Citrus Sinensis ID: 003625

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------
MAPFPAENGVEGDDEREEEEEEDEDEEEEEEEEEEEPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEcccEEEEEcccccEEEEEccccccccEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccEEEEEEccccccccccEEEEEcccccEEEEEEcccccccEEEccccccEEEEEEcccEEEEEEcccEEEEEcccccEEEEEEccccccccccccccEEEccccEEEEEEcccEEEEEEEEccccccccccccccccEEEEEEEEEccEEEEccccccccEEEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccccccccccccccccccEEEHccccHHHHHcccccEEEEEcccEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEccccEEEEEEccccccccccEEEEccccccEEEEEcccccccccEEEcccccEEEEEEcccEEEEEccccEEEEEccccEEEEEEcccccccccHHccccEEEccccEEEEEEccEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEEEEEccccccEEEEEEEccccccccccccccccccccccccEEEEEEccccEEccccEEcccccEcccccccccccccccccccccccccccccEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHcc
mapfpaengvegddereeeeeededeeeeeeeeeeeprlkyqrmggslpsllANDAASCVAVAERMIALGTHAGTVHILDFLGnqvkefpahtaavndlsfdvdgeyvgscsddgsvvinslftdekmkfdyhrpmkaisldpdytrkMSRRFVAGGLAghlylnskkwlgyrdqvlhsgegpvHVVKWRTSLIAWANDAGVKVYDAANDQRITfierprgsprpelllphlvwqddtllvIGWGTYIKIASIKTnqsnvangtyrhvgMNQVDIVASFQTSyyisgiapfgDCLVVLAyipgeedgekefsstlpsrqgnaqrpevrivtwnndelttdalpvlgfehykakdyslahapfsgssyaggqwaagdeplyyivspkdvviakprdAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHlrqlpvlvpymptenprlrdTAYEVALVALATNPSFHKYLLStvkswppviysalpvisaiepqlnsssMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFdfienhnlhDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFevnphagkdfHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLehtvgnldplyivnmvpngleipRLRDRLVKIITDYRtetslrhgcnDILKVL
mapfpaengvegddereeeeeededeeeeeeeeeeeprlkyQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTdekmkfdyhrpmkaisldpdytRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFierprgsprpeLLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFsstlpsrqgnaqrpevrivTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLiqnkdlitpsEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVpngleiprlRDRLVKIITDyrtetslrhgcndilkvl
MAPFPAENGVegddereeeeeededeeeeeeeeeeePRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
**************************************************LLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERP****RPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIP************************VRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQL****MTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDIL***
***************************************KYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQS********HVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYI**********************RPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAP*********QWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
*****************************************QRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEE******************RPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
***********************************EPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQ********RHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGE****************NAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPFPAENGxxxxxxxxxxxxxxxxxxxxxxxxxxxPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMNQVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query807 2.2.26 [Sep-21-2011]
P93231 960 Vacuolar protein sorting- N/A no 0.996 0.837 0.855 0.0
P93043 980 Vacuolar protein sorting- yes no 0.951 0.783 0.831 0.0
Q5KU39853 Vacuolar protein sorting- yes no 0.903 0.854 0.385 1e-155
P49754854 Vacuolar protein sorting- yes no 0.903 0.853 0.384 1e-155
Q9P7N3871 Vacuolar protein sorting- yes no 0.909 0.842 0.317 1e-115
Q19954901 Vacuolar protein sorting- yes no 0.890 0.798 0.262 2e-73
Q618H8898 Vacuolar protein sorting- N/A no 0.914 0.821 0.269 4e-72
P38959992 Vacuolar protein sorting- no no 0.915 0.744 0.231 4e-55
>sp|P93231|VPS41_SOLLC Vacuolar protein sorting-associated protein 41 homolog OS=Solanum lycopersicum GN=VPS41 PE=2 SV=1 Back     alignment and function desciption
 Score = 1418 bits (3670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/808 (85%), Positives = 747/808 (92%), Gaps = 4/808 (0%)

Query: 1   MAPFPAENGVEGDDEREEEEEEDEDEEEEEEEEEEEPRLKYQRMGGSLPSLLANDAASCV 60
           M+P P+ENG++  D+  +EEEED +EEE EEEEE+EPRLKYQRMG S+PSLL+ DAA+C+
Sbjct: 1   MSPKPSENGID-GDDERDEEEEDSEEEEAEEEEEDEPRLKYQRMGASVPSLLSADAATCI 59

Query: 61  AVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSDDGSVVIN 120
           AVAERMIALGTH G VHILDFLGNQVKEF AHTAAVNDL FD DGEYVGSCSDDGSVVIN
Sbjct: 60  AVAERMIALGTHGGAVHILDFLGNQVKEFAAHTAAVNDLCFDTDGEYVGSCSDDGSVVIN 119

Query: 121 SLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQVLHSG 180
           SLFTDE+MKF+YHRPMKAI+LDPDY R  SRRFV GGLAG LYLN KKWLGYRDQVLHSG
Sbjct: 120 SLFTDERMKFEYHRPMKAIALDPDYARTSSRRFVTGGLAGQLYLNVKKWLGYRDQVLHSG 179

Query: 181 EGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLL 240
           EGP+H VKWRTSL+AWAND GVKVYDA+NDQRITFIERPRG PRPELLLPH+VWQDD+LL
Sbjct: 180 EGPIHAVKWRTSLVAWANDTGVKVYDASNDQRITFIERPRGIPRPELLLPHIVWQDDSLL 239

Query: 241 VIGWGTYIKIASIKTNQSNVANGTYRHVGM---NQVDIVASFQTSYYISGIAPFGDCLVV 297
           VIGWGT +KIA I+T QS  ANGTY+H+ M   NQVDIVASFQTSY+ISGIAPFGD LV+
Sbjct: 240 VIGWGTSVKIALIRTTQSKGANGTYKHMSMSSLNQVDIVASFQTSYFISGIAPFGDSLVI 299

Query: 298 LAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYKAKDYSL 357
           LAYIPGEEDGEK+FSST+PSRQGNAQRPEVR+VTWNNDEL TDALPV GFEHYKAKDYSL
Sbjct: 300 LAYIPGEEDGEKDFSSTIPSRQGNAQRPEVRVVTWNNDELATDALPVHGFEHYKAKDYSL 359

Query: 358 AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVE 417
           AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHI WLL+HGWHEKAL AVE
Sbjct: 360 AHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHINWLLQHGWHEKALEAVE 419

Query: 418 AGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL 477
           A QG+SELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL
Sbjct: 420 ANQGQSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVL 479

Query: 478 VPYMPTENPRLRDTAYEVALVALATNPSFHKYLLSTVKSWPPVIYSALPVISAIEPQLNS 537
           VPY+PTENPRLRDTAYEVALVALATNPSFHK LLSTVKSWPP IYS  PV SAIEPQ+N+
Sbjct: 480 VPYIPTENPRLRDTAYEVALVALATNPSFHKDLLSTVKSWPPRIYSTTPVFSAIEPQINT 539

Query: 538 SSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREKVVQLMLLD 597
           SSMTD LKEALAELYVIDG ++KAF+LYADLMKP +FDFIE HNLHDA+REKV+QLM++D
Sbjct: 540 SSMTDPLKEALAELYVIDGQHDKAFALYADLMKPDLFDFIEKHNLHDAVREKVLQLMMID 599

Query: 598 CKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQV 657
           CKRAV LLIQ +DLI PSEVV+QL+ ARDKCD RYFLHLYLH+LFEVN HAGKD+HDMQV
Sbjct: 600 CKRAVLLLIQQRDLIPPSEVVSQLIAARDKCDYRYFLHLYLHSLFEVNLHAGKDYHDMQV 659

Query: 658 ELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKL 717
           ELYADYD KMLL FLRSSQHYTLEKAYEICVK+DLL+EQVFILGRMGN K ALAVIIN+L
Sbjct: 660 ELYADYDPKMLLTFLRSSQHYTLEKAYEICVKKDLLKEQVFILGRMGNAKQALAVIINRL 719

Query: 718 GDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIP 777
           GDIEEA+EFV+MQ DDELWEELI+Q  +KPEMVGVLLEHTVGNLDPLYIVNM+PN LEIP
Sbjct: 720 GDIEEAIEFVSMQQDDELWEELIQQSFHKPEMVGVLLEHTVGNLDPLYIVNMLPNDLEIP 779

Query: 778 RLRDRLVKIITDYRTETSLRHGCNDILK 805
           RLRDRLVKI+TDYRTETSLRHGCNDILK
Sbjct: 780 RLRDRLVKIVTDYRTETSLRHGCNDILK 807
Required for vacuolar assembly and vacuolar traffic.
Solanum lycopersicum (taxid: 4081)
>sp|P93043|VPS41_ARATH Vacuolar protein sorting-associated protein 41 homolog OS=Arabidopsis thaliana GN=VPS41 PE=3 SV=3 Back     alignment and function description
>sp|Q5KU39|VPS41_MOUSE Vacuolar protein sorting-associated protein 41 homolog OS=Mus musculus GN=Vps41 PE=2 SV=1 Back     alignment and function description
>sp|P49754|VPS41_HUMAN Vacuolar protein sorting-associated protein 41 homolog OS=Homo sapiens GN=VPS41 PE=1 SV=3 Back     alignment and function description
>sp|Q9P7N3|VPS41_SCHPO Vacuolar protein sorting-associated protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps41 PE=3 SV=2 Back     alignment and function description
>sp|Q19954|VPS41_CAEEL Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis elegans GN=vps-41 PE=3 SV=4 Back     alignment and function description
>sp|Q618H8|VPS41_CAEBR Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis briggsae GN=vps-41 PE=3 SV=1 Back     alignment and function description
>sp|P38959|VPS41_YEAST Vacuolar protein sorting-associated protein 41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS41 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query807
359479329 960 PREDICTED: vacuolar protein sorting-asso 0.952 0.801 0.902 0.0
255565515 955 vacuolar protein sorting vps41, putative 0.996 0.841 0.883 0.0
297734881 908 unnamed protein product [Vitis vinifera] 0.944 0.839 0.901 0.0
356539325 957 PREDICTED: vacuolar protein sorting-asso 0.997 0.841 0.877 0.0
224104751 952 predicted protein [Populus trichocarpa] 0.998 0.846 0.880 0.0
356544684 957 PREDICTED: vacuolar protein sorting-asso 0.997 0.841 0.874 0.0
449443388 960 PREDICTED: vacuolar protein sorting-asso 0.951 0.8 0.878 0.0
449516828 960 PREDICTED: vacuolar protein sorting-asso 0.951 0.8 0.878 0.0
224058957 951 predicted protein [Populus trichocarpa] 0.982 0.833 0.870 0.0
350536253 960 vacuolar protein sorting-associated prot 0.996 0.837 0.855 0.0
>gi|359479329|ref|XP_002273250.2| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1467 bits (3798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/772 (90%), Positives = 734/772 (95%), Gaps = 3/772 (0%)

Query: 37  PRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAV 96
           PRLKYQRMGGS+P+LL++DAA C+A+AERMIALGTH GTVHILD LGNQVKEF AH A V
Sbjct: 46  PRLKYQRMGGSIPTLLSSDAACCIAIAERMIALGTHDGTVHILDLLGNQVKEFRAHNATV 105

Query: 97  NDLSFDVDGEYVGSCSDDGSVVINSLFTDEKMKFDYHRPMKAISLDPDYTRKMSRRFVAG 156
           NDLSFDV+GEY+GSCSDDG VVINSLFTDEKMKF+YHRPMKAI+LDPDY RK SRRFVAG
Sbjct: 106 NDLSFDVEGEYIGSCSDDGYVVINSLFTDEKMKFEYHRPMKAIALDPDYARKTSRRFVAG 165

Query: 157 GLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITFI 216
           GLAGHL+ N+K+WLGY+DQVLHSGEGP+H VKWRTSLIAWANDAGVKVYD ANDQRITFI
Sbjct: 166 GLAGHLFFNTKRWLGYKDQVLHSGEGPIHAVKWRTSLIAWANDAGVKVYDTANDQRITFI 225

Query: 217 ERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVG---MNQV 273
           ERPRGSPRPE+L+PHLVWQDDTLLVIGWGT +KIASI+ NQSN  NGTYR+V    MNQV
Sbjct: 226 ERPRGSPRPEILVPHLVWQDDTLLVIGWGTSVKIASIRANQSNGTNGTYRNVSKSSMNQV 285

Query: 274 DIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWN 333
           DIVASFQTSY+ISG+APFGD LVVLAYIPGEEDGEKEFSST+PSRQGNAQRPEVRIVTWN
Sbjct: 286 DIVASFQTSYFISGVAPFGDSLVVLAYIPGEEDGEKEFSSTIPSRQGNAQRPEVRIVTWN 345

Query: 334 NDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKP 393
           NDEL TDALPV GFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKP
Sbjct: 346 NDELATDALPVHGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKP 405

Query: 394 RDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKL 453
           RDAEDHI+WLL+HGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKL
Sbjct: 406 RDAEDHISWLLQHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKL 465

Query: 454 LRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLLST 513
           LRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALAT+PSFHK LLST
Sbjct: 466 LRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATSPSFHKDLLST 525

Query: 514 VKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYI 573
           VKSWPPVIYSALPVISAIEPQLN+SSMTD LKEALAE YVID  YEKAF+LYADLMKP I
Sbjct: 526 VKSWPPVIYSALPVISAIEPQLNTSSMTDTLKEALAEFYVIDTQYEKAFALYADLMKPDI 585

Query: 574 FDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYF 633
           FDFIE HNLHDAIREKVVQLM+LDCKRAV LLI ++D ITPSEVV+QLL+A  KCDSRYF
Sbjct: 586 FDFIEKHNLHDAIREKVVQLMMLDCKRAVPLLILHRDFITPSEVVSQLLDASKKCDSRYF 645

Query: 634 LHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEKAYEICVKRDLL 693
           LHLYLHALFEV+ HAGKDFHDMQVELYADYD KMLLPFLRSSQHYTLEKAYEIC+KRDLL
Sbjct: 646 LHLYLHALFEVSQHAGKDFHDMQVELYADYDPKMLLPFLRSSQHYTLEKAYEICIKRDLL 705

Query: 694 REQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVL 753
           REQVFILGRMGN+K ALAVIIN+LGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVL
Sbjct: 706 REQVFILGRMGNSKQALAVIINQLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEMVGVL 765

Query: 754 LEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILK 805
           LEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILK
Sbjct: 766 LEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILK 817

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255565515|ref|XP_002523748.1| vacuolar protein sorting vps41, putative [Ricinus communis] gi|223537052|gb|EEF38688.1| vacuolar protein sorting vps41, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297734881|emb|CBI17115.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356539325|ref|XP_003538149.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Glycine max] Back     alignment and taxonomy information
>gi|224104751|ref|XP_002313553.1| predicted protein [Populus trichocarpa] gi|222849961|gb|EEE87508.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544684|ref|XP_003540777.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449443388|ref|XP_004139459.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516828|ref|XP_004165448.1| PREDICTED: vacuolar protein sorting-associated protein 41 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|224058957|ref|XP_002299663.1| predicted protein [Populus trichocarpa] gi|222846921|gb|EEE84468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|350536253|ref|NP_001233981.1| vacuolar protein sorting-associated protein 41 homolog [Solanum lycopersicum] gi|2499115|sp|P93231.1|VPS41_SOLLC RecName: Full=Vacuolar protein sorting-associated protein 41 homolog gi|1835788|gb|AAB60857.1| VPS41 [Solanum lycopersicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query807
TAIR|locus:2200008 980 VPS41 "AT1G08190" [Arabidopsis 0.950 0.782 0.832 0.0
DICTYBASE|DDB_G0286803 1087 vps41 "7-fold repeat in clathr 0.918 0.681 0.391 3.1e-147
UNIPROTKB|F1SSB8854 VPS41 "Uncharacterized protein 0.519 0.490 0.399 4.2e-145
MGI|MGI:1929215853 Vps41 "vacuolar protein sortin 0.525 0.497 0.398 8.8e-145
UNIPROTKB|P49754854 VPS41 "Vacuolar protein sortin 0.525 0.496 0.398 1.1e-144
UNIPROTKB|A3KN15854 VPS41 "VPS41 protein" [Bos tau 0.525 0.496 0.395 1.1e-144
UNIPROTKB|E2R6C3854 VPS41 "Uncharacterized protein 0.525 0.496 0.393 6.1e-144
ZFIN|ZDB-GENE-030131-6671855 vps41 "vacuolar protein sortin 0.519 0.490 0.386 1.1e-142
UNIPROTKB|F1NMR8854 VPS41 "Uncharacterized protein 0.525 0.496 0.386 6.3e-140
UNIPROTKB|E9PF36829 VPS41 "Vacuolar protein sortin 0.525 0.511 0.398 9.2e-137
TAIR|locus:2200008 VPS41 "AT1G08190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3410 (1205.4 bits), Expect = 0., P = 0.
 Identities = 652/783 (83%), Positives = 707/783 (90%)

Query:    37 PRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAV 96
             PRLKYQRMGG++P+LL+NDAASC+AVA RMIALGTH GTV ILD LGNQVKEF AHTA V
Sbjct:    42 PRLKYQRMGGNVPALLSNDAASCIAVAARMIALGTHDGTVRILDLLGNQVKEFRAHTAPV 101

Query:    97 NDLSFDVDGEYVGSCSDDGSVVINSLFTD-EKMKFDYHRPMKAISLDPDYTRKMSRRFVA 155
             ND++FD +GEY+GSCSDDGSVVINSLFTD EKMKFDYHRPMKAISLDPDYT+K S+RFVA
Sbjct:   102 NDINFDTEGEYIGSCSDDGSVVINSLFTDDEKMKFDYHRPMKAISLDPDYTKKQSKRFVA 161

Query:   156 GGLAGHLYLNSKKWLGYRDQVLHSGEGPVHVVKWRTSLIAWANDAGVKVYDAANDQRITF 215
             GGLAGHLY+NSKKW G +DQVLHSGEGP+H VKWR SLIAWAND GVKVYD A DQR+TF
Sbjct:   162 GGLAGHLYMNSKKWFGNKDQVLHSGEGPIHSVKWRGSLIAWANDVGVKVYDTAKDQRVTF 221

Query:   216 IERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMN---Q 272
             IE+PRGSPRPE LLPHLVWQDDTLLVIGWGT +KIASIK++Q     GT+R + M+   Q
Sbjct:   222 IEKPRGSPRPEALLPHLVWQDDTLLVIGWGTSVKIASIKSDQQQT--GTFRQIQMSSLTQ 279

Query:   273 VDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLP-SRQGNAQRPEVRIVT 331
             VDIVASFQTSYYISGIAPFGD LV+LAYIP E DGEKEFSST   SRQGNAQRPE+RIV+
Sbjct:   280 VDIVASFQTSYYISGIAPFGDSLVILAYIPIEGDGEKEFSSTTTLSRQGNAQRPEIRIVS 339

Query:   332 WNNDELTTDALPVLGFEHYKAKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIA 391
             WNNDELT DALPV GFEHYKAKDYSLAHAPF GSSYAGGQWAAGDEPLYYIVSPKDVVIA
Sbjct:   340 WNNDELTMDALPVHGFEHYKAKDYSLAHAPFPGSSYAGGQWAAGDEPLYYIVSPKDVVIA 399

Query:   392 KPRDAEDHIAWLLEHGWHEKALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCP 451
             KPRDAEDHI WLL+HG+HEKALAAVEA +GR+EL+D+VG+ YLDHLIVERKYAEAASLCP
Sbjct:   400 KPRDAEDHINWLLQHGFHEKALAAVEASEGRTELIDKVGAGYLDHLIVERKYAEAASLCP 459

Query:   452 KLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKYLL 511
             KLLRGSASAWERWVFHFA LRQLPVLVPYMPT+NPRL+DT YEVALVALATNPS+HK LL
Sbjct:   460 KLLRGSASAWERWVFHFAQLRQLPVLVPYMPTDNPRLKDTVYEVALVALATNPSYHKELL 519

Query:   512 STVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKP 571
             S VKSWP  +YSAL VISAIEPQLN+SSMTDALKEALAELYVIDG Y+KAFSLYADL+KP
Sbjct:   520 SAVKSWPRSVYSALTVISAIEPQLNTSSMTDALKEALAELYVIDGQYQKAFSLYADLLKP 579

Query:   572 YIFDFIENHNLHDAIREKVVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARD----- 626
              +FDFIE ++LH+AIR KVVQLMLLDCKRA  L IQN+DLI PSEVV QLL A       
Sbjct:   580 EVFDFIEKYSLHEAIRGKVVQLMLLDCKRATVLFIQNRDLIPPSEVVPQLLKAGKNPQVL 639

Query:   627 ----KCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLLPFLRSSQHYTLEK 682
                 KCDSRY+L+LYLHALFEV+   GKDFHDMQVELYA+YD KMLLPFLRSSQHY LEK
Sbjct:   640 KAGKKCDSRYYLYLYLHALFEVSHDTGKDFHDMQVELYAEYDTKMLLPFLRSSQHYKLEK 699

Query:   683 AYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQ 742
             AYE+CVK+D LREQVF+LGRMGN K ALAVIINKLGDIEEAVEFV+MQHDD+LWEELIKQ
Sbjct:   700 AYELCVKKDFLREQVFVLGRMGNAKQALAVIINKLGDIEEAVEFVSMQHDDDLWEELIKQ 759

Query:   743 CLNKPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCND 802
             CLNKPEMVG+LLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKI+TDYRTETSLRHGCND
Sbjct:   760 CLNKPEMVGLLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIVTDYRTETSLRHGCND 819

Query:   803 ILK 805
             ILK
Sbjct:   820 ILK 822
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0006623 "protein targeting to vacuole" evidence=TAS
GO:0009630 "gravitropism" evidence=IMP
DICTYBASE|DDB_G0286803 vps41 "7-fold repeat in clathrin and VPS proteins repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSB8 VPS41 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1929215 Vps41 "vacuolar protein sorting 41 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P49754 VPS41 "Vacuolar protein sorting-associated protein 41 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN15 VPS41 "VPS41 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6C3 VPS41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6671 vps41 "vacuolar protein sorting 41 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMR8 VPS41 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PF36 VPS41 "Vacuolar protein sorting-associated protein 41 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5KU39VPS41_MOUSENo assigned EC number0.38530.90330.8546yesno
P93231VPS41_SOLLCNo assigned EC number0.85510.99620.8375N/Ano
P93043VPS41_ARATHNo assigned EC number0.83160.95160.7836yesno
P49754VPS41_HUMANNo assigned EC number0.38400.90330.8536yesno
Q9P7N3VPS41_SCHPONo assigned EC number0.31750.90950.8427yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query807
smart00299140 smart00299, CLH, Clathrin heavy chain repeat homol 1e-26
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 3e-18
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
smart0032040 smart00320, WD40, WD40 repeats 4e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 2e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-05
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 2e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 2e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 4e-04
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 6e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 8e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 9e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.002
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.002
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.003
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.004
>gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology Back     alignment and domain information 
 Score =  105 bits (265), Expect = 1e-26
 Identities = 44/146 (30%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 605 LIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVN-PHAGKDFHDMQVELYADY 663
           L++  D I  SEVV                 L  +    +             +ELYA Y
Sbjct: 1   LLEVSDPIDVSEVVELFE------KRNLLEELIPYLESALKLNSENPALQTKLIELYAKY 54

Query: 664 DLKMLLPFL-RSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEE 722
           D +  +  L   S HY +EK  ++C K  L  E V +  + GN K A+  +I  LG+ E+
Sbjct: 55  DPQKEIERLDNKSNHYDIEKVGKLCEKAKLYEEAVELYKKDGNFKDAIVTLIEHLGNYEK 114

Query: 723 AVEFVNMQHDDELWEELIKQCLNKPE 748
           A+E+   Q++ ELW E++K  L+KP 
Sbjct: 115 AIEYFVKQNNPELWAEVLKALLDKPR 140

Length = 140
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 807
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 100.0
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 100.0
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 100.0
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 99.98
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.92
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.92
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.91
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.91
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.91
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.91
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.9
KOG0263707 consensus Transcription initiation factor TFIID, s 99.88
smart00299140 CLH Clathrin heavy chain repeat homology. 99.88
KOG0286343 consensus G-protein beta subunit [General function 99.88
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.87
KOG0286343 consensus G-protein beta subunit [General function 99.87
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.87
KOG0296399 consensus Angio-associated migratory cell protein 99.87
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.87
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.86
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.85
KOG0315311 consensus G-protein beta subunit-like protein (con 99.85
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.85
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.84
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.84
KOG0315311 consensus G-protein beta subunit-like protein (con 99.84
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.84
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.84
KOG0295406 consensus WD40 repeat-containing protein [Function 99.83
KOG0266456 consensus WD40 repeat-containing protein [General 99.83
KOG0266456 consensus WD40 repeat-containing protein [General 99.83
KOG0772641 consensus Uncharacterized conserved protein, conta 99.83
KOG0645312 consensus WD40 repeat protein [General function pr 99.83
PTZ00421493 coronin; Provisional 99.83
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.83
KOG0295406 consensus WD40 repeat-containing protein [Function 99.82
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.81
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.81
KOG0645312 consensus WD40 repeat protein [General function pr 99.81
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.81
PTZ00420568 coronin; Provisional 99.8
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.8
PTZ00420568 coronin; Provisional 99.8
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.8
PTZ00421493 coronin; Provisional 99.8
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.79
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.79
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.79
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.78
PLN00181793 protein SPA1-RELATED; Provisional 99.78
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.78
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.78
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.78
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 99.78
KOG0283712 consensus WD40 repeat-containing protein [Function 99.77
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.76
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.76
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.76
KOG0294362 consensus WD40 repeat-containing protein [Function 99.76
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.76
KOG0643327 consensus Translation initiation factor 3, subunit 99.75
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.75
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.75
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.75
KOG0772641 consensus Uncharacterized conserved protein, conta 99.75
KOG0289506 consensus mRNA splicing factor [General function p 99.75
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.75
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.74
KOG0269839 consensus WD40 repeat-containing protein [Function 99.74
PLN00181793 protein SPA1-RELATED; Provisional 99.74
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.74
KOG0300481 consensus WD40 repeat-containing protein [Function 99.74
KOG0293519 consensus WD40 repeat-containing protein [Function 99.74
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.73
KOG0283712 consensus WD40 repeat-containing protein [Function 99.73
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.73
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.72
KOG0302440 consensus Ribosome Assembly protein [General funct 99.72
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.72
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.71
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.71
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.71
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 99.7
KOG0641350 consensus WD40 repeat protein [General function pr 99.7
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.7
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.7
KOG2055514 consensus WD40 repeat protein [General function pr 99.69
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.69
KOG0300481 consensus WD40 repeat-containing protein [Function 99.69
KOG0296399 consensus Angio-associated migratory cell protein 99.69
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.69
KOG4283397 consensus Transcription-coupled repair protein CSA 99.69
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.68
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.68
KOG0270463 consensus WD40 repeat-containing protein [Function 99.68
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.68
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.68
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.67
KOG0270463 consensus WD40 repeat-containing protein [Function 99.67
KOG0293519 consensus WD40 repeat-containing protein [Function 99.67
KOG0302440 consensus Ribosome Assembly protein [General funct 99.67
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.66
KOG0289506 consensus mRNA splicing factor [General function p 99.65
KOG0301745 consensus Phospholipase A2-activating protein (con 99.65
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 99.65
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.65
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.64
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.64
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.64
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.64
KOG0301745 consensus Phospholipase A2-activating protein (con 99.63
KOG1273405 consensus WD40 repeat protein [General function pr 99.63
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.62
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.62
KOG4328498 consensus WD40 protein [Function unknown] 99.62
KOG0269839 consensus WD40 repeat-containing protein [Function 99.62
KOG0294362 consensus WD40 repeat-containing protein [Function 99.61
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.6
KOG0267825 consensus Microtubule severing protein katanin p80 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.59
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.59
KOG0646476 consensus WD40 repeat protein [General function pr 99.58
KOG0646476 consensus WD40 repeat protein [General function pr 99.58
KOG2048691 consensus WD40 repeat protein [General function pr 99.57
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.57
KOG1274 933 consensus WD40 repeat protein [General function pr 99.57
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.57
KOG0267825 consensus Microtubule severing protein katanin p80 99.56
KOG2096420 consensus WD40 repeat protein [General function pr 99.55
KOG0639705 consensus Transducin-like enhancer of split protei 99.55
KOG1539910 consensus WD repeat protein [General function pred 99.55
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.54
KOG1274 933 consensus WD40 repeat protein [General function pr 99.53
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.53
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.52
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.52
KOG0641350 consensus WD40 repeat protein [General function pr 99.51
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.5
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.5
KOG0303472 consensus Actin-binding protein Coronin, contains 99.48
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.48
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.47
KOG1188376 consensus WD40 repeat protein [General function pr 99.47
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.46
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.46
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.45
KOG2055514 consensus WD40 repeat protein [General function pr 99.44
KOG2048691 consensus WD40 repeat protein [General function pr 99.44
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.43
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.43
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.43
KOG0303472 consensus Actin-binding protein Coronin, contains 99.43
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.43
KOG2096420 consensus WD40 repeat protein [General function pr 99.42
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.42
KOG0643327 consensus Translation initiation factor 3, subunit 99.41
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.4
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.37
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.37
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.36
KOG0649325 consensus WD40 repeat protein [General function pr 99.36
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.35
KOG4283397 consensus Transcription-coupled repair protein CSA 99.34
KOG0771398 consensus Prolactin regulatory element-binding pro 99.33
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.3
KOG0639705 consensus Transducin-like enhancer of split protei 99.29
KOG4328498 consensus WD40 protein [Function unknown] 99.29
KOG2106626 consensus Uncharacterized conserved protein, conta 99.29
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.27
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.27
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.26
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.26
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.26
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 99.25
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.24
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.23
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.22
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.21
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.17
KOG1273405 consensus WD40 repeat protein [General function pr 99.16
KOG2106626 consensus Uncharacterized conserved protein, conta 99.15
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.15
KOG4227609 consensus WD40 repeat protein [General function pr 99.15
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.15
KOG1539910 consensus WD repeat protein [General function pred 99.14
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.13
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.13
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.12
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.12
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.12
PRK01742429 tolB translocation protein TolB; Provisional 99.11
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.11
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.1
KOG1310758 consensus WD40 repeat protein [General function pr 99.1
KOG1188376 consensus WD40 repeat protein [General function pr 99.08
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.07
KOG1963792 consensus WD40 repeat protein [General function pr 99.07
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.07
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.05
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.03
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 99.01
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.0
KOG15171387 consensus Guanine nucleotide binding protein MIP1 98.99
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.98
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.98
KOG2110391 consensus Uncharacterized conserved protein, conta 98.98
KOG2139445 consensus WD40 repeat protein [General function pr 98.96
KOG1310758 consensus WD40 repeat protein [General function pr 98.96
COG2319466 FOG: WD40 repeat [General function prediction only 98.96
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.96
PRK01742429 tolB translocation protein TolB; Provisional 98.94
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.93
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.92
KOG2111346 consensus Uncharacterized conserved protein, conta 98.92
PRK05137435 tolB translocation protein TolB; Provisional 98.91
PRK03629429 tolB translocation protein TolB; Provisional 98.91
KOG2139445 consensus WD40 repeat protein [General function pr 98.91
KOG2321703 consensus WD40 repeat protein [General function pr 98.9
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.9
COG2319466 FOG: WD40 repeat [General function prediction only 98.89
PRK05137435 tolB translocation protein TolB; Provisional 98.88
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.88
PRK04922433 tolB translocation protein TolB; Provisional 98.88
KOG2321703 consensus WD40 repeat protein [General function pr 98.87
PRK11028330 6-phosphogluconolactonase; Provisional 98.87
PRK02889427 tolB translocation protein TolB; Provisional 98.86
KOG2110391 consensus Uncharacterized conserved protein, conta 98.84
PRK02889427 tolB translocation protein TolB; Provisional 98.84
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 98.83
KOG2111346 consensus Uncharacterized conserved protein, conta 98.82
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.77
KOG4227609 consensus WD40 repeat protein [General function pr 98.77
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.75
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.74
PRK04922433 tolB translocation protein TolB; Provisional 98.74
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.71
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.7
PRK03629429 tolB translocation protein TolB; Provisional 98.7
PRK11028330 6-phosphogluconolactonase; Provisional 98.68
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.67
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.65
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.64
KOG3621726 consensus WD40 repeat-containing protein [General 98.63
KOG1963792 consensus WD40 repeat protein [General function pr 98.63
KOG0771398 consensus Prolactin regulatory element-binding pro 98.62
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.6
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.59
PRK00178430 tolB translocation protein TolB; Provisional 98.57
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.56
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.54
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.54
KOG1334559 consensus WD40 repeat protein [General function pr 98.54
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.51
KOG4547541 consensus WD40 repeat-containing protein [General 98.51
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.48
PRK04792448 tolB translocation protein TolB; Provisional 98.46
PRK01029428 tolB translocation protein TolB; Provisional 98.46
PRK04792448 tolB translocation protein TolB; Provisional 98.46
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.44
PRK00178430 tolB translocation protein TolB; Provisional 98.44
KOG4547541 consensus WD40 repeat-containing protein [General 98.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.34
KOG1409404 consensus Uncharacterized conserved protein, conta 98.33
KOG1334559 consensus WD40 repeat protein [General function pr 98.32
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.31
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.31
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.31
KOG1409404 consensus Uncharacterized conserved protein, conta 98.29
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.27
KOG2695425 consensus WD40 repeat protein [General function pr 98.23
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.19
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.18
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.16
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.12
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.11
PF05131147 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPr 98.1
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 98.04
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.04
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.02
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.01
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.0
COG4946668 Uncharacterized protein related to the periplasmic 97.95
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.93
PRK04043419 tolB translocation protein TolB; Provisional 97.93
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.91
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.91
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.86
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.84
smart00299140 CLH Clathrin heavy chain repeat homology. 97.81
COG4946668 Uncharacterized protein related to the periplasmic 97.8
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.79
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 97.78
PRK01029428 tolB translocation protein TolB; Provisional 97.78
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.78
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.77
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.73
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.73
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 97.72
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.72
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.71
KOG2315566 consensus Predicted translation initiation factor 97.69
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.69
PRK04043419 tolB translocation protein TolB; Provisional 97.68
KOG2695425 consensus WD40 repeat protein [General function pr 97.68
KOG2315566 consensus Predicted translation initiation factor 97.63
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.59
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.56
KOG19121062 consensus WD40 repeat protein [General function pr 97.53
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.47
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.44
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.41
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.39
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.36
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.36
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.36
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.33
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.3
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.27
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 97.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.24
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.24
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.24
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.21
PLN03218 1060 maturation of RBCL 1; Provisional 97.21
PLN03077 857 Protein ECB2; Provisional 97.2
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.2
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.2
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.19
KOG2395644 consensus Protein involved in vacuole import and d 97.16
PLN03218 1060 maturation of RBCL 1; Provisional 97.13
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.11
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.1
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.09
KOG1008783 consensus Uncharacterized conserved protein, conta 97.07
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.07
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.04
KOG2314698 consensus Translation initiation factor 3, subunit 97.0
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.98
KOG2314698 consensus Translation initiation factor 3, subunit 96.92
PLN03077 857 Protein ECB2; Provisional 96.89
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.88
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.77
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.76
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.74
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.73
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.72
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.72
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.68
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.66
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.64
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.58
KOG2076 895 consensus RNA polymerase III transcription factor 96.47
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.45
KOG2395644 consensus Protein involved in vacuole import and d 96.4
PF14763353 HPS3_C: Hermansky-Pudlak syndrome 3, C-terminal 96.35
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.3
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.26
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.22
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.17
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.07
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.05
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.02
KOG3621726 consensus WD40 repeat-containing protein [General 95.92
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.87
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.74
KOG3616 1636 consensus Selective LIM binding factor [Transcript 95.49
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 95.48
KOG1008783 consensus Uncharacterized conserved protein, conta 95.33
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.3
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.15
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.07
PRK13616591 lipoprotein LpqB; Provisional 95.03
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.95
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.93
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 94.93
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.91
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 94.9
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.9
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 94.88
KOG2076 895 consensus RNA polymerase III transcription factor 94.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 94.83
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.74
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.59
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.57
PHA02713557 hypothetical protein; Provisional 94.57
PRK11788389 tetratricopeptide repeat protein; Provisional 94.49
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.46
smart0032040 WD40 WD40 repeats. Note that these repeats are per 94.28
PF15390671 DUF4613: Domain of unknown function (DUF4613) 93.97
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 93.85
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 93.6
COG5167776 VID27 Protein involved in vacuole import and degra 93.5
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 93.42
PRK02888635 nitrous-oxide reductase; Validated 93.25
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.16
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.14
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.12
KOG2444238 consensus WD40 repeat protein [General function pr 93.09
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 93.05
KOG2376 652 consensus Signal recognition particle, subunit Srp 93.02
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.8
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 92.8
PF15390671 DUF4613: Domain of unknown function (DUF4613) 92.44
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.3
PRK13616591 lipoprotein LpqB; Provisional 92.17
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 91.95
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 91.85
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 91.72
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.66
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.56
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 91.5
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 91.42
PHA02790480 Kelch-like protein; Provisional 91.12
PHA03098534 kelch-like protein; Provisional 90.97
PHA02713557 hypothetical protein; Provisional 90.92
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.54
COG5167776 VID27 Protein involved in vacuole import and degra 90.33
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 90.21
KOG2444238 consensus WD40 repeat protein [General function pr 90.21
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 90.18
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.1
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 90.01
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 89.7
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 89.29
PRK02888635 nitrous-oxide reductase; Validated 89.17
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 89.12
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.01
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 88.56
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 88.34
COG3386307 Gluconolactonase [Carbohydrate transport and metab 88.33
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 87.96
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 87.94
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 87.89
PRK14720 906 transcript cleavage factor/unknown domain fusion p 87.74
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 87.73
PF12816196 Vps8: Golgi CORVET complex core vacuolar protein 8 87.41
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.19
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 86.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 86.6
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 86.6
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 86.57
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 86.56
PRK13684334 Ycf48-like protein; Provisional 86.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 86.22
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 85.94
KOG2003840 consensus TPR repeat-containing protein [General f 85.52
KOG2247615 consensus WD40 repeat-containing protein [General 85.5
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 85.15
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 85.04
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 84.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 83.63
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 83.59
KOG2377657 consensus Uncharacterized conserved protein [Funct 82.84
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 82.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 82.39
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.12
PLN00033398 photosystem II stability/assembly factor; Provisio 82.08
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 81.42
PF12816196 Vps8: Golgi CORVET complex core vacuolar protein 8 80.65
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 80.44
COG3204316 Uncharacterized protein conserved in bacteria [Fun 80.39
COG3391381 Uncharacterized conserved protein [Function unknow 80.18
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-118  Score=950.94  Aligned_cols=740  Identities=52%  Similarity=0.905  Sum_probs=693.9

Q ss_pred             cCCCceeeeecCCCCccccCCCceEEEEecCCEEEEEecCCeEEEEecCCCeeEEecCCCcceeEEEEcCCCCEEEEEeC
Q 003625           34 EEEPRLKYQRMGGSLPSLLANDAASCVAVAERMIALGTHAGTVHILDFLGNQVKEFPAHTAAVNDLSFDVDGEYVGSCSD  113 (807)
Q Consensus        34 ~~~~~l~~~~~~~~~~~~~~~~~i~~~s~~~~~la~gs~dg~I~i~d~~~~~~~~~~~h~~~V~~l~~s~~g~~l~s~~~  113 (807)
                      +++|.++|.|+++.+..++.++.++|+..++++++.|+.+|.|++++.+|.. .+...|+..      +.+|.+++|||.
T Consensus        19 deePklkY~Ri~n~~~~~~~~D~is~~av~~~~~~~GtH~g~v~~~~~~~~~-~~~~~~s~~------~~~Gey~asCS~   91 (846)
T KOG2066|consen   19 DEEPKLKYERISNLVKNFLQNDAISCCAVHDKFFALGTHRGAVYLTTCQGNP-KTNFDHSSS------ILEGEYVASCSD   91 (846)
T ss_pred             ccCccceehhhhcccHHHHhhhHHHHHHhhcceeeeccccceEEEEecCCcc-ccccccccc------ccCCceEEEecC
Confidence            7899999999999999999999999999999999999999999999999987 555566654      778999999999


Q ss_pred             CCcEEEEeccCC-ceeEEecCCceEEEEeCCCCCCcCCCEEEEecCCCeEEEEEcccCCccceE-eecCCcCeEEEEEeC
Q 003625          114 DGSVVINSLFTD-EKMKFDYHRPMKAISLDPDYTRKMSRRFVAGGLAGHLYLNSKKWLGYRDQV-LHSGEGPVHVVKWRT  191 (807)
Q Consensus       114 Dg~v~iwd~~~~-~~~~~~~~~~v~~v~~~p~~~~~~~~~l~~g~~dg~v~l~~~~~~~~~~~~-~~~~~~~V~~l~~~~  191 (807)
                      ||+|.|..+.+. .+.++++++|+.+|+++|+|.++.++.|++||..| +.++.++|.+.+..+ ++..+|+|.++.|.|
T Consensus        92 DGkv~I~sl~~~~~~~~~df~rpiksial~Pd~~~~~sk~fv~GG~ag-lvL~er~wlgnk~~v~l~~~eG~I~~i~W~g  170 (846)
T KOG2066|consen   92 DGKVVIGSLFTDDEITQYDFKRPIKSIALHPDFSRQQSKQFVSGGMAG-LVLSERNWLGNKDSVVLSEGEGPIHSIKWRG  170 (846)
T ss_pred             CCcEEEeeccCCccceeEecCCcceeEEeccchhhhhhhheeecCcce-EEEehhhhhcCccceeeecCccceEEEEecC
Confidence            999999999885 45678999999999999999988899999999999 999999999977666 788999999999999


Q ss_pred             CEEEEEeCCcEEEEEcCCCceEEeeeCCCCCCCCCCCCCeeeeeCCCEEEEEeCCcEEEEEEeeCCCcCCCCccccCCcc
Q 003625          192 SLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLLVIGWGTYIKIASIKTNQSNVANGTYRHVGMN  271 (807)
Q Consensus       192 ~~la~~~d~~v~iwd~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~~l~~g~d~~i~vw~~~~~~~~~~~~~~~~~~~~  271 (807)
                      +++||++|-+|++||+.+++.+..++.+...++++.++|.+.|.+...|++||+++|+|..++.+.+.. ..+..-.+..
T Consensus       171 ~lIAWand~Gv~vyd~~~~~~l~~i~~p~~~~R~e~fpphl~W~~~~~LVIGW~d~v~i~~I~~~~s~~-a~~~~~~~~~  249 (846)
T KOG2066|consen  171 NLIAWANDDGVKVYDTPTRQRLTNIPPPSQSVRPELFPPHLHWQDEDRLVIGWGDSVKICSIKKRSSSE-ARSFRLPSLK  249 (846)
T ss_pred             cEEEEecCCCcEEEeccccceeeccCCCCCCCCcccCCCceEecCCCeEEEecCCeEEEEEEecccccc-cccccCCccc
Confidence            999999999999999999999999999999999999999999999999999999999999999554222 2223333455


Q ss_pred             eEEEEEEeeeceEEEeeeecCCceEEEEeecCCCCCcccccCCCCcccCCCCCCeEEEeccCCcccccCccccCcccccc
Q 003625          272 QVDIVASFQTSYYISGIAPFGDCLVVLAYIPGEEDGEKEFSSTLPSRQGNAQRPEVRIVTWNNDELTTDALPVLGFEHYK  351 (807)
Q Consensus       272 ~v~~~~~~~~~~~i~gi~~~~~~l~vl~~~~~~~~~~~~~~~~~~~~~~~~~~p~l~iv~~~~~~i~~~~~~~~~~~~~~  351 (807)
                      .++++..|+.++.|+|++|+++++++|+|.+..+  +...++..|..+++..+|++|+++..++|+++|++.++||+++.
T Consensus       250 ~V~~~s~f~~s~~isGla~lg~qLv~L~f~~~~~--~~e~~s~~~~~r~~~~~peir~~~~~~~Ei~~Dal~~~~~e~~~  327 (846)
T KOG2066|consen  250 KVEIVSHFETSFYISGLAPLGDQLVVLGFDKDIS--EGEFTSARPSSRAKGNRPEIRIVSLNNDEICSDALIVRGFEELS  327 (846)
T ss_pred             eeeeEEEeeeeeeeeccccccceeEEEeeecccc--cccccccchhhhccCCCceEEeccccchhhhhhhhhhcchhhcC
Confidence            8999999999999999999999999999986543  44566778876688889999999999999999999999999999


Q ss_pred             ccCcccccccCCCCCCCCCcccCCCCCEEEEECCCcEEEEEeCChhhHHHHHHhcccHHHHHHHHHhcCCCc--hhHhHH
Q 003625          352 AKDYSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALAAVEAGQGRS--ELLDEV  429 (807)
Q Consensus       352 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~s~~~i~~~~~~~~~d~i~~ll~~~~~~~Al~~~~~~~~~~--~~~~~i  429 (807)
                      ++||||...|             +..+.|||+||++|+++++++.+|||+||+++++|+|||.+++......  .+...+
T Consensus       328 ~~DY~L~~~~-------------~~~~~yyIvspkDiV~a~~~~~~Dhi~Wll~~k~yeeAl~~~k~~~~~~~~~~i~kv  394 (846)
T KOG2066|consen  328 INDYHLGGHP-------------KTEPLYYIVSPKDIVVAKERDQEDHIDWLLEKKKYEEALDAAKASIGNEERFVIKKV  394 (846)
T ss_pred             CccccccCCC-------------CCCceEEEecCCceEEEeecCcchhHHHHHHhhHHHHHHHHHHhccCCccccchHHH
Confidence            9999999975             4688999999999999999999999999999999999999999876633  357899


Q ss_pred             HHHHHHHHhCcccHHHHHhHhhHhhccChhhHHHHHHHHhhcCCCCcccccCcCCCCCCCHHHHHHHHHHHhcCCCChHH
Q 003625          430 GSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTAYEVALVALATNPSFHKY  509 (807)
Q Consensus       430 ~~~~~~~l~~~~~~~~A~~~~~~~~~~~~~~we~~i~~F~~~~~l~~L~~yl~~~~~~l~~~~~~~~L~~~~~~~~~~~~  509 (807)
                      |+.|++||+..++|++||..|++++|++..+||.|+++|...+++..+.||+|+..|+|.+.+|+++|..|+.  ++...
T Consensus       395 ~~~yI~HLl~~~~y~~Aas~~p~m~gn~~~eWe~~V~~f~e~~~l~~Ia~~lPt~~~rL~p~vYemvLve~L~--~~~~~  472 (846)
T KOG2066|consen  395 GKTYIDHLLFEGKYDEAASLCPKMLGNNAAEWELWVFKFAELDQLTDIAPYLPTGPPRLKPLVYEMVLVEFLA--SDVKG  472 (846)
T ss_pred             HHHHHHHHHhcchHHHHHhhhHHHhcchHHHHHHHHHHhccccccchhhccCCCCCcccCchHHHHHHHHHHH--HHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999  48999


Q ss_pred             HHHHhhcCCcCCCChHHHHHHHHHhhhcCCChHHHHHHHHHHHHhcCCHHHHHHHHHHccCcchhhHhhhccchHHHHHH
Q 003625          510 LLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPYIFDFIENHNLHDAIREK  589 (807)
Q Consensus       510 ~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ly~~~~~~~~al~~~~~~~~~~~~~~i~~~~~~~~~~~~  589 (807)
                      |.+.++.||..+|++.+++++++.+....+++..+.+.|+.||...++|.+|+++|+++++.++|++|.++++++.+.+.
T Consensus       473 F~e~i~~Wp~~Lys~l~iisa~~~q~~q~Se~~~L~e~La~LYl~d~~Y~~Al~~ylklk~~~vf~lI~k~nL~d~i~~~  552 (846)
T KOG2066|consen  473 FLELIKEWPGHLYSVLTIISATEPQIKQNSESTALLEVLAHLYLYDNKYEKALPIYLKLQDKDVFDLIKKHNLFDQIKDQ  552 (846)
T ss_pred             HHHHHHhCChhhhhhhHHHhhcchHHHhhccchhHHHHHHHHHHHccChHHHHHHHHhccChHHHHHHHHHhhHHHHHHH
Confidence            99999999999999999999999999888888889999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcChhHHHHHhhhcCCCCChHHHHHHHhcccccCchhhHHHHHHHHHHhhCCCCChhHHHHHHHHHHHhchHHHH
Q 003625          590 VVQLMLLDCKRAVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYDLKMLL  669 (807)
Q Consensus       590 ~~~l~~~~~~~~~~ll~~~~~~~~~~~vi~~l~~~~~~~~~~~~~~~yLe~l~~~~~~~~~~~~~~l~~ly~~~~~~kl~  669 (807)
                      +..||.++.++++.+|+++.+.+||..|+++++.      .|.+++.||..++..+.....+||+.+++|||+|++++|+
T Consensus       553 Iv~Lmll~skka~~lLldn~d~ip~a~Vveql~~------~P~~l~~YL~kl~~rd~~~~~~y~dk~I~LYAEyDrk~LL  626 (846)
T KOG2066|consen  553 IVLLMLLDSKKAIDLLLDNRDSISPSEVVEQLED------NPKLLYCYLHKLFKRDHFMGSEYHDKQIELYAEYDRKKLL  626 (846)
T ss_pred             HHHHHccchhhHHHHHhhccccCCHHHHHHHHhc------ChHHHHHHHHHHhhcCccccchhhhHHHHHHHHHhHhhhh
Confidence            9999999999999999999999999999999994      6889999999999999988999999999999999999999


Q ss_pred             HHhhcCCCCCHHHHHHHHhcCCchhHHHHHHhhcCChHHHHHHHHHHhCCHHHHHHHHhhcCChhHHHHHHHHhcCCchH
Q 003625          670 PFLRSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDIEEAVEFVNMQHDDELWEELIKQCLNKPEM  749 (807)
Q Consensus       670 ~fL~~~~~y~~~~al~~~~~~~~~~e~~~L~~r~g~~~~Al~~~i~~l~d~~~A~~~~~~~~~~~lw~~ll~~~~~~~~~  749 (807)
                      .||+++++|++++|+++|.+.++++|.||||||||++.+||.++|++++|+++||+||++++|++||..|+.|++++|++
T Consensus       627 PFLr~s~~Y~lekA~eiC~q~~~~~E~VYlLgrmGn~k~AL~lII~el~die~AIefvKeq~D~eLWe~LI~~~ldkPe~  706 (846)
T KOG2066|consen  627 PFLRKSQNYNLEKALEICSQKNFYEELVYLLGRMGNAKEALKLIINELRDIEKAIEFVKEQDDSELWEDLINYSLDKPEF  706 (846)
T ss_pred             HHHHhcCCCCHHHHHHHHHhhCcHHHHHHHHHhhcchHHHHHHHHHHhhCHHHHHHHHHhcCCHHHHHHHHHHhhcCcHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCCCCHHHHHhhCCCCCccccHHHHHHHHHhhhhHHHHHHHHHHHHhhc
Q 003625          750 VGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDILKV  806 (807)
Q Consensus       750 ~~~lL~~~~~~i~~~~vl~~lp~~~~i~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~  806 (807)
                      ++++|+ ++++.||..|+..||+++.|+.+++.|.++|++|+.|++++++|..|+++
T Consensus       707 ~~~ll~-i~~~~dpl~ii~kip~g~~IPnLrdsl~Kil~dy~~q~el~~~c~~i~~n  762 (846)
T KOG2066|consen  707 IKALLN-IGEHEDPLLIIRKIPDGLEIPNLRDSLVKILQDYNLQLELRQGCYDILKN  762 (846)
T ss_pred             HHHHHH-hhhcccHHHHHhcCCCCCCCccHHHHHHHHHHhhhhhHHHHHHHHHHHHH
Confidence            999988 77779999999999999999999999999999999999999999999875

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF05131 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPro: IPR007810 This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14763 HPS3_C: Hermansky-Pudlak syndrome 3, C-terminal Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 807
d1b89a_336 a.118.1.3 (A:) Clathrin heavy chain proximal leg s 2e-21
d1b89a_ 336 a.118.1.3 (A:) Clathrin heavy chain proximal leg s 7e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.002
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.001
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.004
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.003
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.004
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.004
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 93.8 bits (233), Expect = 2e-21
 Identities = 44/254 (17%), Positives = 87/254 (34%), Gaps = 11/254 (4%)

Query: 542 DALKEALAELYVIDGHYEKAFSLYADLMK-PYIFDFIENHNLHDAIREKVVQLMLLDCKR 600
           + + +A   LY    ++ +  S    L +     D     N     +E  V    +D K 
Sbjct: 27  EKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKE--VCFACVDGKE 84

Query: 601 AVSLLIQNKDLITPSEVVTQLLNARDKCDSRYFL-HLYLHALFEVNPHAGKDFHDMQVEL 659
                +    ++  ++ + +L+N          L  +   AL     H G         L
Sbjct: 85  FRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMG--MFTELAIL 142

Query: 660 YADYDLKMLLPFL-RSSQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLG 718
           Y+ +  + +   L        + K      +  L  E VF+  +     +A+  ++N   
Sbjct: 143 YSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPT 202

Query: 719 DIEEAVEF---VNMQHDDELWEELIKQCLN-KPEMVGVLLEHTVGNLDPLYIVNMVPNGL 774
           D  +  +F   +    + EL+   I+  L  KP ++  LL      LD    VN      
Sbjct: 203 DAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVK 262

Query: 775 EIPRLRDRLVKIIT 788
           ++P ++  L  +  
Sbjct: 263 QLPLVKPYLRSVQN 276
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query807
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.93
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.92
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.91
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.91
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.91
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.91
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.9
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.88
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.88
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.87
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.86
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.83
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.82
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.82
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.81
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.8
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.79
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.76
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.74
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.72
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.69
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.68
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.6
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.55
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.53
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.48
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.46
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.45
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.44
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.42
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.24
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.19
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.12
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.05
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.03
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.01
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.85
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.82
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.64
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.62
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.44
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.31
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.86
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.78
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.75
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.7
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.68
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.64
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.59
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.34
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.3
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.22
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.2
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.17
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.8
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.86
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.19
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.0
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.63
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 91.33
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 90.93
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 89.1
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=8.1e-31  Score=216.69  Aligned_cols=277  Identities=16%  Similarity=0.132  Sum_probs=236.4

Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCC-HHHHHHHCCCHHHHH
Q ss_conf             8998731289678793789999877640298818999999999982499899999999806960-356763036359999
Q 003625          509 YLLSTVKSWPPVIYSALPVISAIEPQLNSSSMTDALKEALAELYVIDGHYEKAFSLYADLMKPY-IFDFIENHNLHDAIR  587 (807)
Q Consensus       509 ~~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ly~~~~~~~~al~~~~~~~~~~-~~~~i~~~~~~~~v~  587 (807)
                      .+.+|++.  ++.++...+...|++..        +|++++.+|...++|++++.+|+++++.+ +++++.+++..+.++
T Consensus         4 ~~e~fl~~--~n~~d~~~i~~~c~~~~--------lye~A~~lY~~~~d~~rl~~~~v~l~~~~~avd~~~k~~~~~~~k   73 (336)
T d1b89a_           4 ELEEFING--PNNAHIQQVGDRCYDEK--------MYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWK   73 (336)
T ss_dssp             HHTTTTTC--C------------------------CTTTHHHHHHHTTCHHHHHHHHHTTTCHHHHHHHHHHHTCHHHHH
T ss_pred             HHHHHHCC--CCCCCHHHHHHHHHHCC--------CHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHH
T ss_conf             69998758--98578999999998787--------799999999867899999999970315999999998808899999


Q ss_pred             HHHHHHHHCCHHHHHHHHHHCCCCCCHHH---HHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHC
Q ss_conf             99999880594678887540278779379---999986064557634689999999884199999357999999989711
Q 003625          588 EKVVQLMLLDCKRAVSLLIQNKDLITPSE---VVTQLLNARDKCDSRYFLHLYLHALFEVNPHAGKDFHDMQVELYADYD  664 (807)
Q Consensus       588 ~~~~~l~~~~~~~~~~ll~~~~~~~~~~~---vi~~l~~~~~~~~~~~~l~~yL~~l~~~~~~~~~~~~~~l~~ly~~~~  664 (807)
                      +.++.+++..+....++.... ....|+.   ++..++..    +....++.||+..+... .....+|+.|+.+||+++
T Consensus        74 ~~~~~l~~~~e~~la~i~~~~-~~~~~d~l~~~v~~ye~~----~~~e~Li~~Le~~~~~~-~~~~~~~~~L~~lyak~~  147 (336)
T d1b89a_          74 EVCFACVDGKEFRLAQMCGLH-IVVHADELEELINYYQDR----GYFEELITMLEAALGLE-RAHMGMFTELAILYSKFK  147 (336)
T ss_dssp             HHHHHHHHTTCHHHHHHTTTT-TTTCHHHHHHHHHHHHHT----TCHHHHHHHHHHHTTST-TCCHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHCCHHHHHHHHHHH-HHCCHHHHHHHHHHHHHC----CCHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHC
T ss_conf             999999727287899999987-535788789999999876----98599999999997577-444679999999999869


Q ss_pred             HHHHHHHHHC-CCCCCHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHCCH---HHHHHHHHHCCCHHHHHHHH
Q ss_conf             6888998520-8999988999997137961679999741289499999999981997---89999984049905899999
Q 003625          665 LKMLLPFLRS-SQHYTLEKAYEICVKRDLLREQVFILGRMGNTKHALAVIINKLGDI---EEAVEFVNMQHDDELWEELI  740 (807)
Q Consensus       665 ~~kl~~~L~~-~~~y~~~~~l~~~~~~~~~~e~~~l~~~~g~~~~Al~~~~~~l~d~---~~a~~~~~~~~~~~lw~~ll  740 (807)
                      |+|+++||+. ++.|+++++++.|++.++|+|++|||.|+|+|++|+.+++++..|.   ...++.+.++.++++|..++
T Consensus       148 ~~kl~e~l~~~s~~y~~~k~~~~c~~~~l~~elv~Ly~~~~~~~~A~~~~i~~~~~~~~~~~f~e~~~k~~N~e~~~~~i  227 (336)
T d1b89a_         148 PQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAI  227 (336)
T ss_dssp             HHHHHHHHHHHSTTSCHHHHHHHHHTTTCHHHHHHHHHHTTCHHHHHHHHHHSTTTTCCHHHHHHHHHHCSSTHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             49999999860235999999999887487499999998558799999999976544566999999997247869999999


Q ss_pred             HHHCC-CCHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99449-9068999998405999988798409999760008999999996356789999899887
Q 003625          741 KQCLN-KPEMVGVLLEHTVGNLDPLYIVNMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCNDI  803 (807)
Q Consensus       741 ~~~~~-~~~~~~~lL~~~~~~~~~~~vl~~lp~~~~i~~i~~~l~~~l~~~~~~~~~~~~~~~~  803 (807)
                      .+++. +|+++..+|..+.+.+|+..+++.++....++.+++||..+...++.  .+....++|
T Consensus       228 ~~yL~~~p~~i~~lL~~v~~~~d~~r~V~~~~k~~~l~li~p~Le~v~~~n~~--~vn~al~~l  289 (336)
T d1b89a_         228 QFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNK--SVNESLNNL  289 (336)
T ss_dssp             HHHHHHCGGGHHHHHHHHGGGCCHHHHHHHHHHTTCTTTTHHHHHHHHTTCCH--HHHHHHHHH
T ss_pred             HHHHHCCHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCHH--HHHHHHHHH
T ss_conf             99997599999999998565799899999998538807799999999981809--999999999
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure