Citrus Sinensis ID: 003746


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------80
MTLATKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
ccccccccccHHcccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHccccccEEEHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cccHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEccccccEcccccc
MTLATKLAHLSSTIKssvnakpifkptinLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFstdllpfieMSYSFKIFAflespngfifNTMMRAYIQRNVPQQAICLYKLMLnnnvgvdnytypLLAQASALRLSVFEGKLIHdhvlkagfdsdvYVNNTLINMYAVCGDLSaarklfdespvldlvSWNSILAGYVNADNVEEAKFIYnkmperniiasNSMIVLFGRKGNVAEACRLFkempkkdlVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMqhhgirpdeaTLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLgcvdnalevfhgteekgvsSWNALIIGFAMNGLADKSLEMFSEMkksgvtpneiTFVGVLGAcrhmglvdeghrHFNSMIqehrlepnskhyGCMVDLLGRAGMLKEAEELIesmpmspdvaTWGALLGACkkhgdhemgeRVGRKLVelqpdhdgfHVLLSNIHASKGRWDDVLEVRGMMVRRgvvkipgcsmieangiiheflagdrthpqiNEIDNMLDEMAKKLKlegyapdtleVAFDIDQEEKETTLFRHSEKLAIAFGlitisppnpiriMKNLRICNDCHTAAKFISRafdreivvrdrhrfhhfkhgscscmdfw
mtlatklahlsstikssvnakpiFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFkempkkdlvSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSnihaskgrwdDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRfhhfkhgscscmdfw
MTLATKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRvmvdevvvvsvLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEvrgmmvrrgvvKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
*****************VNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIE***MSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMD**
***************************INLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
MTLATKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
*TLATKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLATKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query798 2.2.26 [Sep-21-2011]
Q9LUJ2842 Pentatricopeptide repeat- yes no 0.984 0.933 0.370 1e-165
Q9LN01741 Pentatricopeptide repeat- no no 0.877 0.944 0.400 1e-164
O82380738 Pentatricopeptide repeat- no no 0.819 0.886 0.392 1e-151
Q9FJY7620 Pentatricopeptide repeat- no no 0.687 0.885 0.449 1e-146
Q9FI80646 Pentatricopeptide repeat- no no 0.691 0.854 0.430 1e-144
Q3E6Q1809 Pentatricopeptide repeat- no no 0.908 0.896 0.346 1e-142
Q9SY02781 Pentatricopeptide repeat- no no 0.899 0.919 0.345 1e-140
Q9FND7612 Putative pentatricopeptid no no 0.691 0.901 0.431 1e-140
Q683I9573 Pentatricopeptide repeat- no no 0.649 0.904 0.459 1e-139
Q9SZT8632 Pentatricopeptide repeat- no no 0.697 0.881 0.424 1e-139
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function desciption
 Score =  581 bits (1497), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 309/834 (37%), Positives = 482/834 (57%), Gaps = 48/834 (5%)

Query: 7   LAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAAS 66
           LA  ++T  S +N     K T       + L+ C++  +       +   GL  D    +
Sbjct: 15  LATTTTTKPSLLNQSKCTKAT------PSSLKNCKTIDELKMFHRSLTKQGLDNDVSTIT 68

Query: 67  RLIKFSTDLLPFIEMSYSFKIFAFLES-PNGFIFNTMMRAYIQRNVPQQAICLYKLMLNN 125
           +L+  S +L     +S++ ++F   ES    F++N+++R Y    +  +AI L+  M+N+
Sbjct: 69  KLVARSCELGTRESLSFAKEVFENSESYGTCFMYNSLIRGYASSGLCNEAILLFLRMMNS 128

Query: 126 NVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAA 185
            +  D YT+P    A A   +   G  IH  ++K G+  D++V N+L++ YA CG+L +A
Sbjct: 129 GISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGELDSA 188

Query: 186 RKLFDESPVLDLVSWNSILAGYVNADNVEEA----------------------------- 216
           RK+FDE    ++VSW S++ GY   D  ++A                             
Sbjct: 189 RKVFDEMSERNVVSWTSMICGYARRDFAKDAVDLFFRMVRDEEVTPNSVTMVCVISACAK 248

Query: 217 -----------KFIYNKMPERNIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSAL 265
                       FI N   E N +  ++++ ++ +   +  A RLF E    +L   +A+
Sbjct: 249 LEDLETGEKVYAFIRNSGIEVNDLMVSALVDMYMKCNAIDVAKRLFDEYGASNLDLCNAM 308

Query: 266 ISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGI 325
            S Y +  +  EAL +F  M+D  V  D + ++S +S+C+ L  +  G S H   ++ G 
Sbjct: 309 ASNYVRQGLTREALGVFNLMMDSGVRPDRISMLSAISSCSQLRNILWGKSCHGYVLRNGF 368

Query: 326 ECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDA 385
           E + N+ NALI MY  C    TA ++FD   N  +++WNS+++GY++ G V+ A   F+ 
Sbjct: 369 ESWDNICNALIDMYMKCHRQDTAFRIFDRMSNKTVVTWNSIVAGYVENGEVDAAWETFET 428

Query: 386 MIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQ-HHGIRPDEATLVSVISACTHLVALDQ 444
           M EK++VSW+T+ISG  Q   F E + +F  MQ   G+  D  T++S+ SAC HL ALD 
Sbjct: 429 MPEKNIVSWNTIISGLVQGSLFEEAIEVFCSMQSQEGVNADGVTMMSIASACGHLGALDL 488

Query: 445 GKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAM 504
            KWI+ YI KNG++++  LGTTL+DM+ + G  ++A+ +F+    + VS+W A I   AM
Sbjct: 489 AKWIYYYIEKNGIQLDVRLGTTLVDMFSRCGDPESAMSIFNSLTNRDVSAWTAAIGAMAM 548

Query: 505 NGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSK 564
            G A++++E+F +M + G+ P+ + FVG L AC H GLV +G   F SM++ H + P   
Sbjct: 549 AGNAERAIELFDDMIEQGLKPDGVAFVGALTACSHGGLVQQGKEIFYSMLKLHGVSPEDV 608

Query: 565 HYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVEL 624
           HYGCMVDLLGRAG+L+EA +LIE MPM P+   W +LL AC+  G+ EM      K+  L
Sbjct: 609 HYGCMVDLLGRAGLLEEAVQLIEDMPMEPNDVIWNSLLAACRVQGNVEMAAYAAEKIQVL 668

Query: 625 QPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRT 684
            P+  G +VLLSN++AS GRW+D+ +VR  M  +G+ K PG S I+  G  HEF +GD +
Sbjct: 669 APERTGSYVLLSNVYASAGRWNDMAKVRLSMKEKGLRKPPGTSSIQIRGKTHEFTSGDES 728

Query: 685 HPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITIS 744
           HP++  I+ MLDE++++    G+ PD   V  D+D++EK   L RHSEKLA+A+GLI+ +
Sbjct: 729 HPEMPNIEAMLDEVSQRASHLGHVPDLSNVLMDVDEKEKIFMLSRHSEKLAMAYGLISSN 788

Query: 745 PPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW 798
               IRI+KNLR+C+DCH+ AKF S+ ++REI++RD +RFH+ + G CSC DFW
Sbjct: 789 KGTTIRIVKNLRVCSDCHSFAKFASKVYNREIILRDNNRFHYIRQGKCSCGDFW 842





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein At4g37380, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H48 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query798
225450539808 PREDICTED: pentatricopeptide repeat-cont 0.993 0.981 0.753 0.0
224124638793 predicted protein [Populus trichocarpa] 0.987 0.993 0.753 0.0
356569774775 PREDICTED: pentatricopeptide repeat-cont 0.966 0.994 0.672 0.0
449446125809 PREDICTED: pentatricopeptide repeat-cont 0.912 0.899 0.707 0.0
449485565 953 PREDICTED: pentatricopeptide repeat-cont 0.780 0.653 0.724 0.0
296089800640 unnamed protein product [Vitis vinifera] 0.771 0.962 0.582 0.0
125543615648 hypothetical protein OsI_11297 [Oryza sa 0.803 0.989 0.523 0.0
115452665648 Os03g0314400 [Oryza sativa Japonica Grou 0.803 0.989 0.523 0.0
293336578651 uncharacterized protein LOC100382149 [Ze 0.803 0.984 0.511 0.0
242041125650 hypothetical protein SORBIDRAFT_01g03715 0.802 0.984 0.509 0.0
>gi|225450539|ref|XP_002277347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1266 bits (3275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/794 (75%), Positives = 687/794 (86%), Gaps = 1/794 (0%)

Query: 5   TKLAHLSSTIKSSVNAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFA 64
           +KL  LSS +KS+ N KP FKPTI LSILETHL  C + KQF +ILSQMILTG I+DTFA
Sbjct: 16  SKLNQLSSALKSTFNHKPTFKPTITLSILETHLHNCHNLKQFNRILSQMILTGFISDTFA 75

Query: 65  ASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLN 124
           ASRL+KFSTD  PFI + YS +IF  +E+ NGF++NTMMRAYIQ N  ++A+ LYKLM+ 
Sbjct: 76  ASRLLKFSTDS-PFIGLDYSLQIFDRIENSNGFMWNTMMRAYIQSNSAEKALLLYKLMVK 134

Query: 125 NNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSA 184
           NNVG DNYTYPL+ QA A+RL  F GK IHDHVLK GFDSDVYV NTLINMYAVCG++  
Sbjct: 135 NNVGPDNYTYPLVVQACAVRLLEFGGKEIHDHVLKVGFDSDVYVQNTLINMYAVCGNMRD 194

Query: 185 ARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASNSMIVLFGRKGNV 244
           ARKLFDESPVLD VSWNSILAGYV   +VEEAK I+++MP+RNI+ASNSMIVL G+ G V
Sbjct: 195 ARKLFDESPVLDSVSWNSILAGYVKKGDVEEAKLIFDQMPQRNIVASNSMIVLLGKMGQV 254

Query: 245 AEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSAC 304
            EA +LF EM +KD+VSWSALIS YEQN MYEEALV+F+ M  + + +DEVVVVSVLSAC
Sbjct: 255 MEAWKLFNEMDEKDMVSWSALISGYEQNGMYEEALVMFIEMNANGMRLDEVVVVSVLSAC 314

Query: 305 ANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWN 364
           A+L++VK G  +H L +++GIE Y+NLQNALIHMYS  GEI  A+KLF+  HNLD ISWN
Sbjct: 315 AHLSIVKTGKMIHGLVIRMGIESYVNLQNALIHMYSGSGEIMDAQKLFNGSHNLDQISWN 374

Query: 365 SMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRP 424
           SMISG +KCGSVEKARALFD M EKD+VSWS +ISGYAQHD FSETL+LF EMQ   IRP
Sbjct: 375 SMISGCMKCGSVEKARALFDVMPEKDIVSWSAVISGYAQHDCFSETLALFHEMQLGQIRP 434

Query: 425 DEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVF 484
           DE  LVSVISACTHL ALDQGKW+HAYIRKNGLK+N ILGTTL+DMYMK GCV+NALEVF
Sbjct: 435 DETILVSVISACTHLAALDQGKWVHAYIRKNGLKVNVILGTTLLDMYMKCGCVENALEVF 494

Query: 485 HGTEEKGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVD 544
           +G EEKGVSSWNALIIG A+NGL ++SL+MFSEMK +GV PNEITF+GVLGACRHMGLVD
Sbjct: 495 NGMEEKGVSSWNALIIGLAVNGLVERSLDMFSEMKNNGVIPNEITFMGVLGACRHMGLVD 554

Query: 545 EGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESMPMSPDVATWGALLGA 604
           EG  HF SMI++H +EPN KHYGCMVDLLGRAG+L EAE+LIESMPM+PDVATWGALLGA
Sbjct: 555 EGRCHFASMIEKHGIEPNVKHYGCMVDLLGRAGLLNEAEKLIESMPMAPDVATWGALLGA 614

Query: 605 CKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRRGVVKIP 664
           CKKHGD EMGERVGRKL+ELQPDHDGFHVLLSNI ASKG W+DVLEVRGMM ++GVVK P
Sbjct: 615 CKKHGDTEMGERVGRKLIELQPDHDGFHVLLSNIFASKGDWEDVLEVRGMMKQQGVVKTP 674

Query: 665 GCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKE 724
           GCS+IEANG++HEFLAGD+THP IN+++ ML+EMAK+LK+EGYAPDT EV+ DID+EEKE
Sbjct: 675 GCSLIEANGVVHEFLAGDKTHPWINKVEGMLNEMAKRLKMEGYAPDTNEVSLDIDEEEKE 734

Query: 725 TTLFRHSEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRF 784
           TTLFRHSEKLAIAFGL+TISPP PIRIMKNLRICNDCHTAAK IS+A+ REIVVRDRHRF
Sbjct: 735 TTLFRHSEKLAIAFGLLTISPPTPIRIMKNLRICNDCHTAAKLISKAYAREIVVRDRHRF 794

Query: 785 HHFKHGSCSCMDFW 798
           H+FK G+CSCMD+W
Sbjct: 795 HYFKEGACSCMDYW 808




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224124638|ref|XP_002330073.1| predicted protein [Populus trichocarpa] gi|222871498|gb|EEF08629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356569774|ref|XP_003553071.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Back     alignment and taxonomy information
>gi|449446125|ref|XP_004140822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449485565|ref|XP_004157209.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296089800|emb|CBI39619.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125543615|gb|EAY89754.1| hypothetical protein OsI_11297 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115452665|ref|NP_001049933.1| Os03g0314400 [Oryza sativa Japonica Group] gi|108707812|gb|ABF95607.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113548404|dbj|BAF11847.1| Os03g0314400 [Oryza sativa Japonica Group] gi|125586044|gb|EAZ26708.1| hypothetical protein OsJ_10614 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|293336578|ref|NP_001168380.1| uncharacterized protein LOC100382149 [Zea mays] gi|223947871|gb|ACN28019.1| unknown [Zea mays] gi|413955892|gb|AFW88541.1| hypothetical protein ZEAMMB73_254585 [Zea mays] Back     alignment and taxonomy information
>gi|242041125|ref|XP_002467957.1| hypothetical protein SORBIDRAFT_01g037150 [Sorghum bicolor] gi|241921811|gb|EER94955.1| hypothetical protein SORBIDRAFT_01g037150 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LUJ2PP249_ARATHNo assigned EC number0.37050.98490.9334yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01310097
hypothetical protein (793 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query798
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.0
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-154
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-67
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-31
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-30
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 6e-25
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-17
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-16
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-08
pfam0153531 pfam01535, PPR, PPR repeat 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  552 bits (1424), Expect = 0.0
 Identities = 273/761 (35%), Positives = 415/761 (54%), Gaps = 73/761 (9%)

Query: 75  LLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTY 134
            + F E+ +++ +F  +   + F +N ++  Y +     +A+CLY  ML   V  D YT+
Sbjct: 131 FVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTF 190

Query: 135 PLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPV 194
           P + +       +  G+ +H HV++ GF+ DV V N LI MY  CGD+ +AR +FD  P 
Sbjct: 191 PCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPR 250

Query: 195 LDLVSWNSILAGYVNADNVEEAKFIYNKMPER---------------------------- 226
            D +SWN++++GY       E   ++  M E                             
Sbjct: 251 RDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREM 310

Query: 227 -----------NIIASNSMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMY 275
                      ++   NS+I ++   G+  EA ++F  M  KD VSW+A+IS YE+N + 
Sbjct: 311 HGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLP 370

Query: 276 EEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNAL 335
           ++AL  +  M    V  DE+ + SVLSACA L  +  G  +H LA + G+  Y+ + NAL
Sbjct: 371 DKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANAL 430

Query: 336 IHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWS 395
           I MYS                               KC  ++KA  +F  + EKDV+SW+
Sbjct: 431 IEMYS-------------------------------KCKCIDKALEVFHNIPEKDVISWT 459

Query: 396 TMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKN 455
           ++I+G   +++  E L  F +M    ++P+  TL++ +SAC  + AL  GK IHA++ + 
Sbjct: 460 SIIAGLRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRT 518

Query: 456 GLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEKGVSSWNALIIGFAMNGLADKSLEMF 515
           G+  +  L   L+D+Y++ G ++ A   F+ + EK V SWN L+ G+  +G    ++E+F
Sbjct: 519 GIGFDGFLPNALLDLYVRCGRMNYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELF 577

Query: 516 SEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGR 575
           + M +SGV P+E+TF+ +L AC   G+V +G  +F+SM +++ + PN KHY C+VDLLGR
Sbjct: 578 NRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGR 637

Query: 576 AGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLL 635
           AG L EA   I  MP++PD A WGALL AC+ H   E+GE   + + EL P+  G+++LL
Sbjct: 638 AGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILL 697

Query: 636 SNIHASKGRWDDVLEVRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNML 695
            N++A  G+WD+V  VR  M   G+   PGCS +E  G +H FL  D +HPQI EI+ +L
Sbjct: 698 CNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVL 757

Query: 696 DEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRHSEKLAIAFGLITISPPNPIRIMKNL 755
           +   +K+K  G A      + D  +  K+     HSE+LAIAFGLI   P  PI + KNL
Sbjct: 758 EGFYEKMKASGLAGSESS-SMDEIEVSKDDIFCGHSERLAIAFGLINTVPGMPIWVTKNL 816

Query: 756 RICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMD 796
            +C +CH   KFIS+   REI VRD  +FHHFK G CSC D
Sbjct: 817 YMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD 857


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 798
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.76
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.69
KOG2003840 consensus TPR repeat-containing protein [General f 99.68
KOG2076895 consensus RNA polymerase III transcription factor 99.66
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.64
KOG2076895 consensus RNA polymerase III transcription factor 99.64
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.61
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.59
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
KOG0547606 consensus Translocase of outer mitochondrial membr 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.45
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.44
KOG1915677 consensus Cell cycle control protein (crooked neck 99.43
KOG1126638 consensus DNA-binding cell division cycle control 99.42
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.4
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.4
KOG2003840 consensus TPR repeat-containing protein [General f 99.4
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.37
KOG1915677 consensus Cell cycle control protein (crooked neck 99.35
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.33
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.32
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.28
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.22
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.22
KOG0547606 consensus Translocase of outer mitochondrial membr 99.22
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.21
PF1304150 PPR_2: PPR repeat family 99.21
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.2
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.2
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.19
KOG2376652 consensus Signal recognition particle, subunit Srp 99.19
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.18
PF1304150 PPR_2: PPR repeat family 99.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.14
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.11
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.1
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.1
PRK11189296 lipoprotein NlpI; Provisional 99.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.07
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.07
PRK12370553 invasion protein regulator; Provisional 99.06
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.05
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.05
KOG2376652 consensus Signal recognition particle, subunit Srp 99.02
PRK12370553 invasion protein regulator; Provisional 99.02
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.01
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.01
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.0
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.0
KOG1129478 consensus TPR repeat-containing protein [General f 98.95
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.94
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.93
KOG1129478 consensus TPR repeat-containing protein [General f 98.92
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.91
PRK11189296 lipoprotein NlpI; Provisional 98.89
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.86
KOG1125579 consensus TPR repeat-containing protein [General f 98.81
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.77
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.75
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.75
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.72
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.7
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.69
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.68
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.63
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.6
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.57
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.56
PRK04841903 transcriptional regulator MalT; Provisional 98.56
PRK15359144 type III secretion system chaperone protein SscB; 98.54
PRK15359144 type III secretion system chaperone protein SscB; 98.52
PRK04841903 transcriptional regulator MalT; Provisional 98.5
PRK10370198 formate-dependent nitrite reductase complex subuni 98.5
PF1285434 PPR_1: PPR repeat 98.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.43
PF1285434 PPR_1: PPR repeat 98.4
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.39
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.39
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.37
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.32
PRK10370198 formate-dependent nitrite reductase complex subuni 98.31
PLN02789320 farnesyltranstransferase 98.3
KOG1125579 consensus TPR repeat-containing protein [General f 98.3
KOG1128777 consensus Uncharacterized conserved protein, conta 98.3
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.28
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.25
KOG1128777 consensus Uncharacterized conserved protein, conta 98.17
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.15
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.12
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.1
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.05
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.03
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.02
PLN02789320 farnesyltranstransferase 98.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.01
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.97
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.94
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.89
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.89
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.85
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.85
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.84
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.84
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.82
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.82
KOG0553304 consensus TPR repeat-containing protein [General f 97.81
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.79
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.68
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.66
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.66
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.59
PRK15331165 chaperone protein SicA; Provisional 97.56
KOG20411189 consensus WD40 repeat protein [General function pr 97.55
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.53
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.53
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.53
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.46
KOG0553304 consensus TPR repeat-containing protein [General f 97.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.42
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.35
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.3
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.3
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.3
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.24
PF1337173 TPR_9: Tetratricopeptide repeat 97.23
COG3898531 Uncharacterized membrane-bound protein [Function u 97.23
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.16
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.16
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.16
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.14
PF1343134 TPR_17: Tetratricopeptide repeat 97.13
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.07
PRK10803263 tol-pal system protein YbgF; Provisional 97.06
COG3898531 Uncharacterized membrane-bound protein [Function u 97.04
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.03
COG4700251 Uncharacterized protein conserved in bacteria cont 97.02
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.99
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.89
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.89
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.87
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.87
PF12688120 TPR_5: Tetratrico peptide repeat 96.86
COG4700251 Uncharacterized protein conserved in bacteria cont 96.84
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.8
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.78
PF1337173 TPR_9: Tetratricopeptide repeat 96.75
PF12688120 TPR_5: Tetratrico peptide repeat 96.74
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.7
PF1342844 TPR_14: Tetratricopeptide repeat 96.7
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.67
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.65
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.64
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.62
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.61
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.53
PRK10803263 tol-pal system protein YbgF; Provisional 96.52
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.52
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.52
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.49
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.48
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.47
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.31
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.29
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.21
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.19
PRK11906458 transcriptional regulator; Provisional 96.19
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.19
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.17
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.15
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.07
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 96.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.0
KOG1258577 consensus mRNA processing protein [RNA processing 95.99
KOG4555175 consensus TPR repeat-containing protein [Function 95.86
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.8
PRK11906458 transcriptional regulator; Provisional 95.77
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.71
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.69
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.69
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.59
KOG20411189 consensus WD40 repeat protein [General function pr 95.43
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.41
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.33
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.33
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.2
KOG1941518 consensus Acetylcholine receptor-associated protei 95.18
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.17
PF13512142 TPR_18: Tetratricopeptide repeat 95.04
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.89
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.83
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.82
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.82
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.7
KOG1585308 consensus Protein required for fusion of vesicles 94.6
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.58
PF13512142 TPR_18: Tetratricopeptide repeat 94.44
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.4
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.4
KOG4234271 consensus TPR repeat-containing protein [General f 94.34
smart00299140 CLH Clathrin heavy chain repeat homology. 94.15
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.13
KOG3941406 consensus Intermediate in Toll signal transduction 94.12
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.75
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.45
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.43
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.27
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.18
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.98
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.87
KOG3941406 consensus Intermediate in Toll signal transduction 92.81
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.64
PRK15331165 chaperone protein SicA; Provisional 92.44
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.33
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.07
smart00299140 CLH Clathrin heavy chain repeat homology. 91.96
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.89
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.47
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.17
KOG1585308 consensus Protein required for fusion of vesicles 90.99
KOG4555175 consensus TPR repeat-containing protein [Function 90.98
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.78
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.47
PF1342844 TPR_14: Tetratricopeptide repeat 89.5
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.24
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.82
KOG1586288 consensus Protein required for fusion of vesicles 88.23
PRK09687280 putative lyase; Provisional 88.13
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.61
PRK11619644 lytic murein transglycosylase; Provisional 87.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.36
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.28
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.17
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.14
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.88
COG3629280 DnrI DNA-binding transcriptional activator of the 86.81
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.7
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.56
PRK10941269 hypothetical protein; Provisional 86.28
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.92
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 85.67
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.44
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.56
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.53
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.37
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.05
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 84.03
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.93
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.64
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.62
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 83.49
PF1343134 TPR_17: Tetratricopeptide repeat 83.28
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.1
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.07
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 82.99
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 82.71
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 82.63
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.55
COG3629280 DnrI DNA-binding transcriptional activator of the 82.52
PF06552186 TOM20_plant: Plant specific mitochondrial import r 82.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 81.9
COG4649221 Uncharacterized protein conserved in bacteria [Fun 81.73
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.55
COG4649221 Uncharacterized protein conserved in bacteria [Fun 81.29
KOG1258577 consensus mRNA processing protein [RNA processing 80.5
KOG4648 536 consensus Uncharacterized conserved protein, conta 80.29
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-136  Score=1204.64  Aligned_cols=761  Identities=33%  Similarity=0.585  Sum_probs=739.7

Q ss_pred             CCCChHHHHHHHhhccC---hHHHHHHHHHHHHhCCCCchhhhhhccccccCccCCCChhHHHHhhhcCCCCCcchHHHH
Q 003746           26 PTINLSILETHLQKCQS---FKQFTQILSQMILTGLIADTFAASRLIKFSTDLLPFIEMSYSFKIFAFLESPNGFIFNTM  102 (798)
Q Consensus        26 ~~~~~~~~~~~l~~~~~---~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~y~~~~g~~~~a~~~f~~~~~~~~~~~~~l  102 (798)
                      .+|+..++..+++.|..   +..+.++|..+++.|..+++.++|+|+.  +|+ ++|++++|+++|++|++||+++||++
T Consensus        82 ~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~--~~~-~~g~~~~A~~~f~~m~~~d~~~~n~l  158 (857)
T PLN03077         82 VPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLS--MFV-RFGELVHAWYVFGKMPERDLFSWNVL  158 (857)
T ss_pred             CCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHH--HHH-hCCChHHHHHHHhcCCCCCeeEHHHH
Confidence            45677788888888865   7889999999999999999999999999  999 99999999999999999999999999


Q ss_pred             HHHHHcCCCchHHHHHHHHHHhCCCCCCcccHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCh
Q 003746          103 MRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKLIHDHVLKAGFDSDVYVNNTLINMYAVCGDL  182 (798)
Q Consensus       103 i~~~~~~g~~~~A~~~~~~m~~~g~~~~~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~  182 (798)
                      |.+|++.|++++|+++|++|...|+.||.+||++++++|+..+++..++++|..+.+.|+.||+.++|+||.+|+++|++
T Consensus       159 i~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~  238 (857)
T PLN03077        159 VGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDV  238 (857)
T ss_pred             HHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHccCCCCCcchHHHHHHHHHhCCCHHHHHHHHhhCCC----CCchHHHHHHHHHhhcCCHHHHHHHHhcCCC--
Q 003746          183 SAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPE----RNIIASNSMIVLFGRKGNVAEACRLFKEMPK--  256 (798)
Q Consensus       183 ~~A~~~f~~~~~~d~~~~~~li~~~~~~g~~~~A~~~~~~m~~----~~~~~~~~li~~y~~~g~~~~A~~~f~~~~~--  256 (798)
                      ++|.++|++|+.+|+++||+||.+|++.|++++|+++|++|..    ||..+|+.++.++++.|+++.|.+++..|.+  
T Consensus       239 ~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g  318 (857)
T PLN03077        239 VSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTG  318 (857)
T ss_pred             HHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhC
Confidence            9999999999999999999999999999999999999999964    7899999999999999999999999998864  


Q ss_pred             --CCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCchhHHHHHHHHhccCchHHHHHHHHHHHHhCCccchhHHHH
Q 003746          257 --KDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNA  334 (798)
Q Consensus       257 --~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~  334 (798)
                        ||..+||+||.+|++.|++++|.++|++|.    .||..+|++++.+|.+.|+.++|.+++..|.+.|+.||..+++.
T Consensus       319 ~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~----~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~  394 (857)
T PLN03077        319 FAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME----TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIAS  394 (857)
T ss_pred             CccchHHHHHHHHHHHhcCCHHHHHHHHhhCC----CCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHH
Confidence              699999999999999999999999999996    48999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCHHHHHHHHHh----cCCCChhhHHHHHHHHHhcCCHHHHHHHHHhcCCCCHHHHHHHHHHHHhCCChHHH
Q 003746          335 LIHMYSSCGEITTAEKLFDA----GHNLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSET  410 (798)
Q Consensus       335 li~~y~~~g~~~~A~~~~~~----~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~li~~~~~~g~~~~A  410 (798)
                      ++.+|++.|++++|.++++.    +..++..+||+||++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|
T Consensus       395 ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA  474 (857)
T PLN03077        395 VLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEA  474 (857)
T ss_pred             HHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHH
Confidence            99999999999999999864    78899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHhcccchhHHHHHHHHHHHcCCCCcHHHHhHHHhhHHhcCCHHHHHHHHhhcCCC
Q 003746          411 LSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGCVDNALEVFHGTEEK  490 (798)
Q Consensus       411 ~~l~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~  490 (798)
                      +.+|++|.. +++||.+||+.+|.+|++.|+++.++++|..+.+.|+.++..++|+|+++|+|+|++++|.++|+.+ .+
T Consensus       475 ~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~  552 (857)
T PLN03077        475 LIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EK  552 (857)
T ss_pred             HHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CC
Confidence            999999986 6999999999999999999999999999999999999999999999999999999999999999999 89


Q ss_pred             CcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHhCCCcCCcchHHHHH
Q 003746          491 GVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMV  570 (798)
Q Consensus       491 ~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~  570 (798)
                      |+++||+||.+|+++|+.++|+++|++|.+.|+.||.+||+.++.+|++.|++++|.++|+.|.+++|+.|+..+|++|+
T Consensus       553 d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv  632 (857)
T PLN03077        553 DVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVV  632 (857)
T ss_pred             ChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999987899999999999999


Q ss_pred             HHHHhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhcCCCCcchHHHHHHHHHhcCChhHHHH
Q 003746          571 DLLGRAGMLKEAEELIESMPMSPDVATWGALLGACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLE  650 (798)
Q Consensus       571 ~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~  650 (798)
                      ++|++.|++++|.+++++|+++||..+|++|+.+|+.+|+.+.|+.+.+++++++|+++.+|+.|+++|+..|+|++|.+
T Consensus       633 ~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~  712 (857)
T PLN03077        633 DLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVAR  712 (857)
T ss_pred             HHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCccCCccceEEECCEEEEEEeCCCCCcChHHHHHHHHHHHHHHHHcCCCCCCcccccccChHHHHhHHhhH
Q 003746          651 VRGMMVRRGVVKIPGCSMIEANGIIHEFLAGDRTHPQINEIDNMLDEMAKKLKLEGYAPDTLEVAFDIDQEEKETTLFRH  730 (798)
Q Consensus       651 ~~~~m~~~~~~~~~~~s~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~g~~~d~~~~~~~~~~~~~~~~~~~h  730 (798)
                      +++.|+++|++|+||+|||++++++|.|.+||++||+.++|+.+|+++..+|++.||.||+...+ ++++++|+..+++|
T Consensus       713 vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~~~~-~~~~~~k~~~~~~h  791 (857)
T PLN03077        713 VRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSM-DEIEVSKDDIFCGH  791 (857)
T ss_pred             HHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcchhc-cccHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999998877 55788899999999


Q ss_pred             HHHHHHHHhhccCCCCCcEEEEcccccCcchhhHHHHHhhhcCceEEEecCCcccccCCcccCCCC
Q 003746          731 SEKLAIAFGLITISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMD  796 (798)
Q Consensus       731 ~~~~a~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~~~s~~~~~~~~~~~~~~~h~~~~g~csc~~  796 (798)
                      |||||+|||||++|+|+||||+||||||+|||+++||||++++|||||||.+|||||++|+|||+|
T Consensus       792 se~la~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  857 (857)
T PLN03077        792 SERLAIAFGLINTVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD  857 (857)
T ss_pred             cHHHHHHHhhhcCCCCCeEEEeCCCEeCccHHHHHHHHHHHhCeEEEEecCCcceeCCCCcccCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999998



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query798
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 71.0 bits (172), Expect = 1e-12
 Identities = 23/186 (12%), Positives = 62/186 (33%), Gaps = 7/186 (3%)

Query: 417 MQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTTLIDMYMKLGC 476
            +     P E  L  ++      ++LD  +       +  L              +    
Sbjct: 83  TRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQ 142

Query: 477 VDNALEVFHGTEEKG-------VSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEIT 529
           +  A  +      +        +  +NA+++G+A  G   + + +   +K +G+TP+ ++
Sbjct: 143 LPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLS 202

Query: 530 FVGVLGACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESM 589
           +   L                   + +  L+  +     ++    RA +LK   ++  + 
Sbjct: 203 YAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTF 262

Query: 590 PMSPDV 595
            + P +
Sbjct: 263 SLPPQL 268


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query798
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.93
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.67
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.65
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.61
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.61
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.43
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.41
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.4
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.4
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.37
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.37
3u4t_A272 TPR repeat-containing protein; structural genomics 99.36
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.36
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.33
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.28
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.19
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.16
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.12
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.0
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.95
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.92
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.91
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.88
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.83
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.8
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.79
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.76
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.75
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.72
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.71
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.7
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.7
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.68
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.63
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.63
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.61
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.57
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.54
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.52
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.45
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.45
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.43
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.4
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.4
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.39
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.39
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.39
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.38
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.33
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.32
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.3
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.3
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.28
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.27
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.27
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.24
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.23
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.22
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.22
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.22
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.22
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.12
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.1
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.1
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.09
3k9i_A117 BH0479 protein; putative protein binding protein, 98.09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.07
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.03
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.03
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.03
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.03
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.03
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.02
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.0
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.99
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.99
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.99
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.98
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.97
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.95
3k9i_A117 BH0479 protein; putative protein binding protein, 97.91
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.91
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.91
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.9
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.9
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.88
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.87
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.82
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.81
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.79
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.74
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.72
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.72
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.7
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.7
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.59
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.54
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.37
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.33
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.29
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.25
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.01
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.93
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.92
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.87
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.87
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.76
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.42
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.31
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.23
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.19
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.76
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.53
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.34
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.26
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 94.91
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.69
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.56
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.51
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.91
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.63
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.63
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.08
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.96
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.09
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 86.94
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.28
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 84.67
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.23
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.16
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 83.92
2p58_C116 Putative type III secretion protein YSCG; type III 83.83
2uwj_G115 Type III export protein PSCG; virulence, chaperone 83.53
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 83.34
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 82.92
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 82.4
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 81.81
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.15
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.86
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 80.25
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.1e-42  Score=391.36  Aligned_cols=500  Identities=9%  Similarity=-0.039  Sum_probs=294.8

Q ss_pred             cCccCCCChhHHHHhhhcCCCCCcchHHHHHHHHHcCCCchHHHHHHHHHHhCCCCCCcccHHHHHHHHhccCChHHHHH
Q 003746           73 TDLLPFIEMSYSFKIFAFLESPNGFIFNTMMRAYIQRNVPQQAICLYKLMLNNNVGVDNYTYPLLAQASALRLSVFEGKL  152 (798)
Q Consensus        73 ~y~~~~g~~~~a~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~t~~~ll~a~~~~~~~~~a~~  152 (798)
                      .+. +.|.+..++..|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..||..++..++.+|...|+++.|..
T Consensus        62 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~  138 (597)
T 2xpi_A           62 NTS-TDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKC  138 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             ccc-ccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHH
Confidence            455 788899999999999999999999999999999999999999999984  45777888888888888888888888


Q ss_pred             HHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHccCCCCCcchHHHHHHHHHhCCCHHHHHHHHhhCCCCCchHHH
Q 003746          153 IHDHVLKAGFDSDVYVNNTLINMYAVCGDLSAARKLFDESPVLDLVSWNSILAGYVNADNVEEAKFIYNKMPERNIIASN  232 (798)
Q Consensus       153 ~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~f~~~~~~d~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~  232 (798)
                      +++.+...  ++++.+++.++.+|.++|++++|.++|+++...+...     .++.+.                      
T Consensus       139 ~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~-----~~~~~~----------------------  189 (597)
T 2xpi_A          139 LLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDE-----KNANKL----------------------  189 (597)
T ss_dssp             HHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC------------------------------------
T ss_pred             HHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccc-----cccccc----------------------
Confidence            88877543  5778888888888888888888888888543222110     000000                      


Q ss_pred             HHHHHHhhcCCHHHHHHHHhcCCCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCchhHHHHHHHHhccCchHH
Q 003746          233 SMIVLFGRKGNVAEACRLFKEMPKKDLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVVKA  312 (798)
Q Consensus       233 ~li~~y~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~  312 (798)
                               ++       ++.-...++.+|+.++.+|.+.|++++|+++|++|.+.  .|+..+....+..+........
T Consensus       190 ---------~~-------~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~~l~~~~~~~~~~~  251 (597)
T 2xpi_A          190 ---------LM-------QDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMV--DAKCYEAFDQLVSNHLLTADEE  251 (597)
T ss_dssp             ----------C-------CCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHTTCSCHHHH
T ss_pred             ---------cc-------cccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CchhhHHHHHHHHhhcccchhH
Confidence                     00       00111236788999999999999999999999999874  3555444333333322221111


Q ss_pred             HHHH----HHHHHHhCCccchhHHHHHHHHHHhCCCHHHHHHHHHhcCCCChhhHHHHHHHHHhcCCHHHHHHHHHhcCC
Q 003746          313 GTSV----HALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGHNLDLISWNSMISGYLKCGSVEKARALFDAMIE  388 (798)
Q Consensus       313 a~~i----~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~  388 (798)
                      ...+    +..+...+......+++.++.+|.                               +.|++++|.++|+++.+
T Consensus       252 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------~~g~~~~A~~~~~~~~~  300 (597)
T 2xpi_A          252 WDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTS-------------------------------HEDELRRAEDYLSSING  300 (597)
T ss_dssp             HHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTT-------------------------------THHHHHHHHHHHHTSTT
T ss_pred             HHHHHhcCCcccccchHHHHHHHHHHHHHHHc-------------------------------CcchHHHHHHHHHHhhc
Confidence            1111    222333333334444555555565                               55555555555555544


Q ss_pred             --CCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhcccchhHHHHHHHHHHHcCCCCcHHHHhH
Q 003746          389 --KDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILGTT  466 (798)
Q Consensus       389 --~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  466 (798)
                        ++..+|+.++.+|.+.|++++|+++|++|...+ +.+..++..++.++.+.|+.++|..+++.+.+.. +.+..+++.
T Consensus       301 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~  378 (597)
T 2xpi_A          301 LEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLA  378 (597)
T ss_dssp             GGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHH
Confidence              455555555555555556666665555555443 2244455555555555566666666555555432 334555566


Q ss_pred             HHhhHHhcCCHHHHHHHHhhcCC---CCcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCcH
Q 003746          467 LIDMYMKLGCVDNALEVFHGTEE---KGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEITFVGVLGACRHMGLV  543 (798)
Q Consensus       467 li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~  543 (798)
                      ++.+|.++|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|+++|+++.+.+ +++..++..++.+|.+.|++
T Consensus       379 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~  457 (597)
T 2xpi_A          379 VGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNI  457 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCH
Confidence            66666666666666666665432   234566666666666666666666666666542 23445666666666666666


Q ss_pred             HHHHHHHHHHHHhCCCcCCcchHHHHHHHHHhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHHHHHHHcCChhHH
Q 003746          544 DEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESM-------PMSPD--VATWGALLGACKKHGDHEMG  614 (798)
Q Consensus       544 ~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~-------~~~p~--~~~~~~l~~~~~~~g~~~~A  614 (798)
                      ++|.++|+++.+.  .+.+..+|+.++.+|.+.|++++|.++|+++       +..|+  ..+|..++.+|.+.|++++|
T Consensus       458 ~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A  535 (597)
T 2xpi_A          458 LLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAA  535 (597)
T ss_dssp             HHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHH
Confidence            6666666666542  1224555666666666666666666666655       23454  45666666666666666666


Q ss_pred             HHHHHHHHhcCCCCcchHHHHHHHHHhcCChhHHHHHHHHHHhC
Q 003746          615 ERVGRKLVELQPDHDGFHVLLSNIHASKGRWDDVLEVRGMMVRR  658 (798)
Q Consensus       615 ~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~  658 (798)
                      ++.+++++++.|+++.++..++.+|...|++++|.++++++.+.
T Consensus       536 ~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          536 IDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             HHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence            66666666666666666666666666666666666666666543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 798
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-07
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.6 bits (122), Expect = 2e-07
 Identities = 47/417 (11%), Positives = 115/417 (27%), Gaps = 53/417 (12%)

Query: 240 RKGNVAEACRLFKEMPKKD---LVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVV 296
           + G+   A R   ++ +++         L S + Q    + +       I    ++    
Sbjct: 11  QAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL---- 66

Query: 297 VVSVLSACANLTVVKAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAGH 356
                                        E Y NL N           I           
Sbjct: 67  ----------------------------AEAYSNLGNVYKERGQLQEAIEHYRHALRLKP 98

Query: 357 NLDLISWNSMISGYLKCGSVEKARALFDAMIEKDVVSWSTMISGYAQHDQFSETLSLFME 416
           +      N   +           +A   A+     +       G           +    
Sbjct: 99  DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY 158

Query: 417 MQHHGIRPDEATLVSVISACTHLVALDQGKWIHAY-IRKNGLKINSILGTTLIDM---YM 472
           ++    +P+ A   S +    +     QG+   A    +  + ++       I++     
Sbjct: 159 LKAIETQPNFAVAWSNLGCVFN----AQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK 214

Query: 473 KLGCVDNALEVFHGTEEKG---VSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPNEIT 529
           +    D A+  +                L   +   GL D +++ +    +  + P+   
Sbjct: 215 EARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPD 272

Query: 530 FVGVLG-ACRHMGLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIE- 587
               L  A +  G V E    +N+ ++      ++     + ++    G ++EA  L   
Sbjct: 273 AYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRK 330

Query: 588 SMPMSPDVATWGALLG-ACKKHGDHEMGERVGRKLVELQPDHDGFHVLLSNIHASKG 643
           ++ + P+ A   + L    ++ G  +      ++ + + P     +  + N      
Sbjct: 331 ALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query798
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.47
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.78
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.75
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.41
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.37
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.3
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.3
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.26
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.25
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.15
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.98
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.98
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.94
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.84
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.77
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.75
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.74
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.72
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.25
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.13
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.1
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.81
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.64
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.59
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.03
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.52
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.88
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 90.73
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 80.27
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=5.6e-19  Score=186.51  Aligned_cols=369  Identities=11%  Similarity=0.056  Sum_probs=262.5

Q ss_pred             HHHHHhhcCCHHHHHHHHhcCCC--C-CcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCchhHHHHHHHHhccCch
Q 003746          234 MIVLFGRKGNVAEACRLFKEMPK--K-DLVSWSALISCYEQNEMYEEALVLFMNMIDHRVMVDEVVVVSVLSACANLTVV  310 (798)
Q Consensus       234 li~~y~~~g~~~~A~~~f~~~~~--~-~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~  310 (798)
                      +...+.+.|++++|.+.|+++.+  | +...|..+...|.+.|++++|+..|++..+.  .|+                 
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~--~p~-----------------   65 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NPL-----------------   65 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTT-----------------
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCC-----------------
Confidence            34556666777777777766532  2 4556666666677777777777777666552  122                 


Q ss_pred             HHHHHHHHHHHHhCCccchhHHHHHHHHHHhCCCHHHHHHHHHhc---CCCChhhHHHHHHHHHhcCCHHHHHHHHHhc-
Q 003746          311 KAGTSVHALAVKIGIECYINLQNALIHMYSSCGEITTAEKLFDAG---HNLDLISWNSMISGYLKCGSVEKARALFDAM-  386 (798)
Q Consensus       311 ~~a~~i~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~---~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m-  386 (798)
                                       +..++..+...|.+.|++++|.+.+...   .+.+...+..........+....+....... 
T Consensus        66 -----------------~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  128 (388)
T d1w3ba_          66 -----------------LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSAL  128 (388)
T ss_dssp             -----------------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHH
T ss_pred             -----------------CHHHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                             2334455555566666666666665542   2222233333333333334333333333222 


Q ss_pred             --CCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhcccchhHHHHHHHHHHHcCCCCcHHHH
Q 003746          387 --IEKDVVSWSTMISGYAQHDQFSETLSLFMEMQHHGIRPDEATLVSVISACTHLVALDQGKWIHAYIRKNGLKINSILG  464 (798)
Q Consensus       387 --~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  464 (798)
                        .......+..........+....+...+.+..... +-+...+..+...+...+..+.|...+..+++.. +.+...+
T Consensus       129 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~  206 (388)
T d1w3ba_         129 QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAY  206 (388)
T ss_dssp             HHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHH
T ss_pred             ccccccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHH
Confidence              23344455556666667777777777777766542 2244556666677777888888888888877764 3356677


Q ss_pred             hHHHhhHHhcCCHHHHHHHHhhcCC---CCcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHhc
Q 003746          465 TTLIDMYMKLGCVDNALEVFHGTEE---KGVSSWNALIIGFAMNGLADKSLEMFSEMKKSGVTPN-EITFVGVLGACRHM  540 (798)
Q Consensus       465 ~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~-~~t~~~ll~a~~~~  540 (798)
                      ..+...|...|++++|...|+....   .+...|..+...+.+.|++++|+..|++..+.  .|+ ..++..+..++...
T Consensus       207 ~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~  284 (388)
T d1w3ba_         207 INLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEK  284 (388)
T ss_dssp             HHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHH
T ss_pred             HHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHc
Confidence            7888889999999999998887654   34567888889999999999999999999884  555 45788888999999


Q ss_pred             CcHHHHHHHHHHHHHhCCCcCCcchHHHHHHHHHhcCCHHHHHHHHHhC-CCCC-CHHHHHHHHHHHHHcCChhHHHHHH
Q 003746          541 GLVDEGHRHFNSMIQEHRLEPNSKHYGCMVDLLGRAGMLKEAEELIESM-PMSP-DVATWGALLGACKKHGDHEMGERVG  618 (798)
Q Consensus       541 g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~  618 (798)
                      |++++|.+.++.....  .+.+...+..+...|.+.|++++|.+.+++. ...| +..+|..+..++...|++++|+..+
T Consensus       285 ~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~  362 (388)
T d1w3ba_         285 GSVAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHY  362 (388)
T ss_dssp             SCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHH
T ss_pred             CCHHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            9999999999998763  3345788889999999999999999999986 5566 5778999999999999999999999


Q ss_pred             HHHHhcCCCCcchHHHHHHHHHhcCC
Q 003746          619 RKLVELQPDHDGFHVLLSNIHASKGR  644 (798)
Q Consensus       619 ~~~~~~~p~~~~~~~~l~~~~~~~g~  644 (798)
                      +++++++|+++.++..|+.+|.+.|+
T Consensus       363 ~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         363 KEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999988875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure