Citrus Sinensis ID: 003859

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
ccccccccccccccccccccHHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHcccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHcHHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHccccccccccccccEEEEEcccccccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccEEEEEHHHHHHcccccEEEEccccccccccccccc
ccccccccccccccccccccHHHccccccccccEEEccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccEEEEEccccccccccccHHcccccccccccccccccccccccccHHcccccccccccccccccccccHHHHccccccccccccccHHcccccccccccccHcccccccccccccccccccccccccccccccccccHHHHccccEccHHcHHHHcccccHccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHccccccccEEEEEEccccccccHcccccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcHHHcccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHccccccHcccEEcHHHHHHHHHHccccccHHHHcHcHHHHHHHHHHcccccHHHHcHHHHHcHHHHHHcccccccHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccEEEEEEHHHHHHccEEEEEcccccccccHccccccc
myskrsgqgdgsvpgpvrtsdrlrrrpkilgrtylyynpirprksktKARTAASQIARmfgpgkrtvrtsnknsvplnlrrstrkrrisvnledytdssgsededlmrpsyrplrnrmrnnmsqdelspskrkkvveakptprreglrprrsmVATRKQlnldsgdeqgsseekvgqdetengnesdndaddgqneiegdgeaeaedegegedeedgddeegeeeqegrrrydlrNRAEVRRLSveegkqrprsprrvlhqgigtkvgrdvrkggsRVLKRHRlaraedsddsllvdeldqgpaipwgrggsrsgppwlfgglemhgttawglnvaasgwghqgdTLAALTSGiqtagpsskggadiqplqvdesvsfddiGGLSEYIDALKEMvffpllypdffasyhitpprgvllcgppgtgKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAqrnqpsiiffdeidglapvrsskqeqIHNSIVSTLLALMDGLDSRGQVVLIGATnrvdaidgalrrpgrfdrefnfplpgceARAEILDIHtrkwkqppsrelKSELAASCVGYCGADLKALCTEAAIRAFREkypqvytsddkflidvdsvtVEKYHFIEAMStitpaahrgatvhsrplslvVAPCLQRHLQKAMNYIsdifpplgmsselTKLCMLshgsaiplvyrprlllcgsegtgvFNRIILGLQFYMNWRNFLFILLVFQLFFQilvprhqrrHWCIYLVKLEEQRhqysiyhssifggrthmnslglfc
myskrsgqgdgsvpgpvrtsdrlrrrpkilgrtylyynpirprksktkaRTAASQiarmfgpgkrtvrtsnknsvplnlrrstrkrrisvnledytdssgsededlmrpsyrplrnrmrnnmsqdelspskrkkvveakptprreglrprrsmvatrkqlnldsgdeqgsseekvgqdetengnesdndaddgqNEIEGdgeaeaedegegedeedgddeegeeeqegrrrydlrnraevrrlsveegkqrprsprrvlhqgigtkvgrdvrkggsrvlkrhrlaraedsddsllvDELDQgpaipwgrggsRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIgatnrvdaidgalrrpgrfdrefnfplpgCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFRekypqvytsddkfliDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYhssifggrTHMNSLGLFC
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIegdgeaeaedegegedeedgddeegeeeQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAedsddsllvdeldQGPAIpwgrggsrsgppwLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNflfillvfqlffqilvPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
***************************KILGRTYLYYNPI*************************************************************************************************************************************************************************************************************************************************************************************WLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSG******************VDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVR****EQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWK*********ELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMN******
**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************LAALTSGI***************LQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGL****************STLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPL******************PLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQI****HQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
****************VRTSDRLRRRPKILGRTYLYYNPIRP***********SQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLED************MRPSYRPLRNRMRN********************************MVATRKQLN****************************ADDGQNEIE********************************RYDLRNRAEVRR**************RVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQ**********DIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKW**********ELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
********************DRLRRRPKILGRTYLYYNPIR*****************************************TRKRRISVNLEDY**********************************************************************************************************************************************AEVR************SPRRV******T**************************DSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVR***QEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNPIRPRKSKTKARTAASQIARMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRMRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQDETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEGRRRYDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDDSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTSGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFYMNWRNFLFILLVFQLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNSLGLFC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query791 2.2.26 [Sep-21-2011]
F4IAE9 1210 ATPase family AAA domain- yes no 0.883 0.577 0.761 0.0
Q6PL18 1390 ATPase family AAA domain- yes no 0.396 0.225 0.605 1e-112
Q8CDM1 1040 ATPase family AAA domain- no no 0.443 0.337 0.514 1e-111
Q9ULI0 1458 ATPase family AAA domain- no no 0.443 0.240 0.524 1e-111
Q5RDX4 1091 ATPase family AAA domain- yes no 0.396 0.287 0.605 1e-110
P40340 1379 Tat-binding homolog 7 OS= yes no 0.394 0.226 0.6 1e-110
O14114 1190 Uncharacterized AAA domai yes no 0.467 0.310 0.537 1e-108
A8X0L9 1285 Tat-binding homolog 7 OS= N/A no 0.434 0.267 0.534 1e-104
P54816 1291 Tat-binding homolog 7 OS= yes no 0.436 0.267 0.538 1e-104
Q9C0W2 1201 Uncharacterized AAA domai no no 0.481 0.317 0.507 3e-99
>sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 Back     alignment and function desciption
 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/713 (76%), Positives = 600/713 (84%), Gaps = 14/713 (1%)

Query: 1   MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYY---NPIRPRKSKTKARTAASQIA 57
           M+ KRS QGDGSV  PVRTSDRLRRRPK+ GR+YLYY   N +  RK  TK RTAASQIA
Sbjct: 1   MHPKRSSQGDGSVTKPVRTSDRLRRRPKLHGRSYLYYSSPNMLHNRKRNTKTRTAASQIA 60

Query: 58  RMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNR 117
           +M   G R  R SN   +  +LRRSTRKRRISVNLEDYTDSSG+EDED+M P+YR LR R
Sbjct: 61  KMLHKGNRPARASNAAPIASDLRRSTRKRRISVNLEDYTDSSGAEDEDMMSPAYRTLRRR 120

Query: 118 MRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQ 177
           +  N S      SK +K ++A+  PRREGLRPRRS     K+L  +SG +Q +SEEK GQ
Sbjct: 121 VHKNFST-----SKSRKDMDAELAPRREGLRPRRSTTIANKRLKTESGADQDTSEEKDGQ 175

Query: 178 DETENGNESDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEG---RRRYDL 234
           DETENGNE D DADDG+NE+E + E   EDEG+GEDE + D ++ EE  E    R+RYDL
Sbjct: 176 DETENGNELD-DADDGENEVEAEDEGNGEDEGDGEDEGEEDGDDDEEGDEEQEGRKRYDL 234

Query: 235 RNRAEVRRLSVEE--GKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSDD 292
           RNRAEVRR+   E   +Q+PRSPRRVLHQG+GT+VGRD R+GGSR  KRHR  R +DSDD
Sbjct: 235 RNRAEVRRMPTGEINKQQQPRSPRRVLHQGMGTRVGRDGRRGGSRPHKRHRFTRTDDSDD 294

Query: 293 SLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTS 352
           SLLVDELDQGPAIPW RGG+RSG PWLFGGL+ +G+++ GLNV ASGWGHQ D LAALTS
Sbjct: 295 SLLVDELDQGPAIPWARGGNRSGAPWLFGGLDTYGSSSLGLNVGASGWGHQSDGLAALTS 354

Query: 353 GIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITP 412
           G+QTAGPSSKGGADIQPLQ++E ++FDDIGGLSEYI+ LKEMVFFPLLYP+FFASY ITP
Sbjct: 355 GVQTAGPSSKGGADIQPLQINEDINFDDIGGLSEYINDLKEMVFFPLLYPEFFASYSITP 414

Query: 413 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 472
           PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE
Sbjct: 415 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 474

Query: 473 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 532
           AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA
Sbjct: 475 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 534

Query: 533 IDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADL 592
           IDGALRRPGRFDREFNF LPGCEARAEILDIHTRKWK PP+RELK ELAA+CVGYCGADL
Sbjct: 535 IDGALRRPGRFDREFNFSLPGCEARAEILDIHTRKWKHPPTRELKEELAATCVGYCGADL 594

Query: 593 KALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSR 652
           KALCTEAAIRAFREKYPQVYTSDDK+ IDV  V VEK HF+EAMS ITPAAHRG+ V SR
Sbjct: 595 KALCTEAAIRAFREKYPQVYTSDDKYAIDVGLVNVEKSHFVEAMSAITPAAHRGSVVQSR 654

Query: 653 PLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPR 705
           PLS VV PCL RHL ++M+ ISDIFP    SSELTKL +L+ GSAIPLVYRPR
Sbjct: 655 PLSPVVLPCLHRHLLESMSLISDIFPSSATSSELTKLSILTFGSAIPLVYRPR 707

Arabidopsis thaliana (taxid: 3702)
>sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 Back     alignment and function description
>sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 Back     alignment and function description
>sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 Back     alignment and function description
>sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 Back     alignment and function description
>sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 Back     alignment and function description
>sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query791
255584650 1153 ATP binding protein, putative [Ricinus c 0.905 0.620 0.845 0.0
225433862 1218 PREDICTED: ATPase family AAA domain-cont 0.905 0.587 0.832 0.0
224093154 1219 bromodomain protein [Populus trichocarpa 0.902 0.585 0.829 0.0
224133126 1157 bromodomain protein [Populus trichocarpa 0.838 0.573 0.810 0.0
356545489 1201 PREDICTED: ATPase family AAA domain-cont 0.901 0.593 0.825 0.0
356538905 1196 PREDICTED: ATPase family AAA domain-cont 0.896 0.592 0.821 0.0
358345778843 ATPase family AAA domain-containing prot 0.888 0.833 0.805 0.0
297843390 1208 hypothetical protein ARALYDRAFT_470606 [ 0.883 0.578 0.759 0.0
297743771 1105 unnamed protein product [Vitis vinifera] 0.764 0.547 0.725 0.0
18390588 1210 cell division cycle protein 48-like prot 0.883 0.577 0.761 0.0
>gi|255584650|ref|XP_002533048.1| ATP binding protein, putative [Ricinus communis] gi|223527167|gb|EEF29338.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/725 (84%), Positives = 658/725 (90%), Gaps = 9/725 (1%)

Query: 1   MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYYNP--IRPRKSKTKARTAASQIAR 58
           M+SKRSGQGDG V  PVRTSDRLRRRPK+ GRTYLYY P  IRPRKSK K RTAAS+IA+
Sbjct: 1   MHSKRSGQGDGPVSRPVRTSDRLRRRPKVYGRTYLYYTPTIIRPRKSKPKTRTAASRIAK 60

Query: 59  MFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNRM 118
           M  P  R  R+ N NS   NLRRSTRKRRISVNLEDYTDSSGSEDEDLM+P++R LRNR+
Sbjct: 61  MLCPSNRPARSPNNNSGASNLRRSTRKRRISVNLEDYTDSSGSEDEDLMKPTFRRLRNRI 120

Query: 119 RNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQD 178
            N++SQDELS  KRKK+ E + TPRREGLRPRRS    R++LNL+SGDEQ + + K+ +D
Sbjct: 121 DNSVSQDELSSPKRKKIAETRSTPRREGLRPRRSKTLAREKLNLESGDEQDTFDNKIIED 180

Query: 179 ETENGNE-SDNDADDGQNEIEGDGEAEAEDEGEGEDEEDGDDEEGEEEQEG------RRR 231
           ETENGNE  DNDADDGQN+ E + E + E E EG+++ D ++ E EEE+E       RRR
Sbjct: 181 ETENGNEIDDNDADDGQNDGEAEDEGDGEGEDEGDEDGDDEEGEEEEEEEEEEEQEGRRR 240

Query: 232 YDLRNRAEVRRLSVEEGKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAEDSD 291
           YDLRNRAEVRRLS+EEGKQRPRSPRRVLHQGIGT+V RDVRKGGSRV KRHR+ RAEDSD
Sbjct: 241 YDLRNRAEVRRLSMEEGKQRPRSPRRVLHQGIGTRVNRDVRKGGSRVHKRHRITRAEDSD 300

Query: 292 DSLLVDELDQGPAIPWGRGGSRSGPPWLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALT 351
           DSLLVDELDQGPAIPW RGGSRSGPPWLFGGL+MHGTTAWGLNVAASGWGHQGD +AALT
Sbjct: 301 DSLLVDELDQGPAIPWARGGSRSGPPWLFGGLDMHGTTAWGLNVAASGWGHQGDNIAALT 360

Query: 352 SGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHIT 411
           SGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHIT
Sbjct: 361 SGIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHIT 420

Query: 412 PPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFE 471
           PPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFE
Sbjct: 421 PPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFE 480

Query: 472 EAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVD 531
           EAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVD
Sbjct: 481 EAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVD 540

Query: 532 AIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGAD 591
           AIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPS+ELKSELAASCVGYCGAD
Sbjct: 541 AIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSKELKSELAASCVGYCGAD 600

Query: 592 LKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHS 651
           LKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSV VEKYHFIEAMSTITPAAHRGA VHS
Sbjct: 601 LKALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVKVEKYHFIEAMSTITPAAHRGAVVHS 660

Query: 652 RPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGS 711
           RPLSLVVAPCLQRHLQKAM++IS+IFPPL ++SE TKL MLS+GSAIP+VYRPRLL+ G 
Sbjct: 661 RPLSLVVAPCLQRHLQKAMDFISNIFPPLALASEFTKLSMLSYGSAIPIVYRPRLLMLGG 720

Query: 712 EGTGV 716
           EG+G+
Sbjct: 721 EGSGL 725

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225433862|ref|XP_002264772.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093154|ref|XP_002309811.1| bromodomain protein [Populus trichocarpa] gi|222852714|gb|EEE90261.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224133126|ref|XP_002327967.1| bromodomain protein [Populus trichocarpa] gi|222837376|gb|EEE75755.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545489|ref|XP_003541174.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Glycine max] Back     alignment and taxonomy information
>gi|356538905|ref|XP_003537941.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Glycine max] Back     alignment and taxonomy information
>gi|358345778|ref|XP_003636952.1| ATPase family AAA domain-containing protein 2B, partial [Medicago truncatula] gi|355502887|gb|AES84090.1| ATPase family AAA domain-containing protein 2B, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|297843390|ref|XP_002889576.1| hypothetical protein ARALYDRAFT_470606 [Arabidopsis lyrata subsp. lyrata] gi|297335418|gb|EFH65835.1| hypothetical protein ARALYDRAFT_470606 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297743771|emb|CBI36654.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18390588|ref|NP_563753.1| cell division cycle protein 48-like protein [Arabidopsis thaliana] gi|378525243|sp|F4IAE9.1|Y1591_ARATH RecName: Full=ATPase family AAA domain-containing protein At1g05910 gi|332189796|gb|AEE27917.1| cell division cycle protein 48-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query791
TAIR|locus:2198748 1210 AT1G05910 [Arabidopsis thalian 0.897 0.586 0.714 1.7e-265
UNIPROTKB|E2RRW1 1373 ATAD2 "Uncharacterized protein 0.396 0.228 0.605 1.8e-113
ZFIN|ZDB-GENE-030131-5754 1358 wu:fi16e04 "wu:fi16e04" [Danio 0.396 0.231 0.608 5.1e-112
UNIPROTKB|F1RR16 1388 ATAD2 "Uncharacterized protein 0.420 0.239 0.575 1e-109
ZFIN|ZDB-GENE-110411-210 1402 atad2b "ATPase family, AAA dom 0.396 0.223 0.592 1.1e-109
UNIPROTKB|Q6PL18 1390 ATAD2 "ATPase family AAA domai 0.396 0.225 0.605 4.8e-109
UNIPROTKB|E1BC78 1372 ATAD2 "Uncharacterized protein 0.396 0.228 0.595 5.9e-109
UNIPROTKB|J9NU31 1291 ATAD2B "Uncharacterized protei 0.396 0.243 0.601 3.5e-107
UNIPROTKB|F1MEU3 1248 ATAD2B "Uncharacterized protei 0.396 0.251 0.601 1.2e-106
DICTYBASE|DDB_G0281521 1800 DDB_G0281521 "BRAT group prote 0.408 0.179 0.579 3.2e-106
TAIR|locus:2198748 AT1G05910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2554 (904.1 bits), Expect = 1.7e-265, P = 1.7e-265
 Identities = 517/724 (71%), Positives = 568/724 (78%)

Query:     1 MYSKRSGQGDGSVPGPVRTSDRLRRRPKILGRTYLYY---NPIRPRKSKTKARTAASQIA 57
             M+ KRS QGDGSV  PVRTSDRLRRRPK+ GR+YLYY   N +  RK  TK RTAASQIA
Sbjct:     1 MHPKRSSQGDGSVTKPVRTSDRLRRRPKLHGRSYLYYSSPNMLHNRKRNTKTRTAASQIA 60

Query:    58 RMFGPGKRTVRTSNKNSVPLNLRRSTRKRRISVNLEDYTDSSGSEDEDLMRPSYRPLRNR 117
             +M   G R  R SN   +  +LRRSTRKRRISVNLEDYTDSSG+EDED+M P+YR LR R
Sbjct:    61 KMLHKGNRPARASNAAPIASDLRRSTRKRRISVNLEDYTDSSGAEDEDMMSPAYRTLRRR 120

Query:   118 MRNNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGSSEEKVGQ 177
             +  N S      SK +K ++A+  PRREGLRPRRS     K+L  +SG +Q +SEEK GQ
Sbjct:   121 VHKNFST-----SKSRKDMDAELAPRREGLRPRRSTTIANKRLKTESGADQDTSEEKDGQ 175

Query:   178 DETENGNESDNDADDGQNEIXXXXXXXXXXXXXXXXXXXXXXXXXXXX---QEGRRRYDL 234
             DETENGNE D DADDG+NE+                               QEGR+RYDL
Sbjct:   176 DETENGNELD-DADDGENEVEAEDEGNGEDEGDGEDEGEEDGDDDEEGDEEQEGRKRYDL 234

Query:   235 RNRAEVRRLSVEE--GKQRPRSPRRVLHQGIGTKVGRDVRKGGSRVLKRHRLARAXXXXX 292
             RNRAEVRR+   E   +Q+PRSPRRVLHQG+GT+VGRD R+GGSR  KRHR  R      
Sbjct:   235 RNRAEVRRMPTGEINKQQQPRSPRRVLHQGMGTRVGRDGRRGGSRPHKRHRFTRTDDSDD 294

Query:   293 XXXXXXXXQGPAIXXXXXXXXXXXXXLFGGLEMHGTTAWGLNVAASGWGHQGDTLAALTS 352
                     QGPAI             LFGGL+ +G+++ GLNV ASGWGHQ D LAALTS
Sbjct:   295 SLLVDELDQGPAIPWARGGNRSGAPWLFGGLDTYGSSSLGLNVGASGWGHQSDGLAALTS 354

Query:   353 GIQTAGPSSKGGADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITP 412
             G+QTAGPSSKGGADIQPLQ++E ++FDDIGGLSEYI+ LKEMVFFPLLYP+FFASY ITP
Sbjct:   355 GVQTAGPSSKGGADIQPLQINEDINFDDIGGLSEYINDLKEMVFFPLLYPEFFASYSITP 414

Query:   413 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 472
             PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE
Sbjct:   415 PRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEE 474

Query:   473 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 532
             AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA
Sbjct:   475 AQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA 534

Query:   533 IDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADL 592
             IDGALRRPGRFDREFNF LPGCEARAEILDIHTRKWK PP+RELK ELAA+CVGYCGADL
Sbjct:   535 IDGALRRPGRFDREFNFSLPGCEARAEILDIHTRKWKHPPTRELKEELAATCVGYCGADL 594

Query:   593 KALCTEAAIRAFREKYPQVYTSDDKFLIDVDSVTVEKYHFIEAMSTITPAAHRGATVHSR 652
             KALCTEAAIRAFREKYPQVYTSDDK+ IDV  V VEK HF+EAMS ITPAAHRG+ V SR
Sbjct:   595 KALCTEAAIRAFREKYPQVYTSDDKYAIDVGLVNVEKSHFVEAMSAITPAAHRGSVVQSR 654

Query:   653 PLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSE 712
             PLS VV PCL RHL ++M+ ISDIFP    SSELTKL +L+ GSAIPLVYRPRLLL G E
Sbjct:   655 PLSPVVLPCLHRHLLESMSLISDIFPSSATSSELTKLSILTFGSAIPLVYRPRLLLLGGE 714

Query:   713 GTGV 716
             G G+
Sbjct:   715 GVGL 718
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
UNIPROTKB|E2RRW1 ATAD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5754 wu:fi16e04 "wu:fi16e04" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR16 ATAD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-210 atad2b "ATPase family, AAA domain containing 2B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PL18 ATAD2 "ATPase family AAA domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC78 ATAD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NU31 ATAD2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEU3 ATAD2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281521 DDB_G0281521 "BRAT group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4IAE9Y1591_ARATHNo assigned EC number0.76150.88360.5776yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-70
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-69
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-69
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-67
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-64
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-62
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-54
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 6e-51
CHL00176638 CHL00176, ftsH, cell division protein; Validated 2e-48
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 7e-46
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-45
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-45
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-44
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-43
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-35
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-34
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 3e-27
smart00382148 smart00382, AAA, ATPases associated with a variety 8e-20
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 1e-14
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 3e-08
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 1e-06
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 2e-06
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 3e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 7e-06
pfam04147809 pfam04147, Nop14, Nop14-like family 9e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
PRK13342413 PRK13342, PRK13342, recombination factor protein R 2e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 3e-05
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 3e-05
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 5e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 6e-05
pfam01695178 pfam01695, IstB_IS21, IstB-like ATP binding protei 6e-05
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 6e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 9e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam03344715 pfam03344, Daxx, Daxx Family 1e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 1e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 2e-04
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-04
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-04
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 2e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 3e-04
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 3e-04
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 4e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 6e-04
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 6e-04
pfam05285317 pfam05285, SDA1, SDA1 6e-04
COG5414392 COG5414, COG5414, TATA-binding protein-associated 8e-04
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 8e-04
pfam13401124 pfam13401, AAA_22, AAA domain 9e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam04147809 pfam04147, Nop14, Nop14-like family 0.001
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.001
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.001
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.001
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.001
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.001
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.002
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.002
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.002
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.002
PRK09183259 PRK09183, PRK09183, transposase/IS protein; Provis 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.003
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 0.003
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.003
COG3343175 COG3343, RpoE, DNA-directed RNA polymerase, delta 0.003
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.003
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.003
pfam02724583 pfam02724, CDC45, CDC45-like protein 0.003
pfam08619430 pfam08619, Nha1_C, Alkali metal cation/H+ antiport 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  244 bits (624), Expect = 5e-70
 Identities = 120/273 (43%), Positives = 167/273 (61%), Gaps = 9/273 (3%)

Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
           V+++DIGGL E  + ++EMV  P+ +P+ F    I PP+GVLL GPPGTGKTL+A+A+A 
Sbjct: 175 VTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVAN 234

Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
            A        F    G +++SK+ GE+E +L+ +F+EA+ N PSIIF DEID +AP R  
Sbjct: 235 EAG-----AYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREE 289

Query: 496 KQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCE 555
              ++   +V+ LL LMDGL  RG+V++IGATNR DA+D ALRRPGRFDRE    +P   
Sbjct: 290 VTGEVEKRVVAQLLTLMDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKR 349

Query: 556 ARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD 615
           AR EIL +HTR        +L  +LA    G+ GADL AL  EAA+ A R    +   + 
Sbjct: 350 ARKEILKVHTRNMPLAEDVDLD-KLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINF 408

Query: 616 DKFLID---VDSVTVEKYHFIEAMSTITPAAHR 645
           +   I    +  + V    F+EA+  + P+A R
Sbjct: 409 EAEEIPAEVLKELKVTMKDFMEALKMVEPSAIR 441

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|110677 pfam01695, IstB_IS21, IstB-like ATP binding protein Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|181681 PRK09183, PRK09183, transposase/IS protein; Provisional Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|219939 pfam08619, Nha1_C, Alkali metal cation/H+ antiporter Nha1 C terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 791
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.98
CHL00176638 ftsH cell division protein; Validated 99.97
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.97
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.97
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.97
CHL00206 2281 ycf2 Ycf2; Provisional 99.96
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.96
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.96
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.96
CHL00095 821 clpC Clp protease ATP binding subunit 99.96
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.95
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.94
PRK10865 857 protein disaggregation chaperone; Provisional 99.93
CHL00181287 cbbX CbbX; Provisional 99.87
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.86
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.86
CHL00195 489 ycf46 Ycf46; Provisional 99.86
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.83
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.82
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.81
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.8
PF00004132 AAA: ATPase family associated with various cellula 99.79
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.79
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.76
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.74
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.72
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.72
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.72
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.7
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK00149450 dnaA chromosomal replication initiation protein; R 99.67
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.66
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.66
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.66
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.65
PRK06893229 DNA replication initiation factor; Validated 99.65
PRK08084235 DNA replication initiation factor; Provisional 99.65
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.65
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.65
PRK14088440 dnaA chromosomal replication initiation protein; P 99.64
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.64
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.64
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.64
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.64
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.63
PRK08727233 hypothetical protein; Validated 99.62
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.62
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.62
PRK14086617 dnaA chromosomal replication initiation protein; P 99.62
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.62
PLN03025319 replication factor C subunit; Provisional 99.62
PRK12402337 replication factor C small subunit 2; Reviewed 99.62
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.61
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.61
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.61
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.61
PTZ001121164 origin recognition complex 1 protein; Provisional 99.6
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.6
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.6
PRK13342413 recombination factor protein RarA; Reviewed 99.59
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.59
KOG2028554 consensus ATPase related to the helicase subunit o 99.59
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.58
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.58
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.58
PRK04195482 replication factor C large subunit; Provisional 99.58
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.57
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.57
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK07940394 DNA polymerase III subunit delta'; Validated 99.56
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.55
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.55
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.55
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.54
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK00440319 rfc replication factor C small subunit; Reviewed 99.54
PRK05642234 DNA replication initiation factor; Validated 99.53
PRK12422445 chromosomal replication initiation protein; Provis 99.53
PRK13341 725 recombination factor protein RarA/unknown domain f 99.53
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.53
PRK14087450 dnaA chromosomal replication initiation protein; P 99.53
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.52
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.52
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.5
PHA02544316 44 clamp loader, small subunit; Provisional 99.5
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.49
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.48
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.47
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.47
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.47
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.47
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.46
COG0593408 DnaA ATPase involved in DNA replication initiation 99.46
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.46
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.46
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.45
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK06620214 hypothetical protein; Validated 99.44
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.43
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.43
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.42
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.42
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.42
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.4
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.4
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.39
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.38
PRK09087226 hypothetical protein; Validated 99.37
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.37
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.36
KOG1514767 consensus Origin recognition complex, subunit 1, a 99.34
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.33
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.32
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.32
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.32
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.31
PRK10865857 protein disaggregation chaperone; Provisional 99.3
PRK09112351 DNA polymerase III subunit delta'; Validated 99.3
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.3
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.29
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.28
PRK07471365 DNA polymerase III subunit delta'; Validated 99.28
CHL00095821 clpC Clp protease ATP binding subunit 99.27
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.27
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.27
PRK05564313 DNA polymerase III subunit delta'; Validated 99.26
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.23
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.22
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.22
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.22
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.21
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 99.19
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.18
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.18
PRK04132846 replication factor C small subunit; Provisional 99.13
PRK07399314 DNA polymerase III subunit delta'; Validated 99.11
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.11
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.11
CHL00176 638 ftsH cell division protein; Validated 99.1
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.1
PRK08058329 DNA polymerase III subunit delta'; Validated 99.09
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.09
PRK13531498 regulatory ATPase RavA; Provisional 99.08
PHA02244383 ATPase-like protein 99.07
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.06
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.02
COG0714329 MoxR-like ATPases [General function prediction onl 99.02
PRK05707328 DNA polymerase III subunit delta'; Validated 99.01
smart00382148 AAA ATPases associated with a variety of cellular 98.99
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.99
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.98
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.96
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.96
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.93
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.93
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.93
smart00350509 MCM minichromosome maintenance proteins. 98.92
PRK11608326 pspF phage shock protein operon transcriptional ac 98.92
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.92
PRK06871325 DNA polymerase III subunit delta'; Validated 98.91
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.91
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.91
PRK07993334 DNA polymerase III subunit delta'; Validated 98.91
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.9
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.89
CHL00206 2281 ycf2 Ycf2; Provisional 98.89
COG1221403 PspF Transcriptional regulators containing an AAA- 98.88
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.88
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.88
PRK08769319 DNA polymerase III subunit delta'; Validated 98.87
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.86
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.85
PRK08116268 hypothetical protein; Validated 98.85
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.83
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.83
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.82
PF00004132 AAA: ATPase family associated with various cellula 98.81
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.8
PRK06964342 DNA polymerase III subunit delta'; Validated 98.79
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.79
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.79
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.78
PF07726131 AAA_3: ATPase family associated with various cellu 98.76
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.76
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.75
PRK15424538 propionate catabolism operon regulatory protein Pr 98.75
PRK06090319 DNA polymerase III subunit delta'; Validated 98.73
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.71
PRK12377248 putative replication protein; Provisional 98.71
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.71
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.7
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.7
PRK09862506 putative ATP-dependent protease; Provisional 98.67
CHL00181 287 cbbX CbbX; Provisional 98.67
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.65
COG2204464 AtoC Response regulator containing CheY-like recei 98.64
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.62
PRK07952244 DNA replication protein DnaC; Validated 98.62
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.62
PRK08699325 DNA polymerase III subunit delta'; Validated 98.61
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.61
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.61
PRK08181269 transposase; Validated 98.61
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.6
PRK06526254 transposase; Provisional 98.6
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.59
PRK06921266 hypothetical protein; Provisional 98.58
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.58
PRK06835329 DNA replication protein DnaC; Validated 98.57
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.53
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.53
PRK09183259 transposase/IS protein; Provisional 98.51
PRK08939306 primosomal protein DnaI; Reviewed 98.49
PF05729166 NACHT: NACHT domain 98.46
PRK05917290 DNA polymerase III subunit delta'; Validated 98.44
PRK13765 637 ATP-dependent protease Lon; Provisional 98.4
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.38
PRK06851367 hypothetical protein; Provisional 98.38
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.37
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.37
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.36
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.33
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.32
PF13173128 AAA_14: AAA domain 98.32
PRK15115444 response regulator GlrR; Provisional 98.31
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.28
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.28
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.28
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.26
KOG2170344 consensus ATPase of the AAA+ superfamily [General 98.25
PRK07132299 DNA polymerase III subunit delta'; Validated 98.25
PRK07276290 DNA polymerase III subunit delta'; Validated 98.24
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.24
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.23
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.21
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 98.19
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.15
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.14
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.13
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.12
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.09
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 98.07
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 98.06
smart00382148 AAA ATPases associated with a variety of cellular 98.06
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.06
PRK05818261 DNA polymerase III subunit delta'; Validated 98.02
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.02
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.01
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.01
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.0
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.0
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.95
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.95
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 97.94
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.94
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 97.94
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.94
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.94
PLN03025 319 replication factor C subunit; Provisional 97.93
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.91
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.86
PHA00729226 NTP-binding motif containing protein 97.86
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.85
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 97.85
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.85
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 97.84
PF14516331 AAA_35: AAA-like domain 97.84
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.82
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.81
PRK06067234 flagellar accessory protein FlaH; Validated 97.8
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.78
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.75
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.74
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.72
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.72
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.72
PRK00771437 signal recognition particle protein Srp54; Provisi 97.72
PRK06893 229 DNA replication initiation factor; Validated 97.71
PRK13342 413 recombination factor protein RarA; Reviewed 97.71
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.7
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.7
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.7
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.69
PRK14974336 cell division protein FtsY; Provisional 97.69
PRK08181269 transposase; Validated 97.68
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.68
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.67
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.67
KOG0480764 consensus DNA replication licensing factor, MCM6 c 97.67
PHA02624647 large T antigen; Provisional 97.66
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 97.66
cd01394218 radB RadB. The archaeal protein radB shares simila 97.65
COG1485367 Predicted ATPase [General function prediction only 97.64
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.63
PRK12402 337 replication factor C small subunit 2; Reviewed 97.62
KOG0482721 consensus DNA replication licensing factor, MCM7 c 97.62
PRK04195 482 replication factor C large subunit; Provisional 97.61
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.6
PRK06526254 transposase; Provisional 97.59
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.59
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 97.59
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.58
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.57
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.57
PRK09354349 recA recombinase A; Provisional 97.56
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 97.55
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.55
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.55
KOG0927 614 consensus Predicted transporter (ABC superfamily) 97.54
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.53
PRK04296190 thymidine kinase; Provisional 97.53
TIGR00064272 ftsY signal recognition particle-docking protein F 97.52
cd01128249 rho_factor Transcription termination factor rho is 97.52
PRK11823446 DNA repair protein RadA; Provisional 97.52
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.51
COG4619223 ABC-type uncharacterized transport system, ATPase 97.51
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.5
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.5
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.5
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.5
PRK10536262 hypothetical protein; Provisional 97.49
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.49
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.48
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.47
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.47
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.46
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.46
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.45
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.44
PRK05973237 replicative DNA helicase; Provisional 97.43
KOG2028 554 consensus ATPase related to the helicase subunit o 97.42
PRK06581263 DNA polymerase III subunit delta'; Validated 97.42
PRK12377248 putative replication protein; Provisional 97.41
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.41
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.41
PRK07952244 DNA replication protein DnaC; Validated 97.4
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.4
KOG2383467 consensus Predicted ATPase [General function predi 97.4
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.38
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.38
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.38
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.37
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.37
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.37
PRK08084 235 DNA replication initiation factor; Provisional 97.36
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.35
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.34
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.34
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.34
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.34
PRK09376416 rho transcription termination factor Rho; Provisio 97.34
PRK13341 725 recombination factor protein RarA/unknown domain f 97.34
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.34
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.33
COG0488530 Uup ATPase components of ABC transporters with dup 97.32
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.32
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.32
PRK10416318 signal recognition particle-docking protein FtsY; 97.32
PHA02244 383 ATPase-like protein 97.32
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 97.31
PTZ00202550 tuzin; Provisional 97.31
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.31
PRK08939306 primosomal protein DnaI; Reviewed 97.3
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.3
PRK08116268 hypothetical protein; Validated 97.3
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.3
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.3
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.3
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.29
PRK10867433 signal recognition particle protein; Provisional 97.28
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.27
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.25
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.25
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.25
PF13173128 AAA_14: AAA domain 97.25
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.24
PRK04328249 hypothetical protein; Provisional 97.24
PRK08727 233 hypothetical protein; Validated 97.24
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.24
PRK15455 644 PrkA family serine protein kinase; Provisional 97.24
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.23
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.23
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 97.23
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.22
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 97.22
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.22
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 97.22
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.21
PRK04841 903 transcriptional regulator MalT; Provisional 97.21
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.21
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.21
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.2
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.2
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.2
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.2
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.19
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.19
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.19
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.19
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 97.18
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.18
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.16
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.16
PRK13695174 putative NTPase; Provisional 97.14
KOG1969 877 consensus DNA replication checkpoint protein CHL12 97.14
PHA02774613 E1; Provisional 97.13
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 97.12
PRK14086 617 dnaA chromosomal replication initiation protein; P 97.12
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.12
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.12
cd03115173 SRP The signal recognition particle (SRP) mediates 97.11
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.11
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.11
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.11
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.1
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.09
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.09
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.09
PRK13531 498 regulatory ATPase RavA; Provisional 97.09
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.09
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.09
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.08
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.08
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.08
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.08
TIGR00959428 ffh signal recognition particle protein. This mode 97.07
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.07
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.06
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.05
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.05
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.05
cd03246173 ABCC_Protease_Secretion This family represents the 97.04
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.04
PRK14532188 adenylate kinase; Provisional 97.03
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.03
TIGR00767415 rho transcription termination factor Rho. Members 97.03
smart00487201 DEXDc DEAD-like helicases superfamily. 97.02
KOG0481729 consensus DNA replication licensing factor, MCM5 c 97.02
PRK06921266 hypothetical protein; Provisional 97.02
PHA02544 316 44 clamp loader, small subunit; Provisional 97.01
PRK09183259 transposase/IS protein; Provisional 97.01
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.01
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.0
PRK08118167 topology modulation protein; Reviewed 97.0
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.0
PRK06835329 DNA replication protein DnaC; Validated 96.99
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-68  Score=582.00  Aligned_cols=392  Identities=31%  Similarity=0.459  Sum_probs=349.9

Q ss_pred             CCCCCCccCCcHHHHHHHHHHHHcccCChhHhhhcCCCCCceEEEEcCCCChHHHHHHHHHHHHhhcCCceEEEEEechh
Q 003859          374 ESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGAD  453 (791)
Q Consensus       374 ~~~~~~~l~G~e~~k~~L~~~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~~  453 (791)
                      ..++|.+|+|++.++.+|.+++.. +++|+.|..+|+.||+|||||||||||||+||++||.+++     ++|+.+++.+
T Consensus       185 snv~f~diGG~d~~~~el~~li~~-i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~-----vPf~~isApe  258 (802)
T KOG0733|consen  185 SNVSFSDIGGLDKTLAELCELIIH-IKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELG-----VPFLSISAPE  258 (802)
T ss_pred             CCcchhhccChHHHHHHHHHHHHH-hcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcC-----CceEeecchh
Confidence            367999999999999999999988 9999999999999999999999999999999999999995     9999999999


Q ss_pred             hhhhhHhHHHHHHHHHHHHHHhcCCeEEEEeCCCccCCCCCCchhhhhHHHHHHHHHHHhccCCC----CcEEEeccCCc
Q 003859          454 VLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSR----GQVVLIGATNR  529 (791)
Q Consensus       454 ~~~~~~g~~~~~l~~lf~~a~~~~p~VL~IDEiD~L~~~~~~~~~~~~~~v~~~Ll~~l~~~~~~----~~vivIattn~  529 (791)
                      +++.+.|++++.++.+|+.|...+||||||||||++.+++...+..+.++++.+||+.|+++...    ..|+||+|||+
T Consensus       259 ivSGvSGESEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnR  338 (802)
T KOG0733|consen  259 IVSGVSGESEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNR  338 (802)
T ss_pred             hhcccCcccHHHHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCC
Confidence            99999999999999999999999999999999999999999988899999999999999998654    67999999999


Q ss_pred             hhhhhhhhcCCCCccccccCCCCCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHHhhCC
Q 003859          530 VDAIDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYP  609 (791)
Q Consensus       530 ~~~Ld~aL~r~gRf~~~I~~~~Pd~eer~~IL~~~l~~~~~~~~~~~~~~LA~~t~G~s~~di~~l~~~A~~~a~~~~~~  609 (791)
                      |+.||++|+|+|||++.|.+..|+..+|..||+.+++++.+..+.++ ..||..|.||.|+||.+||.+|+..|++|...
T Consensus       339 PDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~-~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld  417 (802)
T KOG0733|consen  339 PDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDF-KQLAKLTPGFVGADLMALCREAAFVAIKRILD  417 (802)
T ss_pred             CcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCCCcCH-HHHHhcCCCccchhHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999988877776 79999999999999999999999999998654


Q ss_pred             CccC---------C-------Ccc---c---------c------------------ccccccceeHHHHHHHhccccccc
Q 003859          610 QVYT---------S-------DDK---F---------L------------------IDVDSVTVEKYHFIEAMSTITPAA  643 (791)
Q Consensus       610 ~~~~---------~-------~~~---~---------~------------------~~~~~~~lt~~df~~Al~~~~p~~  643 (791)
                      ....         +       .+.   .         .                  .....+.|+.+||..|+..++|++
T Consensus       418 ~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSa  497 (802)
T KOG0733|consen  418 QSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSA  497 (802)
T ss_pred             cccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcch
Confidence            2220         0       000   0         0                  001235689999999999999999


Q ss_pred             ccCcccccCCCccchHHHHHHHHHHHHHHHHhhcCCCCCcHHHHHhhhhccCCCCCCCCCCcEEEecCCCCChhHHHHHH
Q 003859          644 HRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCMLSHGSAIPLVYRPRLLLCGSEGTGVFNRIILG  723 (791)
Q Consensus       644 ~r~~~l~~~~v~~~dIggLk~~l~~l~~~l~~~~p~~~~~~~~~~~~~~~~g~~~~l~~~~g~Ll~GPPGtGKT~la~~~  723 (791)
                      .+...+..|.|+|.+||+|+..-.++..+|-.   |+++++.|.++|+.         .+.|||||||||||||+||+++
T Consensus       498 kREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~---PiK~pd~~k~lGi~---------~PsGvLL~GPPGCGKTLlAKAV  565 (802)
T KOG0733|consen  498 KREGFATVPDVTWDDIGALEEVRLELNMAILA---PIKRPDLFKALGID---------APSGVLLCGPPGCGKTLLAKAV  565 (802)
T ss_pred             hcccceecCCCChhhcccHHHHHHHHHHHHhh---hccCHHHHHHhCCC---------CCCceEEeCCCCccHHHHHHHH
Confidence            99999999999999999998887777777655   99999999999876         3569999999999999777776


Q ss_pred             HH----HHcCchhHHHHHHHH----HHHHHHhhhhhcCCceEEEEeCchhhcccccccccccccccccccc
Q 003859          724 LQ----FYMNWRNFLFILLVF----QLFFQILVPRHQRRHWCIYLVKLEEQRHQYSIYHSSIFGGRTHMNS  786 (791)
Q Consensus       724 ~~----~~~~~~~~~l~~d~~----e~~~~~~~~a~~~~P~ivfldeid~~a~~~~~~~~~~~~~~~~~~~  786 (791)
                      |.    .|..+++|.|...|+    ..++++|++|+..+||||||||||+|++.|+..+  ...+.|-+|-
T Consensus       566 ANEag~NFisVKGPELlNkYVGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~--s~~s~RvvNq  634 (802)
T KOG0733|consen  566 ANEAGANFISVKGPELLNKYVGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEG--SSVSSRVVNQ  634 (802)
T ss_pred             hhhccCceEeecCHHHHHHHhhhHHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCC--chhHHHHHHH
Confidence            64    367789999999887    6789999999999999999999999999998776  4455555543

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 2e-58
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 2e-58
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 2e-58
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 4e-58
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 8e-58
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-56
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 5e-49
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-45
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 2e-44
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 2e-44
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 6e-43
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 3e-42
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 6e-40
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 8e-39
2ce7_A476 Edta Treated Length = 476 9e-39
3kds_E465 Apo-ftsh Crystal Structure Length = 465 4e-38
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-36
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-36
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 4e-36
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-36
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 7e-36
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-35
1xwi_A322 Crystal Structure Of Vps4b Length = 322 2e-35
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-35
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 3e-35
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 5e-34
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 1e-33
3vfd_A389 Human Spastin Aaa Domain Length = 389 4e-33
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-29
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-29
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-29
3b9p_A297 Spastin Length = 297 4e-28
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-27
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure 
Iteration: 1

 Score =  224 bits (570), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 171/276 (61%), Gaps = 7/276 (2%)
Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
           V +DDIGG  + +  +KEMV  PL +P  F +  + PPRG+LL GPPGTGKTLIARA+A 
Sbjct: 201 VGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVA- 259
Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
             ++ G    F++  G +++SK  GE+E  L+  FEEA++N P+IIF DE+D +AP R  
Sbjct: 260 --NETG--AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK 315
Query: 496 KQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLPGCE 555
              ++   IVS LL LMDGL  R  V+++ ATNR ++ID ALRR GRFDRE +  +P   
Sbjct: 316 THGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDAT 375
Query: 556 ARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD 615
            R EIL IHT+  K     +L+ ++A    G+ GADL ALC+EAA++A R+K   +   D
Sbjct: 376 GRLEILQIHTKNMKLADDVDLE-QVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED 434
Query: 616 DKFLIDV-DSVTVEKYHFIEAMSTITPAAHRGATVH 650
           +    +V +S+ V    F  A+S   P+A R   V 
Sbjct: 435 ETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVE 470
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query791
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-122
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-93
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 6e-93
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-89
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-88
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-87
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-78
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-74
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-74
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 4e-74
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 8e-74
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-69
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-69
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-54
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-54
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-52
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-52
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-52
2r62_A268 Cell division protease FTSH homolog; ATPase domain 5e-51
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-50
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 6e-47
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-46
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-17
2krk_A86 26S protease regulatory subunit 8; structural geno 8e-15
3kw6_A78 26S protease regulatory subunit 8; structural geno 9e-14
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 4e-11
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 8e-10
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-09
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 2e-07
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 4e-06
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 4e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 3e-05
3pvs_A447 Replication-associated recombination protein A; ma 4e-05
2v1u_A387 Cell division control protein 6 homolog; DNA repli 5e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 5e-05
3cx5_F146 Cytochrome B-C1 complex subunit 6; complex III, el 6e-05
3cx5_F146 Cytochrome B-C1 complex subunit 6; complex III, el 3e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 8e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 1e-04
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 2e-04
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 2e-04
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 4e-04
2qgz_A308 Helicase loader, putative primosome component; str 5e-04
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 9e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score =  374 bits (963), Expect = e-122
 Identities = 120/282 (42%), Positives = 168/282 (59%), Gaps = 7/282 (2%)

Query: 365 ADIQPLQVDESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGT 424
                 +    V +DDIGG  + +  +KEMV  PL +P  F +  + PPRG+LL GPPGT
Sbjct: 190 KREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGT 249

Query: 425 GKTLIARALACAASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFD 484
           GKTLIARA+A           F++  G +++SK  GE+E  L+  FEEA++N P+IIF D
Sbjct: 250 GKTLIARAVANETG-----AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFID 304

Query: 485 EIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFD 544
           E+D +AP R     ++   IVS LL LMDGL  R  V+++ ATNR ++ID ALRR GRFD
Sbjct: 305 ELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFD 364

Query: 545 REFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAF 604
           RE +  +P    R EIL IHT+  K     +L+ ++A    G+ GADL ALC+EAA++A 
Sbjct: 365 REVDIGIPDATGRLEILQIHTKNMKLADDVDLE-QVANETHGHVGADLAALCSEAALQAI 423

Query: 605 REKYPQVYTSDDKFLIDV-DSVTVEKYHFIEAMSTITPAAHR 645
           R+K   +   D+    +V +S+ V    F  A+S   P+A R
Sbjct: 424 RKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALR 465
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3cx5_F Cytochrome B-C1 complex subunit 6; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: f.28.1.1 PDB: 3cxh_F* 1ezv_H* 1kb9_F* 1p84_F* 2ibz_H* 1kyo_F* Length = 146 Back     alignment and structure
>3cx5_F Cytochrome B-C1 complex subunit 6; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: f.28.1.1 PDB: 3cxh_F* 1ezv_H* 1kb9_F* 1p84_F* 2ibz_H* 1kyo_F* Length = 146 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query791
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.98
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.97
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.97
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.97
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.97
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.97
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.96
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.96
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.96
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.95
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.95
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.95
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.94
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.94
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.93
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.88
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.85
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.82
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.81
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.76
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.76
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.75
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.75
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.74
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.73
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.72
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.72
3bos_A242 Putative DNA replication factor; P-loop containing 99.71
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.71
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.7
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.7
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.7
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.7
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.7
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.69
3pvs_A447 Replication-associated recombination protein A; ma 99.69
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.68
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.68
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.68
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.67
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.67
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.66
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.64
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.64
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.63
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.63
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.63
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.63
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.62
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.61
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.61
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.61
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.61
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.6
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.6
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.59
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.59
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.58
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.58
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.57
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.57
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.53
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.53
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.5
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.49
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.48
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.46
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.43
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.39
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.36
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.34
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.32
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.3
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.28
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.27
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.23
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.22
3co5_A143 Putative two-component system transcriptional RES 99.21
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.2
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.2
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.18
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.17
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.15
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.12
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.08
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.06
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.02
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.0
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.99
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 98.97
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.97
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.96
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.96
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.93
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.9
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.87
2fna_A357 Conserved hypothetical protein; structural genomic 98.83
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 98.83
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.83
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.83
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.81
3f8t_A506 Predicted ATPase involved in replication control, 98.8
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.8
2krk_A86 26S protease regulatory subunit 8; structural geno 98.79
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.78
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.68
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.67
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.67
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.67
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.67
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.64
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.63
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 98.5
2qgz_A308 Helicase loader, putative primosome component; str 98.45
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.44
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.43
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.4
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.35
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.33
1tue_A212 Replication protein E1; helicase, replication, E1E 98.22
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.2
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.19
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.17
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.14
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.13
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.13
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.05
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.01
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.0
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.99
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.99
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.96
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.95
3co5_A143 Putative two-component system transcriptional RES 97.95
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.94
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 97.91
3pvs_A 447 Replication-associated recombination protein A; ma 97.9
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.89
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.89
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.88
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.88
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.87
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.87
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.85
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.78
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.78
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.78
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.76
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.75
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.74
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.72
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.72
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.72
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.71
3bos_A 242 Putative DNA replication factor; P-loop containing 97.68
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.66
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.65
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.63
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.61
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.6
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.59
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.59
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.58
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.56
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.55
3io5_A333 Recombination and repair protein; storage dimer, i 97.51
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.5
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.5
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.49
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.49
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.48
2z43_A324 DNA repair and recombination protein RADA; archaea 97.47
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.45
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.45
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.44
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.42
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.36
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.35
2qgz_A308 Helicase loader, putative primosome component; str 97.34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.31
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.31
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.29
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.28
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.24
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.24
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.2
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.2
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.2
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.18
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.17
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.12
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.1
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.1
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.08
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.05
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.05
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.04
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.01
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.01
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.0
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.99
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.99
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.98
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.96
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.95
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.94
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.94
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.92
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.87
1tue_A212 Replication protein E1; helicase, replication, E1E 96.84
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.84
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.82
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.75
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.75
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.73
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.71
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.71
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.71
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.7
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.67
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.67
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.67
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.65
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.63
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.63
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.62
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.61
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 96.61
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.6
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.55
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.54
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.52
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.5
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.47
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.46
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.42
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.42
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.39
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.39
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.38
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.38
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.37
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.37
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.37
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 96.33
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.33
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.32
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.31
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 96.29
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.28
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.28
1via_A175 Shikimate kinase; structural genomics, transferase 96.28
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.27
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.27
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.27
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.26
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.25
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.22
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.21
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.19
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.18
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.17
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.17
2xxa_A433 Signal recognition particle protein; protein trans 96.15
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.12
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.12
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.11
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.11
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.07
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.07
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.07
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.07
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 96.05
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.02
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.02
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.99
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.98
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.98
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.97
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.97
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.96
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.96
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.95
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.94
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 95.93
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.93
3bor_A237 Human initiation factor 4A-II; translation initiat 95.93
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.92
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.92
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.89
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.87
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.87
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 95.86
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.86
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.85
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.83
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 95.83
1p9r_A418 General secretion pathway protein E; bacterial typ 95.81
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.8
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.8
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.79
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.79
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.76
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 95.76
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.76
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.76
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.73
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.73
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.72
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.71
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.7
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.69
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.68
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 95.67
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 95.67
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.67
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.66
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.64
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 95.64
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 95.62
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.6
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.6
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.6
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.55
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.55
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.54
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.54
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.5
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.5
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.44
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.44
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.43
2og2_A359 Putative signal recognition particle receptor; nuc 95.43
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.42
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.41
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.41
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.38
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.37
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.37
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 95.34
2fna_A 357 Conserved hypothetical protein; structural genomic 95.33
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 95.33
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.32
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.31
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.29
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.28
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.27
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.27
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.26
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.23
3ice_A422 Transcription termination factor RHO; transcriptio 95.22
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.2
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.19
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.18
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.17
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.16
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.14
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.13
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.12
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 95.11
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.11
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.1
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.07
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.03
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 95.02
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.01
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 95.0
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.0
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 94.99
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.97
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.96
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 94.96
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.93
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 94.92
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.89
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 94.88
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.88
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 94.87
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.87
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 94.87
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.86
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.86
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.85
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.84
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.83
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 94.83
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 94.82
1via_A175 Shikimate kinase; structural genomics, transferase 94.79
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.78
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 94.78
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 94.75
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.74
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 94.73
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.72
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.71
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 94.71
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.71
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.71
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 94.67
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.67
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.67
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.66
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.65
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.6
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.53
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.52
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 94.5
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.48
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 94.48
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 94.48
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 94.47
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.47
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 94.46
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.43
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.4
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 94.4
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.39
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.39
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.38
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.37
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 94.37
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.35
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.34
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.34
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.34
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.34
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.33
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.33
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.31
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.3
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.3
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.28
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.27
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 94.27
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.27
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.25
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.25
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.25
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.23
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.23
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.22
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.21
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.21
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 94.2
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.2
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.18
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 94.14
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 94.11
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.1
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.09
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.07
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.05
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 94.03
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 94.02
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 94.01
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 94.01
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.0
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 94.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 93.99
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 93.99
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.95
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 93.95
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 93.94
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.92
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.92
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 93.91
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 93.88
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 93.88
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.87
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.86
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 93.85
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.82
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.8
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.8
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.77
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.76
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.76
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.75
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.74
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.73
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=7.9e-61  Score=569.13  Aligned_cols=394  Identities=34%  Similarity=0.513  Sum_probs=332.4

Q ss_pred             CCCCCCCccCCcHHHHHHHHHHHHcccCChhHhhhcCCCCCceEEEEcCCCChHHHHHHHHHHHHhhcCCceEEEEEech
Q 003859          373 DESVSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGA  452 (791)
Q Consensus       373 ~~~~~~~~l~G~e~~k~~L~~~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~  452 (791)
                      .+.++|++|+|++++++.|+++|.+||.+|++|..+|+.+|+|||||||||||||+||++||++++     ++|+.+++.
T Consensus       198 ~~~v~~~dIgGl~~~~~~l~e~v~~pl~~p~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg-----~~~~~v~~~  272 (806)
T 3cf2_A          198 LNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG-----AFFFLINGP  272 (806)
T ss_dssp             SSSCCGGGCCSCCTTHHHHHHHHHHHHHCCGGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTT-----CEEEEEEHH
T ss_pred             CCCCChhhhcCHHHHHHHHHHHHHHHccCHHHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhC-----CeEEEEEhH
Confidence            368999999999999999999999999999999999999999999999999999999999999984     889999999


Q ss_pred             hhhhhhHhHHHHHHHHHHHHHHhcCCeEEEEeCCCccCCCCCCchhhhhHHHHHHHHHHHhccCCCCcEEEeccCCchhh
Q 003859          453 DVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDA  532 (791)
Q Consensus       453 ~~~~~~~g~~~~~l~~lf~~a~~~~p~VL~IDEiD~L~~~~~~~~~~~~~~v~~~Ll~~l~~~~~~~~vivIattn~~~~  532 (791)
                      +++++|.|+++..++.+|..|..++||||||||||.|++.+.........+++++|+.+|+++....+|+||+|||+++.
T Consensus       273 ~l~sk~~gese~~lr~lF~~A~~~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~  352 (806)
T 3cf2_A          273 EIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNS  352 (806)
T ss_dssp             HHHSSCTTHHHHHHHHHHHHHTTSCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTT
T ss_pred             HhhcccchHHHHHHHHHHHHHHHcCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHhcccccCCEEEEEecCChhh
Confidence            99999999999999999999999999999999999999988777777788999999999999988899999999999999


Q ss_pred             hhhhhcCCCCccccccCCCCCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHHhhCCCcc
Q 003859          533 IDGALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVY  612 (791)
Q Consensus       533 Ld~aL~r~gRf~~~I~~~~Pd~eer~~IL~~~l~~~~~~~~~~~~~~LA~~t~G~s~~di~~l~~~A~~~a~~~~~~~~~  612 (791)
                      ||++|+|+|||+..|+|+.|+..+|.+||+.++.++....+.++ ..||..|.||+++||.+||++|++.|+++....+.
T Consensus       353 LD~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~~~dvdl-~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~  431 (806)
T 3cf2_A          353 IDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDL-EQVANETHGHVGADLAALCSEAALQAIRKKMDLID  431 (806)
T ss_dssp             SCTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEECTTCCH-HHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred             cCHHHhCCcccceEEecCCCCHHHHHHHHHHHhcCCCCCcccCH-HHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccc
Confidence            99999999999999999999999999999999998877666555 78999999999999999999999999988654333


Q ss_pred             CCCcccc-ccccccceeHHHHHHHhcccccccccCcccccCCCccchHHHHHHHHHHHHHHHHhhcCCCCCcHHHHHhhh
Q 003859          613 TSDDKFL-IDVDSVTVEKYHFIEAMSTITPAAHRGATVHSRPLSLVVAPCLQRHLQKAMNYISDIFPPLGMSSELTKLCM  691 (791)
Q Consensus       613 ~~~~~~~-~~~~~~~lt~~df~~Al~~~~p~~~r~~~l~~~~v~~~dIggLk~~l~~l~~~l~~~~p~~~~~~~~~~~~~  691 (791)
                      ....... .......|+.+||..|+..++|+..+...+..+.+.|.+|+||....+++.+.+..   |+.+++.|.++|+
T Consensus       432 ~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~v~w~diggl~~~k~~l~e~v~~---p~~~p~~f~~~g~  508 (806)
T 3cf2_A          432 LEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQY---PVEHPDKFLKFGM  508 (806)
T ss_dssp             GTCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCCCCSTTCCSCHHHHHHHTTTTTT---TTTCSGGGSSSCC
T ss_pred             ccccccchhhhccceeeHHHHHHHHHhCCCcccccccccCCCCCHHHhCCHHHHHHHHHHHHHh---hhhCHHHHHhcCC
Confidence            2221111 11245679999999999999999999999999999999999998888887777555   8888888877654


Q ss_pred             hccCCCCCCCCCCcEEEecCCCCChhHHHHHHHHHH----cCchhHHHHHHHH----HHHHHHhhhhhcCCceEEEEeCc
Q 003859          692 LSHGSAIPLVYRPRLLLCGSEGTGVFNRIILGLQFY----MNWRNFLFILLVF----QLFFQILVPRHQRRHWCIYLVKL  763 (791)
Q Consensus       692 ~~~g~~~~l~~~~g~Ll~GPPGtGKT~la~~~~~~~----~~~~~~~l~~d~~----e~~~~~~~~a~~~~P~ivfldei  763 (791)
                               +++.|+|||||||||||++|++++..+    +.+..+.+...+.    ++++++|..|++.+|||||||||
T Consensus       509 ---------~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~~Ar~~~P~IifiDEi  579 (806)
T 3cf2_A          509 ---------TPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDEL  579 (806)
T ss_dssp             ---------CCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHHHHHTTCSEEEECSCG
T ss_pred             ---------CCCceEEEecCCCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHHHHHHcCCceeechhh
Confidence                     446699999999999996666666542    3345555544443    77889999999999999999999


Q ss_pred             hhhcccccccccccccccccc
Q 003859          764 EEQRHQYSIYHSSIFGGRTHM  784 (791)
Q Consensus       764 d~~a~~~~~~~~~~~~~~~~~  784 (791)
                      |+++..|+......++..+++
T Consensus       580 Dsl~~~R~~~~~~~~~~~~rv  600 (806)
T 3cf2_A          580 DSIAKARGGNIGDGGGAADRV  600 (806)
T ss_dssp             GGCC--------------CHH
T ss_pred             hHHhhccCCCCCCCchHHHHH
Confidence            999999976655555555444
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 791
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 7e-82
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-81
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-67
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 6e-57
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-45
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 8e-28
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-25
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-25
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 3e-18
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 6e-16
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-13
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 7e-12
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-09
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 8e-07
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-05
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-05
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 4e-04
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 5e-04
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 6e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 6e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 9e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.002
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.004
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  260 bits (665), Expect = 7e-82
 Identities = 87/243 (35%), Positives = 128/243 (52%), Gaps = 10/243 (4%)

Query: 376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALAC 435
            +F D+ G  E  + + E+V + L  P  F       P+GVL+ GPPGTGKTL+A+A+A 
Sbjct: 9   TTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAG 67

Query: 436 AASKAGQKVSFYMRKGADVLSKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSS 495
            A     KV F+   G+D +  +VG    +++ +FE+A++  P IIF DEID +   R +
Sbjct: 68  EA-----KVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGA 122

Query: 496 KQEQIH---NSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDGALRRPGRFDREFNFPLP 552
                H      ++ +L  MDG +    +++I ATNR D +D AL RPGRFDR+    LP
Sbjct: 123 GLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLP 182

Query: 553 GCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVY 612
               R +IL +H R+    P  +    +A    G+ GADL  L  EAA+ A R     V 
Sbjct: 183 DVRGREQILKVHMRRVPLAPDIDAA-IIARGTPGFSGADLANLVNEAALFAARGNKRVVS 241

Query: 613 TSD 615
             +
Sbjct: 242 MVE 244
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query791
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.87
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.86
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.84
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.82
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.8
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.77
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.75
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.75
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.71
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.67
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.67
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.65
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.65
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.63
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.62
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.62
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.52
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.51
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.48
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.43
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.42
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.41
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.39
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.37
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.32
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.31
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.13
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.1
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.03
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.01
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.88
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.87
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.86
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.64
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.63
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.58
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.33
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.25
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.22
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.21
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.21
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.14
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.13
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.11
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.07
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.89
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.87
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.78
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.77
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.75
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.68
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.67
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.64
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.61
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.6
d2qy9a2211 GTPase domain of the signal recognition particle r 97.58
d1vmaa2213 GTPase domain of the signal recognition particle r 97.57
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.53
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.52
d1okkd2207 GTPase domain of the signal recognition particle r 97.52
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.47
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.46
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.44
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.43
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.42
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.4
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.36
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.36
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.35
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.29
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.28
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.25
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.24
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.23
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.21
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.19
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.16
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.14
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.11
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 97.1
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.09
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.09
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.09
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.07
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.05
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.05
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.03
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.02
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.01
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.01
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.97
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.97
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.92
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.91
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.9
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.82
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.81
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.8
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.8
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.79
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.79
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.77
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.76
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.75
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.74
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.73
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.72
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.72
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.71
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.69
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.66
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.63
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.62
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.6
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.57
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.55
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.55
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.53
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.53
d1okkd2 207 GTPase domain of the signal recognition particle r 96.52
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.51
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.48
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.44
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.43
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.43
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.41
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.4
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.39
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.39
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.38
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.34
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.34
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.33
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.3
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.26
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.19
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.18
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.13
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.12
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.12
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.07
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.07
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.06
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.02
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.01
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.01
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.99
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.95
d1vmaa2 213 GTPase domain of the signal recognition particle r 95.94
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.94
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.92
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.91
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.85
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.85
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.74
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.7
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.69
d2qy9a2 211 GTPase domain of the signal recognition particle r 95.67
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.66
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.66
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.62
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.62
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.62
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.62
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.61
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.59
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.57
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.56
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.5
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.45
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.41
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 95.4
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.39
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.37
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.32
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.27
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.22
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.18
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.18
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.17
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.15
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.03
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.97
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.95
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.92
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.9
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.9
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.88
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 94.85
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.83
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.82
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.79
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 94.78
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 94.76
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.68
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.66
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.36
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.33
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.29
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.27
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.2
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.08
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.06
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.04
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 94.03
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.03
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.98
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.96
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.89
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.87
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.64
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 93.56
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.54
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.54
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 93.48
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.46
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.41
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.37
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.37
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.36
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 93.3
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 93.3
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 93.15
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.78
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.73
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.62
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.61
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.48
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.47
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.4
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 92.4
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.31
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.22
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.22
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.19
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.17
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.09
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.91
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.68
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.63
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.6
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.52
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.51
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.45
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.33
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.28
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 91.24
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.23
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.21
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.19
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.17
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.98
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.97
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.9
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.89
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.89
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.88
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.75
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.71
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.64
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.62
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.55
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.52
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.5
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 90.49
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.44
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.42
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.41
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.38
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.16
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.11
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.03
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.95
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.79
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.79
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 89.74
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 89.72
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.67
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.65
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.63
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 89.63
d2awna2 232 Maltose transport protein MalK, N-terminal domain 89.57
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.5
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.45
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.44
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.43
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.37
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.34
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 89.33
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.32
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 89.31
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.28
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.19
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.15
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.15
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.01
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.94
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 88.91
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 88.91
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.9
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 88.84
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.82
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.69
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.67
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.66
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.64
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 88.64
d2fh5b1 207 Signal recognition particle receptor beta-subunit 88.63
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.58
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.53
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.52
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.48
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.45
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.44
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.37
d1g2912 240 Maltose transport protein MalK, N-terminal domain 88.31
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.28
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 88.28
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.22
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.21
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.09
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.09
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.04
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 87.96
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.82
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 87.82
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.78
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.77
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.65
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 87.65
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.58
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.58
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.52
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 87.3
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.28
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.26
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.21
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.19
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 87.18
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 87.11
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 87.08
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.08
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 87.01
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.96
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.92
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.91
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.89
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.8
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 86.79
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.79
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 86.78
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.76
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.74
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.68
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.53
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 86.49
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 86.45
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.45
d1xpua3289 Transcription termination factor Rho, ATPase domai 86.38
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 86.33
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.32
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 86.32
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.27
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.24
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 86.02
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 85.91
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 85.86
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.84
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.83
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 85.82
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.75
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.74
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.7
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.5
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 85.49
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 85.47
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.46
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.45
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.41
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.28
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.2
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 85.12
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 85.12
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 85.1
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 85.09
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 84.9
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.85
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.69
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 84.63
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 84.58
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 84.29
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.25
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 83.96
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.94
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.9
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.76
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 83.73
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.7
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 83.66
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 83.59
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 83.51
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 83.4
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 83.11
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.04
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.01
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.87
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 82.83
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 82.73
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 82.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.57
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 82.45
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 82.35
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 82.08
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 81.97
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 81.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 81.81
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 81.79
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.77
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 81.73
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 81.72
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.59
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.36
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 81.13
d1xpua3 289 Transcription termination factor Rho, ATPase domai 81.02
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 80.96
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 80.65
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 80.34
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 80.15
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 80.05
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.6e-40  Score=347.55  Aligned_cols=257  Identities=44%  Similarity=0.732  Sum_probs=227.4

Q ss_pred             CCCCccCCcHHHHHHHHHHHHcccCChhHhhhcCCCCCceEEEEcCCCChHHHHHHHHHHHHhhcCCceEEEEEechhhh
Q 003859          376 VSFDDIGGLSEYIDALKEMVFFPLLYPDFFASYHITPPRGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADVL  455 (791)
Q Consensus       376 ~~~~~l~G~e~~k~~L~~~v~~pl~~~~~~~~~g~~~~~~vLL~GppGtGKT~laralA~~l~~~~~~~~~~~i~~~~~~  455 (791)
                      ++|++|+|++++|+.|++.|..|+.+++.|.++|+.+++|+|||||||||||++|+++|.+++     .+++.+++..+.
T Consensus         1 ~~~~dv~G~~~~k~~l~~~i~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~l~~ala~~~~-----~~~~~i~~~~l~   75 (258)
T d1e32a2           1 VGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG-----AFFFLINGPEIM   75 (258)
T ss_dssp             CCGGGCCSCSHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCTTSSHHHHHHHHHHHTT-----CEEEEECHHHHT
T ss_pred             CChhhhccHHHHHHHHHHHHHHHhcCHHHHHhCCCCCCceeEEecCCCCCchHHHHHHHHHhC-----CeEEEEEchhhc
Confidence            589999999999999999999999999999999999999999999999999999999999984     889999999999


Q ss_pred             hhhHhHHHHHHHHHHHHHHhcCCeEEEEeCCCccCCCCCCchhhhhHHHHHHHHHHHhccCCCCcEEEeccCCchhhhhh
Q 003859          456 SKWVGEAERQLKLLFEEAQRNQPSIIFFDEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNRVDAIDG  535 (791)
Q Consensus       456 ~~~~g~~~~~l~~lf~~a~~~~p~VL~IDEiD~L~~~~~~~~~~~~~~v~~~Ll~~l~~~~~~~~vivIattn~~~~Ld~  535 (791)
                      +.++|.....++.+|..|...+||||||||+|.+++++..........++..++.++.......+|+||+|||.++.||+
T Consensus        76 ~~~~g~~~~~l~~~f~~A~~~~p~il~iDeid~l~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~vlvi~tTn~~~~ld~  155 (258)
T d1e32a2          76 SKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDP  155 (258)
T ss_dssp             TSCTTHHHHHHHHHHHHHHHTCSEEEEESSGGGTCCHHHHCCCTTHHHHHHHHHHHHHTCCCSSCEEEEEEESCGGGSCG
T ss_pred             ccccccHHHHHHHHHHHHHhcCCeEEEehhhhhhccCCCCCCCchHHHHHHHhccccccccccCCccEEEeCCCccccch
Confidence            99999999999999999999999999999999999876555555567788899999998888889999999999999999


Q ss_pred             hhcCCCCccccccCCCCCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHHhhCCCccCCC
Q 003859          536 ALRRPGRFDREFNFPLPGCEARAEILDIHTRKWKQPPSRELKSELAASCVGYCGADLKALCTEAAIRAFREKYPQVYTSD  615 (791)
Q Consensus       536 aL~r~gRf~~~I~~~~Pd~eer~~IL~~~l~~~~~~~~~~~~~~LA~~t~G~s~~di~~l~~~A~~~a~~~~~~~~~~~~  615 (791)
                      +++|+|||+..|+|++|+.++|..||+.++.+.....+.+ +..||..|.|||++||.+||++|+..|+++....+...+
T Consensus       156 al~r~gRfd~~i~~~~P~~~~R~~il~~~l~~~~~~~~~~-~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~~~~~  234 (258)
T d1e32a2         156 ALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVD-LEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLED  234 (258)
T ss_dssp             GGTSTTSSCEEEECCCCCHHHHHHHHHHTTTTSCBCTTCC-HHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCS
T ss_pred             hhhhcccccceeECCCCCHHHHHHHhhhhccCcccccccc-hhhhhhcccCCCHHHHHHHHHHHHHHHHHhhccccchhh
Confidence            9999999999999999999999999999998877665545 479999999999999999999999999987654333322


Q ss_pred             cccc-ccccccceeHHHHHHHhcc
Q 003859          616 DKFL-IDVDSVTVEKYHFIEAMST  638 (791)
Q Consensus       616 ~~~~-~~~~~~~lt~~df~~Al~~  638 (791)
                      .... .......|+++||..||.+
T Consensus       235 ~~~~~~~~~~~~it~~Df~~AL~~  258 (258)
T d1e32a2         235 ETIDAEVMNSLAVTMDDFRWALSQ  258 (258)
T ss_dssp             SCCBHHHHHHCCBCHHHHHHHHTC
T ss_pred             hhhhhhhhccCccCHHHHHHHhCc
Confidence            2111 1123566999999999863
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure