSDVDNIVGVGYSSEIEEMEPPSTLKCELRPYQKQALH 344
NK K + N ++ + ISD D+DNIVGVG SS ++EME P TL CELRPYQKQALH
Sbjct: 298 QLNKVKNMNQDANGDENEQCISDGDLDNIVGVGDSSGLKEMETPHTLLCELRPYQKQALH 357
Query: 345 WMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGIL 404
WM QLEKG C DEAAT LHPCWEAY L D+RELVVYLN+F+G+ATI FPSTLQMARGGIL
Sbjct: 358 WMTQLEKGNCTDEAATMLHPCWEAYCLADKRELVVYLNSFTGDATIHFPSTLQMARGGIL 417
Query: 405 ADAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISD-QSPNLMKKEPKSL 463
ADAMGLGKTVMTI+LLL HS + +G + D I + D SP + K K L
Sbjct: 418 ADAMGLGKTVMTISLLLAHSWKAASTGFLCPNYEGDKVISS-SVDDLTSPPV--KATKFL 474
Query: 464 SIDK-LIKQTNTLINGGTLIICPMTLLGQWNKLIQKPYEEG 503
DK L++Q + L NGG LI+CPMTLLGQW I+ + G
Sbjct: 475 GFDKRLLEQKSVLQNGGNLIVCPMTLLGQWKTEIEMHAKPG 515
|
|
| TAIR|locus:2158357 AT5G43530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000056426 AN0044 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC13G6.01c rad8 "ubiquitin-protein ligase E3 Rad8" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004569 orf19.2097 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272082 DDB_G0272082 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C5K0 HLTF "Helicase-like transcription factor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196437 Hltf "helicase-like transcription factor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R9I5 HLTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MLM2 HLTF "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| RAD5 | RAD5; ATP binding / ATP-dependent helicase/ DNA binding / helicase/ hydrolase, acting on acid anhydrides, in phosphorus-containing anhydrides / nucleic acid binding / protein binding / zinc ion binding; DNA repair gene. gamma-radiation hypersensitive (RAD5) involved in stable transformation and T-DNA transfer ; Possesses intrinsic ATP-dependent nucleosome-remodeling activity. This activity may be required for DNA repair (By similarity) (1029 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| UVH1 | • | • | 0.693 | ||||||||
| ATRAD51 | • | • | 0.678 | ||||||||
| UBC13 | • | 0.655 | |||||||||
| AT3G19120 | • | 0.599 | |||||||||
| RAD50 | • | 0.596 | |||||||||
| MUS81 | • | 0.593 | |||||||||
| RECQ4A | • | • | 0.587 | ||||||||
| PCNA1 | • | • | • | 0.547 | |||||||
| AT4G17760 | • | 0.504 | |||||||||
| APC11 | • | 0.468 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 812 | |||
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 1e-17 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-11 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 5e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-10 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 5e-10 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 6e-10 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 6e-09 | |
| pfam08797 | 95 | pfam08797, HIRAN, HIRAN domain | 8e-09 | |
| smart00910 | 90 | smart00910, HIRAN, The HIRAN protein (HIP116, Rad5 | 1e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-08 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-08 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 1e-07 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 2e-07 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 5e-06 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 3e-05 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 1e-04 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 5e-04 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 5e-04 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 0.002 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.002 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.003 |
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
Score = 84.3 bits (209), Expect = 1e-17
Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 6/101 (5%)
Query: 501 EEGDERGLKLVQSILKPIMLRRTKSSTDREGRPILVLPPADMQVIYCELTEAEKDFYEAL 560
E + G+ + +LKP +LRRTK ++ LPP V+YC L++ ++ Y+ L
Sbjct: 207 LEKGKEGINRLHKLLKPFLLRRTKDDVEKS------LPPKTEHVLYCNLSDEQRKLYKKL 260
Query: 561 FKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLV 601
+ ++ VE G AS+L L+++LR+ C+HP+L
Sbjct: 261 LTKRRLALSFAVEGGEKNVGIASLLNLIMQLRKICNHPYLF 301
|
This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|220020 pfam08797, HIRAN, HIRAN domain | Back alignment and domain information |
|---|
| >gnl|CDD|214906 smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 812 | |||
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 100.0 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 100.0 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 100.0 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 100.0 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 100.0 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 100.0 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 100.0 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 100.0 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 100.0 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 100.0 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 100.0 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 100.0 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 100.0 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 100.0 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 100.0 | |
| KOG1016 | 1387 | consensus Predicted DNA helicase, DEAD-box superfa | 100.0 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 100.0 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 99.97 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 99.93 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.9 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 99.77 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.7 | |
| PF08797 | 107 | HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN | 99.6 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.41 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 98.89 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.85 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.82 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.67 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.45 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.44 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.41 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.36 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.29 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.28 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.27 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 98.24 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.22 | |
| PF11496 | 297 | HDA2-3: Class II histone deacetylase complex subun | 98.16 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.13 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.1 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.07 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 98.06 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.04 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.02 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.97 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.95 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.9 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.83 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.73 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.68 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.64 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.63 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 97.62 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.59 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.59 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.53 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 97.43 | |
| PTZ00110 | 545 | helicase; Provisional | 97.32 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.26 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.26 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 97.23 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.19 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 97.0 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 96.96 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.92 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.9 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 96.76 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 96.73 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 96.71 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.67 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 96.66 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 96.64 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 96.55 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.53 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 96.48 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 96.45 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 96.45 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.34 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.32 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.3 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 96.18 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.17 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.16 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.12 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.12 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 96.07 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 96.04 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 96.03 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.03 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 96.01 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 95.96 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 95.92 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.89 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 95.87 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 95.87 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 95.83 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 95.83 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 95.79 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 95.78 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 95.75 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.64 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 95.62 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.59 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 95.51 | |
| PTZ00424 | 401 | helicase 45; Provisional | 95.47 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 95.38 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 95.38 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 95.36 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 95.31 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 95.23 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 95.19 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.18 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.17 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 95.15 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.08 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.99 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 94.97 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 94.91 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 94.63 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 94.62 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 94.56 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.48 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 93.86 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 93.81 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 93.76 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 93.72 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.48 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.46 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 93.45 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 93.3 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 93.27 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 93.2 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 93.13 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 93.1 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 93.0 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 92.94 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 92.71 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 92.66 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 92.63 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 92.55 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 92.49 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 92.4 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.19 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 92.18 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 92.07 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 91.4 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 91.25 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 91.22 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 90.96 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 90.88 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.55 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 90.36 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 90.35 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 90.31 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 90.15 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.02 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 90.0 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 89.82 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 89.7 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 89.65 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 89.6 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 89.27 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 89.16 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 89.16 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 88.83 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 88.65 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 88.35 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.34 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 87.99 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 87.68 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 87.26 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.22 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 86.57 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 85.84 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 85.72 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 85.36 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 84.74 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 84.22 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 83.99 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 83.94 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 83.93 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 82.8 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 81.27 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 80.82 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 80.57 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 80.06 |
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-63 Score=531.73 Aligned_cols=399 Identities=32% Similarity=0.512 Sum_probs=334.8
Q ss_pred CccCCCCcccccCChHHHHHHHHHHHhcccCCCcccccccCCccceeeeecCCCceeEEeecccCcccccCCcccccccC
Q 003540 322 IEEMEPPSTLKCELRPYQKQALHWMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARG 401 (812)
Q Consensus 322 l~~~~~p~~l~~~LrpyQkqgl~WMl~rE~~~~~~~~~~~~~plW~~~~~~d~~~~~fY~N~~tG~~s~~~P~~~~~~~G 401 (812)
...++||..+...|.|||++||+|+...|.. ...|
T Consensus 172 ~e~aeqP~dlii~LL~fQkE~l~Wl~~QE~S---------------------------------------------s~~G 206 (791)
T KOG1002|consen 172 AERAEQPDDLIIPLLPFQKEGLAWLTSQEES---------------------------------------------SVAG 206 (791)
T ss_pred hhcccCcccceecchhhhHHHHHHHHHhhhh---------------------------------------------hhcc
Confidence 3457999999999999999999999998762 3679
Q ss_pred ceeecCCCChhHHHHHHHHHhcccCCCCcccccCCCCCCCCccccc----------------------------------
Q 003540 402 GILADAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYD---------------------------------- 447 (812)
Q Consensus 402 GILADEMGLGKTIq~iaLI~~~~~~~~~l~v~p~s~~~~w~~e~~~---------------------------------- 447 (812)
||||||||+|||||+|||+++.....++++++|...+.+|.+|+..
T Consensus 207 GiLADEMGMGKTIQtIaLllae~~ra~tLVvaP~VAlmQW~nEI~~~T~gslkv~~YhG~~R~~nikel~~YDvVLTty~ 286 (791)
T KOG1002|consen 207 GILADEMGMGKTIQTIALLLAEVDRAPTLVVAPTVALMQWKNEIERHTSGSLKVYIYHGAKRDKNIKELMNYDVVLTTYA 286 (791)
T ss_pred ceehhhhccchHHHHHHHHHhccccCCeeEEccHHHHHHHHHHHHHhccCceEEEEEecccccCCHHHhhcCcEEEEecH
Confidence 9999999999999999999998888899999999999999888632
Q ss_pred ----------------------------------ccccCCcccccCccchhhHHHhhhcceeccCCceeeccc----chh
Q 003540 448 ----------------------------------ISDQSPNLMKKEPKSLSIDKLIKQTNTLINGGTLIICPM----TLL 489 (812)
Q Consensus 448 ----------------------------------~~de~~~~~~~~~~~~~~~~~~~~~~~~~~~gTlIv~P~----sll 489 (812)
++||+|.++.+.+......-.+.+.++|+++|||+.+.. +|+
T Consensus 287 vvEs~yRk~~~GfrrKngv~ke~SlLHsi~~~RiIlDEAH~IK~R~snTArAV~~L~tt~rw~LSGTPLQNrigElySLi 366 (791)
T KOG1002|consen 287 VVESVYRKQDYGFRRKNGVDKEKSLLHSIKFYRIILDEAHNIKDRQSNTARAVFALETTYRWCLSGTPLQNRIGELYSLI 366 (791)
T ss_pred HHHHHHHhccccccccCCcccccchhhhceeeeeehhhhcccccccccHHHHHHhhHhhhhhhccCCcchhhHHHHHHHH
Confidence 788999999888777666667788899999999984321 111
Q ss_pred ------------------------------------------HHhhhhhcCCcccC-----CHHHHHHHHHHhhhhhhhc
Q 003540 490 ------------------------------------------GQWNKLIQKPYEEG-----DERGLKLVQSILKPIMLRR 522 (812)
Q Consensus 490 ------------------------------------------~qW~~~i~~P~e~~-----~~~~~~~L~~iL~p~~LRR 522 (812)
-.|+.+..+|+..- ...++...+.+|.-+||||
T Consensus 367 RFL~i~Pfsyyfc~~cdc~~~~~~ftdr~~c~~c~h~~m~h~~~~n~~mlk~IqkfG~eGpGk~af~~~h~llk~Imlrr 446 (791)
T KOG1002|consen 367 RFLNINPFSYYFCTKCDCASLDWKFTDRMHCDHCSHNIMQHTCFFNHFMLKPIQKFGVEGPGKEAFNNIHTLLKNIMLRR 446 (791)
T ss_pred HHHccCcchhhhhhhccccccceeecccccCCcccchhhhhhhhhcccccccchhhcccCchHHHHHHHHHHHHHHHHHH
Confidence 12366677777642 2477889999999999999
Q ss_pred cccccccCCCCcccCCCCcEEEEEecCCHHHHHHHHHHHHHHHHHHHHHHhhccccccHHHHHHHHHHhhcccCCccccc
Q 003540 523 TKSSTDREGRPILVLPPADMQVIYCELTEAEKDFYEALFKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLVM 602 (812)
Q Consensus 523 tK~~v~~dG~plv~LPpk~~~vv~v~LS~~Er~~Y~~i~~~~~~~~~~~~~~g~~~~~~~~il~~l~rLRq~c~HP~L~~ 602 (812)
||-....| +.|||+.+.+..=-|+.+|.++|+.++...++.|+.+++.|.++.||.+||.+|+||||+..||+|+.
T Consensus 447 Tkl~RAdD----LgLPPRiv~vRrD~fn~eE~D~YeSLY~dSkrkfntyieeGvvlNNYAnIF~LitRmRQ~aDHP~LVl 522 (791)
T KOG1002|consen 447 TKLERADD----LGLPPRIVTVRRDFFNEEEKDLYESLYKDSKRKFNTYIEEGVVLNNYANIFTLITRMRQAADHPDLVL 522 (791)
T ss_pred hhcccccc----cCCCccceeeehhhhhhHHHHHHHHHHHhhHHhhhhHHhhhhhhhhHHHHHHHHHHHHHhccCcceee
Confidence 99888777 77999999999999999999999999999999999999999999999999999999999999999996
Q ss_pred cCCCcchhhHHHHHHHHHhccCCCcccCCCCCCCchHHHHHHHHHHHccCCCCCCccccccccccccCCcchhchhhhhh
Q 003540 603 SRGDTQDYSDLNKLAKRFLKGSSNALEGEDKDVPSRAYVQEVVEELQKGEQGECPICLEAFEDAVLTPCAHRLCRECLLG 682 (812)
Q Consensus 603 ~~~~~~~~~dl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~eC~iC~~~~~~~~vt~C~H~~C~~Cl~~ 682 (812)
..... .+ .. .+....+|.+|.++.++.+.+.|.|.||+-|+.+
T Consensus 523 ~S~~~-----------n~--------~~------------------enk~~~~C~lc~d~aed~i~s~ChH~FCrlCi~e 565 (791)
T KOG1002|consen 523 YSANA-----------NL--------PD------------------ENKGEVECGLCHDPAEDYIESSCHHKFCRLCIKE 565 (791)
T ss_pred ehhhc-----------CC--------Cc------------------cccCceeecccCChhhhhHhhhhhHHHHHHHHHH
Confidence 32000 00 00 0123468999999999999999999999999999
Q ss_pred hhcC---CCCCCCCCCCccccccccccCCCC---Ccc-------ccccccccccchhHHHHHHHHHHHccC--CCeEEEE
Q 003540 683 SWKT---PTSGLCPVCRKTISRQDLITAPTG---SRF-------QVDIEKNWVESTKIAVLLKELENLCLS--GSKSILF 747 (812)
Q Consensus 683 ~~~~---~~~~~CP~Cr~~i~~~~l~~~~~~---~~~-------~~~~~~~~~~SsKl~aLl~~L~~l~~~--~~KvVVF 747 (812)
|+.. .....||.|..+++.+.--..... ..| +++. +.|..|+||+||++.|.-+++. .-|.|||
T Consensus 566 yv~~f~~~~nvtCP~C~i~LsiDlse~alek~~l~~Fk~sSIlnRinm-~~~qsSTKIEAL~EEl~~l~~rd~t~KsIVF 644 (791)
T KOG1002|consen 566 YVESFMENNNVTCPVCHIGLSIDLSEPALEKTDLKGFKASSILNRINM-DDWQSSTKIEALVEELYFLRERDRTAKSIVF 644 (791)
T ss_pred HHHhhhcccCCCCccccccccccccchhhhhcchhhhhhHHHhhhcch-hhhcchhHHHHHHHHHHHHHHcccchhhhhH
Confidence 8853 335899999999887621111110 011 1222 3789999999999999988766 6799999
Q ss_pred cCcHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHhhcCCCcEEEEEeCCCCcccc
Q 003540 748 SQWTAFLDLLQIPLSRNNIPFLRLDGTLNQQQREKVLKQFSEDNNIMVSDSSFLKDFFSL 807 (812)
Q Consensus 748 SQfts~LdlIe~~L~~~gi~~~rlDGs~s~~~R~~~I~~F~~~~~~~VlLlSlrAGG~GL 807 (812)
||||+|||+|+-.|.+.|+..+.++|+|++++|.+.|+.|.++++|+|||+|++|||+.|
T Consensus 645 SQFTSmLDLi~~rL~kaGfscVkL~GsMs~~ardatik~F~nd~~c~vfLvSLkAGGVAL 704 (791)
T KOG1002|consen 645 SQFTSMLDLIEWRLGKAGFSCVKLVGSMSPAARDATIKYFKNDIDCRVFLVSLKAGGVAL 704 (791)
T ss_pred HHHHHHHHHHHHHhhccCceEEEeccCCChHHHHHHHHHhccCCCeEEEEEEeccCceEe
Confidence 999999999999999999999999999999999999999999999999999999999986
|
|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PF08797 HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 812 | ||||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 6e-06 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 2e-05 | ||
| 3hcs_A | 170 | Crystal Structure Of The N-Terminal Domain Of Traf6 | 2e-05 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 5e-05 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 9e-05 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 1e-04 | ||
| 2xeu_A | 64 | Ring Domain Length = 64 | 6e-04 | ||
| 1z63_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM | 7e-04 | ||
| 1z6a_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN | 7e-04 | ||
| 4ap4_A | 133 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 8e-04 |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
|
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|3HCS|A Chain A, Crystal Structure Of The N-Terminal Domain Of Traf6 Length = 170 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|2XEU|A Chain A, Ring Domain Length = 64 | Back alignment and structure |
| >pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 | Back alignment and structure |
| >pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 | Back alignment and structure |
| >pdb|4AP4|A Chain A, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 133 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 812 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 6e-17 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 1e-12 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 2e-09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 3e-16 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 1e-15 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-15 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 4e-15 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 8e-15 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 1e-14 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-14 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 3e-14 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-14 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 3e-14 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 5e-14 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 7e-14 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 7e-14 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 8e-14 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-13 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 5e-13 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-13 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 6e-13 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 7e-13 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 1e-12 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 1e-12 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-12 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 3e-12 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-12 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 3e-12 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 7e-10 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 6e-12 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 9e-12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 9e-12 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 1e-11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 1e-11 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 3e-11 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 5e-11 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 9e-11 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 1e-10 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 2e-10 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 3e-10 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 6e-10 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 3e-09 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 8e-09 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 3e-09 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 6e-07 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 2e-06 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 6e-09 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 7e-09 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 9e-09 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 1e-08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 1e-04 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 1e-08 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 1e-08 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 2e-08 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 4e-08 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 4e-08 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 7e-08 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 1e-07 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 3e-07 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 6e-07 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 6e-07 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 3e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 2e-06 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 3e-06 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 3e-06 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 4e-06 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 1e-05 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 5e-05 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 1e-05 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 4e-05 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 4e-04 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 4e-04 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 6e-04 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 86.1 bits (212), Expect = 3e-17
Identities = 87/617 (14%), Positives = 185/617 (29%), Gaps = 148/617 (23%)
Query: 263 DLYTRKRPLDSKDGCGLHASLLHANKSK-VQSAKVNDVDDVEP--ISDSDVDNIVGVGYS 319
D T + KD +L + V + DV D+ +S ++D+I+ +
Sbjct: 8 DFETGEHQYQYKD-------ILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDA 60
Query: 320 SE-------IEEMEPPSTLKCELRPYQKQALHWMVQLEKGRCLDEAATTLHPCWEAYRLL 372
+ ++ + + +++ K + T + RL
Sbjct: 61 VSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLY 120
Query: 373 DERELVVYLNAFSGEATIEFPSTLQMAR--GGILADAM-GLGKTVMTIALLLTHSQRGGL 429
++ ++ N + ++ L R +L D + G GKT + + + L++
Sbjct: 121 NDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYK----- 175
Query: 430 SGIQSASQPSDGGIEGYDIS---DQSPNLMKKEPKSLSIDKLIKQTNTLINGGTLIICPM 486
+Q D I + ++ SP + + + L ++ + + + I +
Sbjct: 176 --VQCKM---DFKI--FWLNLKNCNSPETVLEMLQKLLY-QIDPNWTSRSDHSSNIKLRI 227
Query: 487 TLLGQWNK--LIQKPYEEG----DERGLKLVQS--ILKP-------IMLRRTKSSTDREG 531
+ + L KPYE VQ+ ++ R K TD
Sbjct: 228 HSIQAELRRLLKSKPYENCLLVLLN-----VQNAKAWNAFNLSCKILLTTRFKQVTD--- 279
Query: 532 RPILVLPPADMQVIYCELTEAEKDFYEALFKRSKVKFDQFVEQGRILHNYASILELLLRL 591
L A I L E +L Y L
Sbjct: 280 ----FLSAATTTHI--SLDHHSMTLTPD-------------EVKSLLLKYLDCRPQDLPR 320
Query: 592 RQCCDHPFLV----------MSRGDTQDYSDLNKLAKRFLKGSSNALEG----------- 630
+P + ++ D + + +KL ++ S N LE
Sbjct: 321 EVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKL-TTIIESSLNVLEPAEYRKMFDRLS 379
Query: 631 ---EDKDVPSRAYVQEVVEELQKGEQGECPICLEAFEDAVLTPCAHRLCRECLL-GSWKT 686
+P+ ++ + V ++L + L+ K
Sbjct: 380 VFPPSAHIPT-----ILLSLIWFDVIKSDV------MVVV-----NKLHKYSLVEKQPKE 423
Query: 687 PTSGL--------CPVCRKTISRQDLITA--PTGSRFQVDIEKNWVES---TKIAVLLKE 733
T + + + + ++ + D+ +++ + I LK
Sbjct: 424 STISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKN 483
Query: 734 LENLCLSGSKSILFSQWTAFLDL--LQIPLSRNNIPFLRLDGTLNQQQREKVLKQFSEDN 791
+E+ + LF FLD L+ + ++ + LN Q+ K K + DN
Sbjct: 484 IEH----PERMTLFRMV--FLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDN 537
Query: 792 N----IMVSDSSFLKDF 804
+ +V+ + DF
Sbjct: 538 DPKYERLVNA---ILDF 551
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 812 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-14 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 9e-14 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-13 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 8e-13 | |
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 1e-11 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 2e-11 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-11 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 2e-10 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-08 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 4e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 6e-08 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 6e-07 | |
| d1z5za1 | 244 | c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h | 1e-06 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 5e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 6e-06 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-05 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 3e-05 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 4e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 4e-04 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 66.2 bits (161), Expect = 3e-14
Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
Query: 656 CPICLEAFEDAVLTPCAHRLCRECLLGSWKTPTSGLCPVCRKTISRQDLIT 706
C IC E +D + PC H +C CL SW+ CP CR I + I
Sbjct: 26 CKICAENDKDVKIEPCGHLMCTSCLT-SWQESEGQGCPFCRCEIKGTEPIV 75
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 812 | |||
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.95 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.93 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.92 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.89 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.8 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.8 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.74 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.61 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.61 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.58 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.52 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 98.38 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.31 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.3 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 98.3 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.27 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 98.26 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.26 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.25 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 98.24 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 98.24 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.22 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.21 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.17 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.16 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.12 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.11 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.07 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.97 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.97 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.58 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.42 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.22 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 96.84 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 96.32 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.61 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.32 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 93.43 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 93.23 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 92.62 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 91.56 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 91.26 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 90.26 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 89.22 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 83.75 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 83.04 | |
| d1ufza_ | 83 | HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 | 82.39 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 81.41 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 81.36 |
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Rad54-like, Rad54L species: Zebra fish (Danio rerio) [TaxId: 7955]
Probab=99.95 E-value=1.4e-26 Score=198.77 Aligned_cols=175 Identities=25% Similarity=0.312 Sum_probs=130.9
Q ss_pred CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf 89980999980399999999999999999999999841011012999999999862006896321367996103579999
Q 003540 537 LPPADMQVIYCELTEAEKDFYEALFKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLVMSRGDTQDYSDLNKL 616 (812)
Q Consensus 537 LPpk~~~iv~v~LS~~Er~~Y~~i~~~~~~~~~~~~~~g~~~~~~~~il~~llrLRq~c~HP~Li~~~~~~~~~~dl~~l 616 (812)
||||++.+++|+||+.|+.+|+.++...+.. ..........++|..+++|||+||||.|+.....
T Consensus 9 LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~~-----~~~~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~---------- 73 (346)
T d1z3ix1 9 LPVKIEQVVCCNLTPLQKELYKLFLKQAKPV-----ESLQTGKISVSSLSSITSLKKLCNHPALIYEKCL---------- 73 (346)
T ss_dssp SCCEEEEEEEECCCHHHHHHHHHHHHHHCGG-----GSSCTTCCCHHHHHHHHHHHHHHHCTHHHHHHHH----------
T ss_pred CCCCEEEEEEECCCHHHHHHHHHHHHHHHHH-----HHHHCCCCHHHHHHHHHHHHHHHCCHHHHHHHHC----------
T ss_conf 8898799999697999999999999989999-----8654487168999999999999579988611110----------
Q ss_pred HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHCHHHHHHHHCCCCCCCCCCCC
Q ss_conf 99985268875568989998468899999999706779997610012444115775200045554310489999998988
Q 003540 617 AKRFLKGSSNALEGEDKDVPSRAYVQEVVEELQKGEQGECPICLEAFEDAVLTPCAHRLCRECLLGSWKTPTSGLCPVCR 696 (812)
Q Consensus 617 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~eC~iC~~~~~~~~it~C~H~~C~~Cl~~~~~~~~~~~CP~Cr 696 (812)
..... . +....
T Consensus 74 -----~~~~~-~--------------------------~~~~~------------------------------------- 84 (346)
T d1z3ix1 74 -----TGEEG-F--------------------------DGALD------------------------------------- 84 (346)
T ss_dssp -----HTCTT-C--------------------------TTGGG-------------------------------------
T ss_pred -----CCCCC-C--------------------------CCHHH-------------------------------------
T ss_conf -----22112-3--------------------------20033-------------------------------------
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf 655555520179999630011223454135999999999770-1898699984938799999998872999989992899
Q 003540 697 KTISRQDLITAPTGSRFQVDIEKNWVESTKIAVLLKELENLC-LSGSKSILFSQWTAFLDLLQIPLSRNNIPFLRLDGTL 775 (812)
Q Consensus 697 ~~i~~~~l~~~~~~~~~~~~~~~~~~~SsKi~aLi~~L~~l~-~~~~KvVVFSQfts~LdlIe~~L~~~gi~~~rlDGs~ 775 (812)
..+.. ..........|+|+..|.++|..+. ..++|+||||||+.++++|+..|...|+.|+++||++
T Consensus 85 ---------~~~~~---~~~~~~~~~~S~Kl~~L~~ll~~~~~~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~ 152 (346)
T d1z3ix1 85 ---------LFPQN---YSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTM 152 (346)
T ss_dssp ---------TSCSS---CCSSSCCGGGSHHHHHHHHHHHHHHHHCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSC
T ss_pred ---------HCCCC---CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHHHCCCCCCCCCH
T ss_conf ---------12334---100001400178999999999998875189516886301456799999763002411011100
Q ss_pred CHHHHHHHHHHHHCCC-CCEEEEEECCCCCCCC
Q ss_conf 9999999999751499-9289988078786555
Q 003540 776 NQQQREKVLKQFSEDN-NIMVSDSSFLKDFFSL 807 (812)
Q Consensus 776 s~~~R~~vi~~F~~~~-~~~VLLlSlkAGG~GL 807 (812)
+.++|+++++.|+++. ...|||+|++|||+||
T Consensus 153 ~~~~R~~~i~~F~~~~~~~~vlLls~~agg~Gl 185 (346)
T d1z3ix1 153 SIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGL 185 (346)
T ss_dssp CHHHHHHHHHHHHSTTCCCCEEEEEGGGSCTTC
T ss_pred HHHHHHHHHHHHHCCCCCCEEEEECCHHHHHCC
T ss_conf 278899999865102343302540331444335
|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|