Citrus Sinensis ID: 003910


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------
MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLTGFVSGGSIGGEMSGTQTTSSFSPVSGVNSSRVNYGESAHQKNSERDRPRERRRPSGWDR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccccccHHHHcccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHccccccccccEEEccccccccccccHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEccccHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccccccccEEEccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccEccccccccccccccccccEccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHccHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHccccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcccccHHccccEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHcccccccEEEEEEEcccccccHcEEEEcccccccccccEEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mtkrkfgfegfninrqtsysfeqsqapqrlyvppssryshdnyedtdldnidyedndaakaandtgngaekeeidplDAFMEGIheemraapppkpkeklerykdddeedpmESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDagmldydsddnpvvvekkkiepipaldhslidyepfnkdfyqdsasisgmsEQDVMEYKKSLAIRvsgfdvprpvktfedcgfSTQLMHAISkqgyekptsiqcqalpiilsgrdiigiaktgsgktaaFVLPMIVhimdqpelqkeegpigvicaptRELAHQIYLETKKFAKSHGIRVsavyggmsklDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEAdrmfdlgfepqIRSIvgqirpdrqtllfsatmpRKVEKLAREILsdpvrvtvgevgmanedITQVVHVIPSDAEKLPWLLeklpgmiddgdVLVFASKKTTVDEIESQLAQKGFKAaalhgdkdQASRMEILQKFKSGVYHVLIATDVaargldiksiKSVVNFDIARDMDMHVhrigrtgragdkdgtayTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKdgrfrskrdarkgggkkgkgrggagrgvrgvdfglgigytpesnntssqsvpsrsaAVNSLKTGMMTQFRSNfvaassntpsegfnnsasayankrpalrgfvsggsiggdvngtqttgltgfvsggsiggemsgtqttssfspvsgvnssrvnygesahqknserdrprerrrpsgwdr
mtkrkfgfegfninrqtsysfeqsqapqrlyvppssrySHDNYEDTDLDNIDYEDNDAAKAandtgngaekeeIDPLDAFMEGIHeemraapppkpkekLERYKDDDEEDPMESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKkkiepipaldhSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIrvsgfdvprpVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIrsivgqirpdRQTLLFSATMPRKVEKlareilsdpvrVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDvaargldiksIKSVVNFDIARDMDMHVHRigrtgragdkdgtAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGrfrskrdarkgggkkgkgrggagrgvrGVDFGLGIGYTpesnntssqsvpsRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLTGFVSGGSIGGEMSGTQTTSSFSPVSGVNssrvnygesahqknserdrprerrrpsgwdr
MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAKAANDTGNGAEKEEIDPLDAFMEGIHeemraapppkpkeklerykDDDEEDPMESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSkrdarkgggkkgkgrggagrgvrgvdFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLTGFVSGGSIGGEMSGTQTTssfspvsgvnssRVNYGESAHQKNserdrprerrrpsgwdr
*****************************************************************************************************************************************************************VVVEKKKIEPIPALDHSLIDYEPFNKDFYQ************VMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIE**L***GFKA************MEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMEL*********************************VRGVDFGLGIGY**************************************************************FVS**SIGGDVNG**TTGLTGFV********************************************************
******G**********************************************************************DAFME****************************************************************************************PIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDL***************************************************************************************************************************************************************************************
MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEM**********************PMESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRS******************GRGVRGVDFGLGIGYTPE**************AVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLTGFVSGGSIGGEMS**********************************************
*****************S*SF*QS*A**********************************************EIDPLDAFMEGIHEEMRAA************************************************************MLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKD***********************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESFLMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGDVNGTQTTGLTGFVSGGSIGGEMSGTQTTSSFSPVSGVNSSRVNYGESAHQKNSERDRPRERRRPSGWDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query787 2.2.26 [Sep-21-2011]
O22907760 DEAD-box ATP-dependent RN yes no 0.956 0.990 0.741 0.0
Q10MH8770 DEAD-box ATP-dependent RN yes no 0.952 0.974 0.706 0.0
Q5F485 944 ATP-dependent RNA helicas yes no 0.876 0.730 0.438 1e-162
Q810A7 929 ATP-dependent RNA helicas yes no 0.781 0.662 0.472 1e-160
Q7ZY47 947 ATP-dependent RNA helicas N/A no 0.903 0.750 0.425 1e-159
Q5R7D1 942 ATP-dependent RNA helicas yes no 0.787 0.658 0.475 1e-159
Q86XP3 938 ATP-dependent RNA helicas yes no 0.670 0.562 0.521 1e-159
Q54IV3 986 Probable ATP-dependent RN yes no 0.686 0.547 0.492 1e-148
Q84UQ11049 DEAD-box ATP-dependent RN no no 0.709 0.531 0.452 1e-127
Q8H0U81166 DEAD-box ATP-dependent RN no no 0.701 0.473 0.450 1e-126
>sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 Back     alignment and function desciption
 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/792 (74%), Positives = 669/792 (84%), Gaps = 39/792 (4%)

Query: 1   MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAK 60
           M+ RKFG EGF INRQTSYSFE+SQAPQRLYVPPSSR   DN ED DLDNIDY +N+ A+
Sbjct: 1   MSNRKFGMEGFGINRQTSYSFERSQAPQRLYVPPSSR-GGDNSEDADLDNIDYMENEEAE 59

Query: 61  AANDTG-----NGAEKEEIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDDDEEDPMESF 115
              + G     +G E +EIDPLDAFMEGIH+EM++APPPKPKEKLERYKDDD+ DP+ES+
Sbjct: 60  EDIEEGGSAAASGGEVDEIDPLDAFMEGIHQEMKSAPPPKPKEKLERYKDDDD-DPVESY 118

Query: 116 LMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPAL 175
           L AKKD+GLTLAADAL AGY+SDEEVYAAAKAVDAGMLDYDSDDNP+VV+K+KIEPI AL
Sbjct: 119 LKAKKDLGLTLAADALNAGYNSDEEVYAAAKAVDAGMLDYDSDDNPIVVDKRKIEPITAL 178

Query: 176 DHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQ 235
           DHS IDYEP NKDFY++  SISGM+EQ+  +Y++ L IRVSGFDV RPVKTFEDCGFS+Q
Sbjct: 179 DHSSIDYEPINKDFYEELESISGMTEQETTDYRQRLGIRVSGFDVHRPVKTFEDCGFSSQ 238

Query: 236 LMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQK 295
           +M AI KQ YEKPT+IQCQALPI+LSGRD+IGIAKTGSGKTAAFVLPMIVHIMDQPELQ+
Sbjct: 239 IMSAIKKQAYEKPTAIQCQALPIVLSGRDVIGIAKTGSGKTAAFVLPMIVHIMDQPELQR 298

Query: 296 EEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIAT 355
           +EGPIGVICAPTRELAHQI+LE KKF+K++G+RVSAVYGGMSK +QFKELKAGCEIV+AT
Sbjct: 299 DEGPIGVICAPTRELAHQIFLEAKKFSKAYGLRVSAVYGGMSKHEQFKELKAGCEIVVAT 358

Query: 356 PGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPR 415
           PGRLIDMLKMKALTM R +YLVLDEADRMFDLGFEPQ+RSIVGQIRPDRQTLLFSATMP 
Sbjct: 359 PGRLIDMLKMKALTMMRASYLVLDEADRMFDLGFEPQVRSIVGQIRPDRQTLLFSATMPW 418

Query: 416 KVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLV 475
           KVEKLAREILSDP+RVTVGEVGMANEDITQVV+VIPSDAEKLPWLLEKLPGMID+GDVLV
Sbjct: 419 KVEKLAREILSDPIRVTVGEVGMANEDITQVVNVIPSDAEKLPWLLEKLPGMIDEGDVLV 478

Query: 476 FASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLD 535
           FASKK TVDEIE+QL    FK AALHGDKDQASRME LQKFKSGV+HVLIATDVAARGLD
Sbjct: 479 FASKKATVDEIEAQLTLNSFKVAALHGDKDQASRMETLQKFKSGVHHVLIATDVAARGLD 538

Query: 536 IKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQ 595
           IKS+K+VVN+DIA+DMDMHVHRIGRTGRAGD+DG AYTLVTQ+EARFAGELVNSL+AAGQ
Sbjct: 539 IKSLKTVVNYDIAKDMDMHVHRIGRTGRAGDRDGVAYTLVTQREARFAGELVNSLVAAGQ 598

Query: 596 NVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGY-TPESNNTS 654
           NV  EL DLAMKDGRF+SKR   + GGKKG+G GG  +GVRGVDFGLGIG+ +  S   S
Sbjct: 599 NVPPELTDLAMKDGRFKSKR-DGRKGGKKGRGGGGGNKGVRGVDFGLGIGFSSESSRTPS 657

Query: 655 SQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGS 714
           S++ PSRS A+NS++TG+M QF+++FVAA+ + P         AY NKRP+L GFVSGG+
Sbjct: 658 SKAAPSRSGAINSVRTGVMAQFKNSFVAATPSNPQN------QAYPNKRPSLMGFVSGGT 711

Query: 715 IGGDVNGTQTTGLTGFVSGGSIGGEMSGTQTTSSFSPVSGVNSSRVNYGESAHQKNSERD 774
           IGGD+  TQ                       S   PV+   ++  +     H ++SE +
Sbjct: 712 IGGDMGRTQ-----------------------SQAPPVAPTQNASSHNSSQNHSQSSE-N 747

Query: 775 RPRERRRPSGWD 786
           RPRER+R SGWD
Sbjct: 748 RPRERKRRSGWD 759





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 Back     alignment and function description
>sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 Back     alignment and function description
>sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 Back     alignment and function description
>sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 Back     alignment and function description
>sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 Back     alignment and function description
>sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 Back     alignment and function description
>sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 Back     alignment and function description
>sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query787
255548421791 hypothetical protein RCOM_1346600 [Ricin 0.986 0.981 0.823 0.0
224064557807 predicted protein [Populus trichocarpa] 0.996 0.971 0.827 0.0
147821303771 hypothetical protein VITISV_041989 [Viti 0.973 0.993 0.810 0.0
225437591771 PREDICTED: DEAD-box ATP-dependent RNA he 0.973 0.993 0.810 0.0
449469020777 PREDICTED: DEAD-box ATP-dependent RNA he 0.966 0.979 0.793 0.0
357511395775 DEAD-box ATP-dependent RNA helicase [Med 0.973 0.988 0.776 0.0
449484206774 PREDICTED: LOW QUALITY PROTEIN: DEAD-box 0.966 0.983 0.801 0.0
356505639782 PREDICTED: DEAD-box ATP-dependent RNA he 0.974 0.980 0.778 0.0
356572801768 PREDICTED: DEAD-box ATP-dependent RNA he 0.973 0.997 0.790 0.0
18407327760 DEAD-box ATP-dependent RNA helicase 24 [ 0.956 0.990 0.741 0.0
>gi|255548421|ref|XP_002515267.1| hypothetical protein RCOM_1346600 [Ricinus communis] gi|223545747|gb|EEF47251.1| hypothetical protein RCOM_1346600 [Ricinus communis] Back     alignment and taxonomy information
 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/800 (82%), Positives = 712/800 (89%), Gaps = 24/800 (3%)

Query: 1   MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDY-EDNDAA 59
           M+KRKFGFEGF INRQ +Y+FEQSQ PQRLYVPPS+R SHDNYEDTDLD IDY E+N+ A
Sbjct: 1   MSKRKFGFEGFGINRQKTYNFEQSQPPQRLYVPPSTRRSHDNYEDTDLDEIDYAEENENA 60

Query: 60  KAANDTGNGAEKEEIDPLDAFMEGIHEEMRAAPPPKPKEKLERYKDD-DEEDPMESFLMA 118
           K +N      E +EIDPLDAFMEGIHEEM+AAPPPK K+K E+Y+DD D+ DPMESFL A
Sbjct: 61  KESN---GAEENDEIDPLDAFMEGIHEEMKAAPPPKAKDKAEKYRDDEDDNDPMESFLKA 117

Query: 119 KKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHS 178
           KKDVGLTLAADAL AGYDSDEEVYAAAKAVDAG+L+YDSDDNPVV+++KKIEPIP LDHS
Sbjct: 118 KKDVGLTLAADALHAGYDSDEEVYAAAKAVDAGLLEYDSDDNPVVLDRKKIEPIPPLDHS 177

Query: 179 LIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQLMH 238
           LIDYEPFNKDFY++  SISGMSEQDV EY+KSLAIRVSGFDVPRP+K+FEDC FS QLM+
Sbjct: 178 LIDYEPFNKDFYEEKPSISGMSEQDVAEYRKSLAIRVSGFDVPRPIKSFEDCSFSMQLMN 237

Query: 239 AISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEG 298
           AI KQGYEKPTSIQCQALP++LSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEG
Sbjct: 238 AIVKQGYEKPTSIQCQALPVVLSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEG 297

Query: 299 PIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGR 358
           PIGVICAPTRELAHQIYLE KKF+KSHGIRVSAVYGGMSKL+QFKELKAGC+IV+ATPGR
Sbjct: 298 PIGVICAPTRELAHQIYLEAKKFSKSHGIRVSAVYGGMSKLEQFKELKAGCDIVVATPGR 357

Query: 359 LIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVE 418
           LID+LKMKAL MS+ TYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVE
Sbjct: 358 LIDLLKMKALNMSKATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVE 417

Query: 419 KLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFAS 478
           KLAREILSDP+RVTVGEVGMANEDITQVV VIPSDAEKLPWL EKLPGMIDDGDVLVFAS
Sbjct: 418 KLAREILSDPIRVTVGEVGMANEDITQVVQVIPSDAEKLPWLFEKLPGMIDDGDVLVFAS 477

Query: 479 KKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKS 538
           KK TVDEIESQLAQKGFK AALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKS
Sbjct: 478 KKATVDEIESQLAQKGFKVAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKS 537

Query: 539 IKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVS 598
           +KSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTL+TQKEARFAGELVNSLIAAGQNVS
Sbjct: 538 LKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLITQKEARFAGELVNSLIAAGQNVS 597

Query: 599 MELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQSV 658
            ELMDLAMKDGRFRSKRDARKG GKKG+GR G GRGVRGVDFGLGIGY PES++T SQ+V
Sbjct: 598 GELMDLAMKDGRFRSKRDARKGAGKKGRGRAGVGRGVRGVDFGLGIGYNPESSST-SQAV 656

Query: 659 PSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGSIGGD 718
           PSRS AVNS ++GMM QF+S+FVAASSN+       S SAYAN RPALRGFVSGGSIGGD
Sbjct: 657 PSRSTAVNSARSGMMAQFKSSFVAASSNS------QSPSAYANNRPALRGFVSGGSIGGD 710

Query: 719 VNGTQTT-GLTGFVSGGSIGGEMSGTQTTSSF-----------SPVSGVNSSRVNYGESA 766
           +N TQTT  L GFVSGGSI G+ + T+TTSS             P     +++ + G  +
Sbjct: 711 LNITQTTSSLPGFVSGGSISGDANRTRTTSSLPGFVSGGSISGDPNRTQTTTQNSRGNPS 770

Query: 767 HQKNSERDRPRERRRPSGWD 786
               S RDR RERRRPSGWD
Sbjct: 771 QTTESSRDRGRERRRPSGWD 790




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224064557|ref|XP_002301515.1| predicted protein [Populus trichocarpa] gi|222843241|gb|EEE80788.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147821303|emb|CAN74586.1| hypothetical protein VITISV_041989 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225437591|ref|XP_002277419.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Vitis vinifera] gi|297743992|emb|CBI36962.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469020|ref|XP_004152219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357511395|ref|XP_003625986.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355501001|gb|AES82204.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449484206|ref|XP_004156816.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505639|ref|XP_003521597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine max] Back     alignment and taxonomy information
>gi|356572801|ref|XP_003554554.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine max] Back     alignment and taxonomy information
>gi|18407327|ref|NP_566099.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana] gi|75318047|sp|O22907.2|RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24 gi|16323192|gb|AAL15330.1| At2g47330/T8I13.17 [Arabidopsis thaliana] gi|20196880|gb|AAB63833.2| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi|21700913|gb|AAM70580.1| At2g47330/T8I13.17 [Arabidopsis thaliana] gi|330255734|gb|AEC10828.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query787
TAIR|locus:2065215760 AT2G47330 [Arabidopsis thalian 0.908 0.940 0.745 3.5e-288
UNIPROTKB|Q5R7D1 942 DDX42 "ATP-dependent RNA helic 0.870 0.727 0.424 4.9e-142
UNIPROTKB|E1BJD2 946 DDX42 "Uncharacterized protein 0.866 0.720 0.420 4.4e-141
UNIPROTKB|F1NJ40 946 DDX42 "ATP-dependent RNA helic 0.870 0.724 0.426 5.5e-141
ZFIN|ZDB-GENE-050706-53910 ddx42 "DEAD (Asp-Glu-Ala-Asp) 0.872 0.754 0.433 7e-141
UNIPROTKB|E2RFF1 933 DDX42 "Uncharacterized protein 0.839 0.708 0.433 7.1e-141
UNIPROTKB|Q5F485 944 DDX42 "ATP-dependent RNA helic 0.867 0.723 0.428 8.9e-141
DICTYBASE|DDB_G0288501 986 ddx42 "DEAD/DEAH box helicase" 0.888 0.708 0.423 1.5e-140
MGI|MGI:1919297 929 Ddx42 "DEAD (Asp-Glu-Ala-Asp) 0.867 0.735 0.429 1e-139
UNIPROTKB|Q86XP3 938 DDX42 "ATP-dependent RNA helic 0.878 0.736 0.425 5.6e-139
TAIR|locus:2065215 AT2G47330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2722 (963.3 bits), Expect = 3.5e-288, Sum P(2) = 3.5e-288
 Identities = 544/730 (74%), Positives = 612/730 (83%)

Query:     1 MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNIDYEDNDAAK 60
             M+ RKFG EGF INRQTSYSFE+SQAPQRLYVPPSSR   DN ED DLDNIDY +N+ A+
Sbjct:     1 MSNRKFGMEGFGINRQTSYSFERSQAPQRLYVPPSSR-GGDNSEDADLDNIDYMENEEAE 59

Query:    61 AANDTG-----NGAEKEEIDPLDAFMEGIHXXXXXXXXXXXXXXXXXXXDDDEEDPMESF 115
                + G     +G E +EIDPLDAFMEGIH                   DDD+ DP+ES+
Sbjct:    60 EDIEEGGSAAASGGEVDEIDPLDAFMEGIHQEMKSAPPPKPKEKLERYKDDDD-DPVESY 118

Query:   116 LMAKKDVGLTLAADALRAGYDSDEEVYAAAKAVDAGMLDYDSDDNPVVVEKKKIEPIPAL 175
             L AKKD+GLTLAADAL AGY+SDEEVYAAAKAVDAGMLDYDSDDNP+VV+K+KIEPI AL
Sbjct:   119 LKAKKDLGLTLAADALNAGYNSDEEVYAAAKAVDAGMLDYDSDDNPIVVDKRKIEPITAL 178

Query:   176 DHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPVKTFEDCGFSTQ 235
             DHS IDYEP NKDFY++  SISGM+EQ+  +Y++ L IRVSGFDV RPVKTFEDCGFS+Q
Sbjct:   179 DHSSIDYEPINKDFYEELESISGMTEQETTDYRQRLGIRVSGFDVHRPVKTFEDCGFSSQ 238

Query:   236 LMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQK 295
             +M AI KQ YEKPT+IQCQALPI+LSGRD+IGIAKTGSGKTAAFVLPMIVHIMDQPELQ+
Sbjct:   239 IMSAIKKQAYEKPTAIQCQALPIVLSGRDVIGIAKTGSGKTAAFVLPMIVHIMDQPELQR 298

Query:   296 EEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIAT 355
             +EGPIGVICAPTRELAHQI+LE KKF+K++G+RVSAVYGGMSK +QFKELKAGCEIV+AT
Sbjct:   299 DEGPIGVICAPTRELAHQIFLEAKKFSKAYGLRVSAVYGGMSKHEQFKELKAGCEIVVAT 358

Query:   356 PGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPR 415
             PGRLIDMLKMKALTM R +YLVLDEADRMFDLGFEPQ+RSIVGQIRPDRQTLLFSATMP 
Sbjct:   359 PGRLIDMLKMKALTMMRASYLVLDEADRMFDLGFEPQVRSIVGQIRPDRQTLLFSATMPW 418

Query:   416 KVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLV 475
             KVEKLAREILSDP+RVTVGEVGMANEDITQVV+VIPSDAEKLPWLLEKLPGMID+GDVLV
Sbjct:   419 KVEKLAREILSDPIRVTVGEVGMANEDITQVVNVIPSDAEKLPWLLEKLPGMIDEGDVLV 478

Query:   476 FASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLD 535
             FASKK TVDEIE+QL    FK AALHGDKDQASRME LQKFKSGV+HVLIATDVAARGLD
Sbjct:   479 FASKKATVDEIEAQLTLNSFKVAALHGDKDQASRMETLQKFKSGVHHVLIATDVAARGLD 538

Query:   536 IKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQ 595
             IKS+K+VVN+DIA+DMDMHVHRIGRTGRAGD+DG AYTLVTQ+EARFAGELVNSL+AAGQ
Sbjct:   539 IKSLKTVVNYDIAKDMDMHVHRIGRTGRAGDRDGVAYTLVTQREARFAGELVNSLVAAGQ 598

Query:   596 NVSMELMDLAMKDGRFRSXXXXXXXXXXXXXXXXXXXXXXXXXXFGLGIGYTPESNNT-S 654
             NV  EL DLAMKDGRF+S                          FGLGIG++ ES+ T S
Sbjct:   599 NVPPELTDLAMKDGRFKSKRDGRKGGKKGRGGGGGNKGVRGVD-FGLGIGFSSESSRTPS 657

Query:   655 SQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKRPALRGFVSGGS 714
             S++ PSRS A+NS++TG+M QF+++FVAA   TPS   N    AY NKRP+L GFVSGG+
Sbjct:   658 SKAAPSRSGAINSVRTGVMAQFKNSFVAA---TPS---NPQNQAYPNKRPSLMGFVSGGT 711

Query:   715 IGGDVNGTQT 724
             IGGD+  TQ+
Sbjct:   712 IGGDMGRTQS 721


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
UNIPROTKB|Q5R7D1 DDX42 "ATP-dependent RNA helicase DDX42" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJD2 DDX42 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ40 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050706-53 ddx42 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 42" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFF1 DDX42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F485 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288501 ddx42 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1919297 Ddx42 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 42" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XP3 DDX42 "ATP-dependent RNA helicase DDX42" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10MH8RH24_ORYSJ3, ., 6, ., 4, ., 1, 30.70630.95290.9740yesno
O22907RH24_ARATH3, ., 6, ., 4, ., 1, 30.74110.95670.9907yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.979
3rd Layer3.6.40.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query787
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-149
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-144
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-103
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-101
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-92
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-91
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 5e-81
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-81
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-80
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 9e-76
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 8e-72
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-68
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 6e-64
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-60
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-41
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-35
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-26
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-26
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-16
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 4e-16
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 3e-13
COG1205 851 COG1205, COG1205, Distinct helicase family with a 4e-13
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-12
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 3e-10
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 3e-10
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 4e-10
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 1e-07
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-06
PRK09401 1176 PRK09401, PRK09401, reverse gyrase; Reviewed 2e-06
TIGR01054 1171 TIGR01054, rgy, reverse gyrase 4e-06
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, 6e-06
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 1e-05
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-05
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 2e-04
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 8e-04
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 0.002
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 0.003
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication 0.004
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  446 bits (1149), Expect = e-149
 Identities = 216/479 (45%), Positives = 298/479 (62%), Gaps = 24/479 (5%)

Query: 167 KKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIR-VSGFDVPRPVK 225
           K+++PI   D   I+  PF K+FY++   +S +S ++V E +K   I  ++G +VP+PV 
Sbjct: 74  KRLQPI---DWKSINLVPFEKNFYKEHPEVSALSSKEVDEIRKEKEITIIAGENVPKPVV 130

Query: 226 TFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIV 285
           +FE   F   ++ ++   G+ +PT IQ Q  PI LSGRD+IGIA+TGSGKT AF+LP IV
Sbjct: 131 SFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPAIV 190

Query: 286 HIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKEL 345
           HI  QP L+  +GPI ++ APTRELA QI  +  KF  S  IR +  YGG+ K  Q   L
Sbjct: 191 HINAQPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIYAL 250

Query: 346 KAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQ 405
           + G EI+IA PGRLID L+     + RVTYLVLDEADRM D+GFEPQIR IV QIRPDRQ
Sbjct: 251 RRGVEILIACPGRLIDFLESNVTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQ 310

Query: 406 TLLFSATMPRKVEKLAREILSD-PVRVTVGEVGM-ANEDITQVVHVIPSDAEK---LPWL 460
           TL++SAT P++V+ LAR++  + PV V VG + + A  +I Q V V+  + EK   L  L
Sbjct: 311 TLMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVV-EEHEKRGKLKML 369

Query: 461 LEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGV 520
           L+++  M D   +L+F   K   D +  +L   G+ A  +HGDK Q  R  +L +FK+G 
Sbjct: 370 LQRI--MRDGDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVLNEFKTGK 427

Query: 521 YHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEA 580
             ++IATDVA+RGLD+K +K V+NFD    ++ +VHRIGRTGRAG K G +YT +T  + 
Sbjct: 428 SPIMIATDVASRGLDVKDVKYVINFDFPNQIEDYVHRIGRTGRAGAK-GASYTFLTPDKY 486

Query: 581 RFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGVRGVD 639
           R A +LV  L  A Q V  EL  L+ +           +  G + +  GG GR    V+
Sbjct: 487 RLARDLVKVLREAKQPVPPELEKLSNE-----------RSNGTERRRWGGYGRFSNNVN 534


Length = 545

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|236498 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|233251 TIGR01054, rgy, reverse gyrase Back     alignment and domain information
>gnl|CDD|224035 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 787
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
PRK13766773 Hef nuclease; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 99.97
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.97
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.97
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.97
KOG0387923 consensus Transcription-coupled repair protein CSB 99.96
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.96
PRK09694878 helicase Cas3; Provisional 99.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.95
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.95
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.95
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.94
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.94
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.94
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.93
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.93
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.93
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.93
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.92
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.92
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.91
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.91
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.91
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.89
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.89
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.88
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.87
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.87
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.87
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.87
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.87
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.87
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.86
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.86
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.86
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK05298652 excinuclease ABC subunit B; Provisional 99.83
smart00487201 DEXDc DEAD-like helicases superfamily. 99.83
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.83
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.83
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.82
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.82
COG4096 875 HsdR Type I site-specific restriction-modification 99.81
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.79
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.78
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.78
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.77
COG4889 1518 Predicted helicase [General function prediction on 99.76
KOG4439901 consensus RNA polymerase II transcription terminat 99.76
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.75
KOG1123776 consensus RNA polymerase II transcription initiati 99.74
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.73
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.72
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.69
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.69
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.69
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.69
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.67
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.66
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.66
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.65
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.62
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.59
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.57
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.56
smart0049082 HELICc helicase superfamily c-terminal domain. 99.5
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.49
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.48
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.46
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.45
PRK14873665 primosome assembly protein PriA; Provisional 99.44
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.43
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.35
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 99.3
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.28
KOG1001674 consensus Helicase-like transcription factor HLTF/ 99.18
COG0610 962 Type I site-specific restriction-modification syst 99.11
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.07
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.07
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.06
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.05
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 98.97
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.78
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.65
KOG0383696 consensus Predicted helicase [General function pre 98.59
PRK15483 986 type III restriction-modification system StyLTI en 98.3
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.27
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.26
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.14
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 98.12
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.11
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.09
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.08
TIGR00376637 DNA helicase, putative. The gene product may repre 98.03
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.84
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.84
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.77
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.76
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.73
KOG1803649 consensus DNA helicase [Replication, recombination 97.69
PRK10536262 hypothetical protein; Provisional 97.66
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.6
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 97.55
PF13871278 Helicase_C_4: Helicase_C-like 97.39
KOG18051100 consensus DNA replication helicase [Replication, r 97.26
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.19
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.14
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.12
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.07
PRK08181269 transposase; Validated 97.07
KOG1131 755 consensus RNA polymerase II transcription initiati 97.04
PF1324576 AAA_19: Part of AAA domain 97.01
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.95
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.94
PRK04296190 thymidine kinase; Provisional 96.89
PRK14974336 cell division protein FtsY; Provisional 96.82
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.78
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.74
PRK06526254 transposase; Provisional 96.71
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.69
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.69
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.66
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.64
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.61
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.56
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.51
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.42
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.3
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.22
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.11
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.06
PHA02533534 17 large terminase protein; Provisional 96.05
PRK06921266 hypothetical protein; Provisional 96.03
smart00382148 AAA ATPases associated with a variety of cellular 95.99
PRK07952244 DNA replication protein DnaC; Validated 95.94
PRK08116268 hypothetical protein; Validated 95.83
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.81
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.78
PRK05642234 DNA replication initiation factor; Validated 95.77
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.74
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.71
PRK06893229 DNA replication initiation factor; Validated 95.59
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.46
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 95.41
PRK08084235 DNA replication initiation factor; Provisional 95.4
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.37
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.34
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 95.34
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 95.32
PRK08727233 hypothetical protein; Validated 95.31
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.22
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.21
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.2
PRK11054684 helD DNA helicase IV; Provisional 95.16
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.11
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.07
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.97
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.96
PRK00149450 dnaA chromosomal replication initiation protein; R 94.94
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.89
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.85
PRK06835329 DNA replication protein DnaC; Validated 94.84
PRK12377248 putative replication protein; Provisional 94.83
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 94.79
PRK14087450 dnaA chromosomal replication initiation protein; P 94.78
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.73
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.73
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 94.65
PHA02544316 44 clamp loader, small subunit; Provisional 94.54
PRK14086617 dnaA chromosomal replication initiation protein; P 94.52
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 94.52
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.47
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.39
KOG02981394 consensus DEAD box-containing helicase-like transc 94.36
TIGR00064272 ftsY signal recognition particle-docking protein F 94.34
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.34
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 94.25
PRK00771437 signal recognition particle protein Srp54; Provisi 94.21
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.21
PTZ001121164 origin recognition complex 1 protein; Provisional 94.18
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.15
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.11
PRK05580 679 primosome assembly protein PriA; Validated 94.01
PRK12422445 chromosomal replication initiation protein; Provis 93.95
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.94
PRK05707328 DNA polymerase III subunit delta'; Validated 93.87
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.8
PF13173128 AAA_14: AAA domain 93.8
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.71
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.71
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.69
PRK12402337 replication factor C small subunit 2; Reviewed 93.68
PRK09183259 transposase/IS protein; Provisional 93.67
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.62
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.57
PRK08769319 DNA polymerase III subunit delta'; Validated 93.52
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.51
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.49
TIGR00643630 recG ATP-dependent DNA helicase RecG. 93.44
PRK14088440 dnaA chromosomal replication initiation protein; P 93.4
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 93.39
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 93.38
PLN03025319 replication factor C subunit; Provisional 93.38
PHA03333752 putative ATPase subunit of terminase; Provisional 93.37
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.29
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 93.17
PRK04195482 replication factor C large subunit; Provisional 93.16
PTZ00293211 thymidine kinase; Provisional 93.12
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.11
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 93.11
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.09
PF00004132 AAA: ATPase family associated with various cellula 93.09
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.03
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.02
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.96
PRK08939306 primosomal protein DnaI; Reviewed 92.85
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 92.83
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.81
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 92.71
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.7
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.69
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 92.66
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 92.63
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.62
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 92.62
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.61
PRK13342413 recombination factor protein RarA; Reviewed 92.59
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.57
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.51
PRK13833323 conjugal transfer protein TrbB; Provisional 92.39
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 92.37
COG0593408 DnaA ATPase involved in DNA replication initiation 92.1
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.01
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.94
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.88
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.88
COG3973747 Superfamily I DNA and RNA helicases [General funct 91.85
PRK09112351 DNA polymerase III subunit delta'; Validated 91.78
PRK13341 725 recombination factor protein RarA/unknown domain f 91.78
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.75
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.73
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 91.7
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.66
PRK10867433 signal recognition particle protein; Provisional 91.65
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.6
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 91.6
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 91.59
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.59
COG4626546 Phage terminase-like protein, large subunit [Gener 91.57
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 91.48
KOG2028554 consensus ATPase related to the helicase subunit o 91.41
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.41
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 91.38
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 91.37
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 91.29
COG1200677 RecG RecG-like helicase [DNA replication, recombin 91.28
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 91.23
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 91.14
CHL00181287 cbbX CbbX; Provisional 91.14
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 91.12
PRK14873 665 primosome assembly protein PriA; Provisional 91.05
cd03115173 SRP The signal recognition particle (SRP) mediates 91.02
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 90.9
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 90.88
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 90.82
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 90.76
PRK10689 1147 transcription-repair coupling factor; Provisional 90.68
COG3972660 Superfamily I DNA and RNA helicases [General funct 90.67
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 90.65
TIGR00959428 ffh signal recognition particle protein. This mode 90.63
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 90.62
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 90.58
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 90.44
PHA00729226 NTP-binding motif containing protein 90.4
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.35
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 90.29
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 90.12
PRK00440319 rfc replication factor C small subunit; Reviewed 90.09
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 90.07
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 90.01
PRK07940394 DNA polymerase III subunit delta'; Validated 89.91
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 89.87
PF05729166 NACHT: NACHT domain 89.84
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.78
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 89.67
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 89.67
PRK10416318 signal recognition particle-docking protein FtsY; 89.57
PHA03372668 DNA packaging terminase subunit 1; Provisional 89.46
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 89.42
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.42
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.29
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 89.21
PRK11823446 DNA repair protein RadA; Provisional 89.2
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 89.1
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 89.09
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.07
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 89.05
PHA00012361 I assembly protein 89.02
PRK13851344 type IV secretion system protein VirB11; Provision 89.01
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 88.98
PRK04841 903 transcriptional regulator MalT; Provisional 88.96
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 88.75
PRK06871325 DNA polymerase III subunit delta'; Validated 88.72
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 88.6
COG1198 730 PriA Primosomal protein N' (replication factor Y) 88.55
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 88.54
PRK05973237 replicative DNA helicase; Provisional 88.5
PRK07471365 DNA polymerase III subunit delta'; Validated 88.5
PRK06964342 DNA polymerase III subunit delta'; Validated 88.31
COG0552340 FtsY Signal recognition particle GTPase [Intracell 88.23
cd03239178 ABC_SMC_head The structural maintenance of chromos 88.19
KOG2543438 consensus Origin recognition complex, subunit 5 [R 88.17
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 88.13
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 88.11
PRK08699325 DNA polymerase III subunit delta'; Validated 88.11
PRK06067234 flagellar accessory protein FlaH; Validated 88.07
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 88.03
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 87.99
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 87.93
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 87.89
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 87.89
PRK10865 857 protein disaggregation chaperone; Provisional 87.78
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 87.77
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 87.7
cd01128249 rho_factor Transcription termination factor rho is 87.45
PRK06904472 replicative DNA helicase; Validated 87.44
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 87.43
PRK13764602 ATPase; Provisional 87.32
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 86.94
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 86.92
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 86.91
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 86.6
KOG0745564 consensus Putative ATP-dependent Clp-type protease 86.4
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 86.37
PRK07993334 DNA polymerase III subunit delta'; Validated 86.34
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 86.26
CHL00095821 clpC Clp protease ATP binding subunit 86.18
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 86.14
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 86.04
COG1485367 Predicted ATPase [General function prediction only 86.04
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 85.86
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 85.73
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.65
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 85.58
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 85.49
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 85.42
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 85.38
PRK13897606 type IV secretion system component VirD4; Provisio 85.36
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 85.32
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 85.27
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 85.23
PRK04328249 hypothetical protein; Provisional 85.09
TIGR00767415 rho transcription termination factor Rho. Members 85.08
PRK07399314 DNA polymerase III subunit delta'; Validated 85.02
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 85.0
PRK06090319 DNA polymerase III subunit delta'; Validated 84.99
TIGR00665434 DnaB replicative DNA helicase. This model describe 84.88
PRK10436462 hypothetical protein; Provisional 84.82
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 84.7
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 84.6
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 84.59
PRK06620214 hypothetical protein; Validated 84.19
KOG3973465 consensus Uncharacterized conserved glycine-rich p 84.13
PRK08506472 replicative DNA helicase; Provisional 84.11
PRK03992389 proteasome-activating nucleotidase; Provisional 84.07
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 83.79
PRK05748448 replicative DNA helicase; Provisional 83.75
PRK08840464 replicative DNA helicase; Provisional 83.48
PRK08760476 replicative DNA helicase; Provisional 83.44
PRK07004460 replicative DNA helicase; Provisional 83.44
PRK07413382 hypothetical protein; Validated 83.33
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 83.3
PHA00350399 putative assembly protein 83.2
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 82.88
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 82.87
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 82.86
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 82.71
PRK09376416 rho transcription termination factor Rho; Provisio 82.7
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 82.41
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 82.36
PF12846304 AAA_10: AAA-like domain 82.35
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 82.3
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 82.16
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 81.9
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 81.77
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 81.75
PRK08006471 replicative DNA helicase; Provisional 81.74
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 81.66
TIGR02012321 tigrfam_recA protein RecA. This model describes or 81.64
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 81.6
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 81.59
TIGR00763775 lon ATP-dependent protease La. This protein is ind 81.54
PRK05636505 replicative DNA helicase; Provisional 81.49
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 81.46
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 81.42
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 81.24
PRK14701 1638 reverse gyrase; Provisional 81.22
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 81.2
CHL00176638 ftsH cell division protein; Validated 81.18
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 81.11
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 80.96
PRK06321472 replicative DNA helicase; Provisional 80.83
PRK13850670 type IV secretion system protein VirD4; Provisiona 80.72
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 80.65
PRK07413382 hypothetical protein; Validated 80.44
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 80.32
COG2255332 RuvB Holliday junction resolvasome, helicase subun 80.29
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=3.6e-126  Score=1001.46  Aligned_cols=697  Identities=60%  Similarity=0.921  Sum_probs=626.6

Q ss_pred             CCCccccccccccccccccccccccCCcccccCCCCCCCCCCCCCCCccCcc----cccchhhhhcCCCCCCCCCccCCc
Q 003910            1 MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRYSHDNYEDTDLDNID----YEDNDAAKAANDTGNGAEKEEIDP   76 (787)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~k~~~~~~d~~~~~----~~ddde~~~~~~~~~~~~eee~d~   76 (787)
                      |+.|+|||+||+.+++.+|+|+++++|+++|+|+|++++- +-++.+-+.++    +||||.....+......+.+|+||
T Consensus         1 l~~r~~g~~g~~rn~~ts~~~e~s~~~~~~y~~~s~yg~~-~~~~~~rk~i~ddey~eddd~p~~~s~~~a~~~~de~d~   79 (731)
T KOG0339|consen    1 LSNRKFGMEGFGRNRQTSYSFERSQAPQRLYVPPSSYGGD-NSEDADRKNIDDDEYEEDDDIPEGGSAAAAGGEVDEIDP   79 (731)
T ss_pred             CCccCCCCCCCCcCcccccchhhhcCccceecChhhcCCC-chhhhhhhcccccccccccccccccchhhccCCCCCCCC
Confidence            7899999999999999999999999999999999998874 22222222222    222232223333445567788999


Q ss_pred             hhHHhhhhHHHhhcCCCCCCcccccccC------------CCCCCChhHHHHHhhhhcCchhhhhhhccCCCChHHHHHH
Q 003910           77 LDAFMEGIHEEMRAAPPPKPKEKLERYK------------DDDEEDPMESFLMAKKDVGLTLAADALRAGYDSDEEVYAA  144 (787)
Q Consensus        77 ~d~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~e~d~~e~~~~~~~~~~~~~~~~~~~~g~~~~ee~~~~  144 (787)
                      +|+||+.+++++++.+++..+++.+..+            |.++++..|.+++|+.+.        ..+         ..
T Consensus        80 ldafMA~~~d~~~sd~~~~e~kk~eRkn~dd~~p~~~vr~dI~~e~aae~~~kym~e~--------k~~---------~~  142 (731)
T KOG0339|consen   80 LDAFMAKIEDQAQSDKKPLEQKKKERKNDDDDDPTATVRADIDEEDAAEALFKYMSEN--------KRA---------GA  142 (731)
T ss_pred             cchhhhhhhhhhhccCCccchHHHhhhccCCCccchhhhcchhhHHhHHHHHHHhhhc--------ccc---------hh
Confidence            9999999999998877555444333333            233445556666665332        112         22


Q ss_pred             HhhhhcCCCCCCCCCChhhhhhhccCCCCCCCCCccccCccccccccCCccccCCCHHHHHHHHHHcCceeccCCCCCcc
Q 003910          145 AKAVDAGMLDYDSDDNPVVVEKKKIEPIPALDHSLIDYEPFNKDFYQDSASISGMSEQDVMEYKKSLAIRVSGFDVPRPV  224 (787)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~k~fy~~~~~i~~~s~~~~~~~~~~~~i~v~g~~~P~pi  224 (787)
                      +++.+...++|+++++++...|+.++|+++++|+.|+|+||+++||.+|+.|..|+..++..++..+++++.|...|+|+
T Consensus       143 ~~e~~~~~leydsd~nPi~~~kr~idpl~~idhs~i~y~p~~kdfy~e~esI~gl~~~d~~~~r~~Lnlrv~g~s~~rpv  222 (731)
T KOG0339|consen  143 AKECDDMCLEYDSDGNPIAPDKRQIDPLPPIDHSEIDYEPFNKDFYEEHESIEGLTKMDVIDLRLTLNLRVSGSSPPRPV  222 (731)
T ss_pred             hhhcccceeecCCCCCccCcccccCCCCCCcchhhccccccccccccChhhhhccccccchhhHhhhcceeccCCCCCCc
Confidence            34556678999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCHHHHHHHHHCCCCCCcHHHHHHHHHHHcCCCEEEEccCCCchhHHHHHHHHHHHhcCcccccCCCCEEEEE
Q 003910          225 KTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPIGVIC  304 (787)
Q Consensus       225 ~sf~~~~l~~~l~~~l~~~g~~~ptp~Q~~ai~~il~grdvii~a~TGsGKTla~llp~l~~l~~~~~~~~~~~p~vLIl  304 (787)
                      ++|++++|+..|+.++.+..|++|||+|+++||..++|+|+|.+|.||||||.+|++|++.|+++++.+...++|+.|||
T Consensus       223 tsfeh~gfDkqLm~airk~Ey~kptpiq~qalptalsgrdvigIAktgSgktaAfi~pm~~himdq~eL~~g~gPi~vil  302 (731)
T KOG0339|consen  223 TSFEHFGFDKQLMTAIRKSEYEKPTPIQCQALPTALSGRDVIGIAKTGSGKTAAFIWPMIVHIMDQPELKPGEGPIGVIL  302 (731)
T ss_pred             chhhhcCchHHHHHHHhhhhcccCCcccccccccccccccchheeeccCcchhHHHHHHHHHhcchhhhcCCCCCeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcHHHHHHHHHHHHHHhhhcCceEEEEECCCChHHHHHHHhcCCcEEEeCHHHHHHHHHhccccccceeEEEEechhhh
Q 003910          305 APTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRM  384 (787)
Q Consensus       305 ~PtreLa~Qi~~~~~~~~~~~~i~v~~~~gg~~~~~~~~~l~~~~dIIV~Tp~~L~~~l~~~~~~l~~i~~lViDEah~m  384 (787)
                      ||||+||.||+.++++|++.++++++++|||.+.++|+..|+.++.||||||+||++++..+.++|.+++|||||||++|
T Consensus       303 vPTrela~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~k~Lk~g~EivVaTPgRlid~VkmKatn~~rvS~LV~DEadrm  382 (731)
T KOG0339|consen  303 VPTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSKELKEGAEIVVATPGRLIDMVKMKATNLSRVSYLVLDEADRM  382 (731)
T ss_pred             eccHHHHHHHHHHHHHhhhhccceEEEeecCCcHHHHHHhhhcCCeEEEechHHHHHHHHhhcccceeeeEEEEechhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCChHHHHHHhhhcCCCceEEEEeccCcHHHHHHHHHHhCCCeEEEecccccccccceEEEEecCCCcchHHHHHHhc
Q 003910          385 FDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVVHVIPSDAEKLPWLLEKL  464 (787)
Q Consensus       385 ~~~~f~~~i~~il~~~~~~~q~ll~SAT~~~~v~~l~~~~l~~p~~i~v~~~~~~~~~i~q~~~~~~~~~~k~~~L~~~L  464 (787)
                      +++||+++++.|..+++|++|+|+||||++..++.+++.+|.+|+.+..+.++..+.+|+|.+.++++...|+.||+..|
T Consensus       383 fdmGfe~qVrSI~~hirpdrQtllFsaTf~~kIe~lard~L~dpVrvVqg~vgean~dITQ~V~V~~s~~~Kl~wl~~~L  462 (731)
T KOG0339|consen  383 FDMGFEPQVRSIKQHIRPDRQTLLFSATFKKKIEKLARDILSDPVRVVQGEVGEANEDITQTVSVCPSEEKKLNWLLRHL  462 (731)
T ss_pred             hccccHHHHHHHHhhcCCcceEEEeeccchHHHHHHHHHHhcCCeeEEEeehhccccchhheeeeccCcHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCEEEEecccccHHHHHHHHHHcCCceeeccCCCCHHHHHHHHHHhhcCCccEEEEehhhhccCCCCCccEEEE
Q 003910          465 PGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVN  544 (787)
Q Consensus       465 ~~~~~~~kvLVF~~s~~~a~~l~~~L~~~g~~v~~lhg~~~~~eR~~~l~~F~~G~~~VLVaT~v~~rGlDip~v~~VI~  544 (787)
                      ......|++|||+..+..++.|+..|+..++.|..+||+|+|.+|.++|..|+.+.+.|||+|++++|||||+.+.+|||
T Consensus       463 ~~f~S~gkvlifVTKk~~~e~i~a~Lklk~~~v~llhgdkdqa~rn~~ls~fKkk~~~VlvatDvaargldI~~ikTVvn  542 (731)
T KOG0339|consen  463 VEFSSEGKVLIFVTKKADAEEIAANLKLKGFNVSLLHGDKDQAERNEVLSKFKKKRKPVLVATDVAARGLDIPSIKTVVN  542 (731)
T ss_pred             hhhccCCcEEEEEeccCCHHHHHHHhccccceeeeecCchhhHHHHHHHHHHhhcCCceEEEeeHhhcCCCccccceeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCHHHHHHHhhccCCCCCCCcEEEEEEccccHHHHHHHHHHHHHcCCCccHHHHHHHHhcCcccccccccCCCCCC
Q 003910          545 FDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKK  624 (787)
Q Consensus       545 ~d~p~s~~~y~QriGR~gR~G~~~G~~i~l~~~~d~~~~~~l~~~l~~~~~~vp~~l~~~a~~~~~~~~~~~~r~~g~~~  624 (787)
                      ||+..+++.|+|||||+||+|. .|++|+|+++.|..++..|++.|+.++|.||++|++|+++.+|||.+|.++++|+++
T Consensus       543 yD~ardIdththrigrtgRag~-kGvayTlvTeKDa~fAG~LVnnLe~agQnVP~~l~dlamk~s~fr~~r~~~g~gk~~  621 (731)
T KOG0339|consen  543 YDFARDIDTHTHRIGRTGRAGE-KGVAYTLVTEKDAEFAGHLVNNLEGAGQNVPDELMDLAMKSSWFRSSRFGRGGGKKG  621 (731)
T ss_pred             ccccchhHHHHHHhhhcccccc-cceeeEEechhhHHHhhHHHHHHhhccccCChHHHHHHhhhhhhhhhhccCCCCCCC
Confidence            9999999999999999999995 599999999999999999999999999999999999999999999999888777654


Q ss_pred             CCCCCCCCCCCCCcccCCCCCCCCCCCCCCCC-CCCCcchhhhhHHHHHHHhhhccccccCCCCCCCCCCCCcCccCCCC
Q 003910          625 GKGRGGAGRGVRGVDFGLGIGYTPESNNTSSQ-SVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNSASAYANKR  703 (787)
Q Consensus       625 g~g~gggg~g~rg~~~g~g~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  703 (787)
                      .+  +|||.|.|+.+ |+|+++.+++++++++ ..|++|....+|++||++||+++||||+.|+++..      +++++|
T Consensus       622 ~~--~~gglgyr~~~-g~g~~~~g~~~~t~~~a~~ps~~gr~~~~r~af~~q~~~~f~a~t~sn~~~q------~~~~~~  692 (731)
T KOG0339|consen  622 TG--GGGGLGYREKD-GLGIGFRGGSNRTPSSAASPSTSGRITAMRTAFQSQFKNSFVAATPSNPPNQ------AAPKKR  692 (731)
T ss_pred             CC--CCCCcccccCC-CCCccccCCCCcCcccccCCCcchhHHHHHHHHHHHhhhheeccCCCCCccc------cccCCC
Confidence            43  33477888876 8888899998888876 35666668899999999999999999998876643      489999


Q ss_pred             CccccccccccccCCCCCccccCc
Q 003910          704 PALRGFVSGGSIGGDVNGTQTTGL  727 (787)
Q Consensus       704 ~~~~~~~~~~~~~~~~~~~~~~~~  727 (787)
                      |.+.  +||+.|++.+.++|.++.
T Consensus       693 p~~~--v~~~~~~~~~~~~q~~s~  714 (731)
T KOG0339|consen  693 PELG--VSGAPIGGPSARTQGQSA  714 (731)
T ss_pred             Cccc--eecCccCCcchhccccCC
Confidence            9998  999999999988886544



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query787
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 6e-82
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 4e-80
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 6e-69
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-65
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 3e-57
2hyi_C413 Structure Of The Human Exon Junction Complex With A 5e-56
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 6e-56
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-56
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 7e-56
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-55
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-55
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 1e-49
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-49
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 7e-49
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 1e-48
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-48
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-44
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 7e-44
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 9e-44
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 9e-44
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 4e-43
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 5e-43
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 6e-43
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-42
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-40
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 8e-40
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 9e-40
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-39
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-39
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 1e-39
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 7e-39
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-38
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 5e-38
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 9e-38
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-37
3ly5_A262 Ddx18 Dead-Domain Length = 262 5e-31
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-30
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-29
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-28
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 3e-28
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-27
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 4e-27
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 5e-27
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-26
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 2e-26
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 1e-25
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-22
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 1e-21
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 4e-20
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 7e-19
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-18
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 2e-18
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-17
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 5e-15
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 6e-15
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 7e-15
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-14
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 2e-12
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 2e-12
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 3e-12
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-11
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 7e-11
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-10
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 5e-10
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 9e-10
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 9e-10
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 9e-10
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 2e-07
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 3e-07
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 6e-06
3tmi_A 695 Structural Basis For Rna Recognition And Activation 7e-05
2ykg_A 696 Structural Insights Into Rna Recognition By Rig-I L 8e-05
4ay2_A 687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 8e-05
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 1e-04
1t5l_A658 Crystal Structure Of The Dna Repair Protein Uvrb Po 6e-04
2fdc_A658 Structural Basis Of Dna Damage Recognition And Proc 6e-04
3uwx_B683 Crystal Structure Of Uvra-Uvrb Complex Length = 683 6e-04
1d9x_A658 Crystal Structure Of The Dna Repair Protein Uvrb Le 6e-04
1d9z_A657 Crystal Structure Of The Dna Repair Protein Uvrb In 6e-04
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Iteration: 1

Score = 302 bits (773), Expect = 6e-82, Method: Compositional matrix adjust. Identities = 168/410 (40%), Positives = 246/410 (60%), Gaps = 19/410 (4%) Query: 213 IRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTG 272 + +G + P +++F D +M I Y +PT +Q A+PII RD++ A+TG Sbjct: 3 VEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTG 62 Query: 273 SGKTAAFVLPMIVHIM-DQP----ELQKEEG--------PIGVICAPTRELAHQIYLETK 319 SGKTAAF+LP++ I D P KE G PI ++ APTRELA QIY E + Sbjct: 63 SGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEAR 122 Query: 320 KFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLD 379 KF+ +R VYGG Q ++L+ GC +++ATPGRL+DM++ + + YLVLD Sbjct: 123 KFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLD 182 Query: 380 EADRMFDLGFEPQIRSIVGQ--IRPD--RQTLLFSATMPRKVEKLAREILSDPVRVTVGE 435 EADRM D+GFEPQIR IV Q + P R T++FSAT P++++ LAR+ L + + + VG Sbjct: 183 EADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGR 242 Query: 436 VGMANEDITQVVHVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGF 495 VG +E+ITQ V V +++K +LL+ L D LVF K D +E L +G+ Sbjct: 243 VGSTSENITQKV-VWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGY 301 Query: 496 KAAALHGDKDQASRMEILQKFKSGVYHVLIATDVAARGLDIKSIKSVVNFDIARDMDMHV 555 ++HGD+ Q R E L +F+SG +L+AT VAARGLDI ++K V+NFD+ D++ +V Sbjct: 302 ACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYV 361 Query: 556 HRIGRTGRAGDKDGTAYTLVTQKEARFAGELVNSLIAAGQNVSMELMDLA 605 HRIGRTGR G+ G A + ++ +L++ L+ A Q V L ++A Sbjct: 362 HRIGRTGRVGNL-GLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMA 410
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 Back     alignment and structure
>pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 Back     alignment and structure
>pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 Back     alignment and structure
>pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 Back     alignment and structure
>pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query787
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3jux_A822 Protein translocase subunit SECA; protein transloc 99.98
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.97
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.95
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.95
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.94
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.92
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.91
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.89
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.89
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.88
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.88
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.8
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.85
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.85
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.77
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.76
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.74
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.83
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.28
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.08
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.05
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.97
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.96
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.96
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.94
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.92
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.12
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.87
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.17
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.08
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.93
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.76
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.75
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.74
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.63
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.28
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.21
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.11
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.9
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.79
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.71
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.69
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.65
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.55
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.54
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.47
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.44
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.04
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.83
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.78
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.74
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.72
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 93.56
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 93.5
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.33
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.27
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.26
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.02
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.02
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 92.91
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.62
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.39
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.38
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.17
2qgz_A308 Helicase loader, putative primosome component; str 92.14
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.0
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.85
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 91.78
3bos_A242 Putative DNA replication factor; P-loop containing 91.62
3co5_A143 Putative two-component system transcriptional RES 91.49
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.38
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 91.36
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 90.97
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 90.85
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 90.11
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 89.73
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 89.71
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 89.62
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 89.6
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 89.44
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 89.34
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.19
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 89.02
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 88.96
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 88.71
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 88.0
2fna_A357 Conserved hypothetical protein; structural genomic 87.76
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.51
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.49
2r6a_A454 DNAB helicase, replicative helicase; replication, 87.46
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 87.0
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 86.93
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 86.88
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.87
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 86.77
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 86.72
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 86.53
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.49
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 86.45
3pvs_A447 Replication-associated recombination protein A; ma 85.81
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 85.33
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 85.19
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 84.98
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 84.9
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 84.82
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 84.73
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 84.53
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 84.48
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 84.48
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 83.7
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 83.47
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 83.43
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 83.38
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 83.34
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 83.31
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.29
3bor_A237 Human initiation factor 4A-II; translation initiat 83.02
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 82.66
2gno_A305 DNA polymerase III, gamma subunit-related protein; 82.49
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 82.45
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 82.37
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 82.12
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 82.1
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 81.28
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 81.11
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 80.86
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 80.62
1vma_A306 Cell division protein FTSY; TM0570, structural gen 80.42
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 80.41
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 80.4
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 80.1
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 80.08
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=2e-66  Score=587.69  Aligned_cols=390  Identities=41%  Similarity=0.688  Sum_probs=361.6

Q ss_pred             HcCceeccCCCCCccCCccccCCCHHHHHHHHHCCCCCCcHHHHHHHHHHHcCCCEEEEccCCCchhHHHHHHHHHHHhc
Q 003910          210 SLAIRVSGFDVPRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMD  289 (787)
Q Consensus       210 ~~~i~v~g~~~P~pi~sf~~~~l~~~l~~~l~~~g~~~ptp~Q~~ai~~il~grdvii~a~TGsGKTla~llp~l~~l~~  289 (787)
                      ...+.+.|.++|.|+.+|++++|++.++++|.+.||.+|||+|.++||.+++++|+|++++||||||++|++|++.+++.
T Consensus        41 ~~~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~  120 (434)
T 2db3_A           41 NIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLE  120 (434)
T ss_dssp             GSCEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHH
T ss_pred             CceeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHh
Confidence            44678899999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CcccccCCCCEEEEEcCcHHHHHHHHHHHHHHhhhcCceEEEEECCCChHHHHHHHhcCCcEEEeCHHHHHHHHHhcccc
Q 003910          290 QPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALT  369 (787)
Q Consensus       290 ~~~~~~~~~p~vLIl~PtreLa~Qi~~~~~~~~~~~~i~v~~~~gg~~~~~~~~~l~~~~dIIV~Tp~~L~~~l~~~~~~  369 (787)
                      .+......++++|||+|||+||.||++++++++...++++.+++||.....+...+..+++|+|+||++|++++.+..+.
T Consensus       121 ~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~  200 (434)
T 2db3_A          121 DPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFIT  200 (434)
T ss_dssp             SCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCC
T ss_pred             cccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcc
Confidence            65433455789999999999999999999999988889999999999998888888889999999999999999988888


Q ss_pred             ccceeEEEEechhhhhcCCChHHHHHHhhhc--CCCceEEEEeccCcHHHHHHHHHHhCCCeEEEecccccccccceEEE
Q 003910          370 MSRVTYLVLDEADRMFDLGFEPQIRSIVGQI--RPDRQTLLFSATMPRKVEKLAREILSDPVRVTVGEVGMANEDITQVV  447 (787)
Q Consensus       370 l~~i~~lViDEah~m~~~~f~~~i~~il~~~--~~~~q~ll~SAT~~~~v~~l~~~~l~~p~~i~v~~~~~~~~~i~q~~  447 (787)
                      +.++++|||||||+|++++|...+..++..+  ++.+|+++||||+|+.+..++..++.++..+.++........+.+.+
T Consensus       201 l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~  280 (434)
T 2db3_A          201 FEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTI  280 (434)
T ss_dssp             CTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEE
T ss_pred             cccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEE
Confidence            9999999999999999999999999999875  67899999999999999999999999999999988877788888888


Q ss_pred             EecCCCcchHHHHHHhcCCcCCCCCEEEEecccccHHHHHHHHHHcCCceeeccCCCCHHHHHHHHHHhhcCCccEEEEe
Q 003910          448 HVIPSDAEKLPWLLEKLPGMIDDGDVLVFASKKTTVDEIESQLAQKGFKAAALHGDKDQASRMEILQKFKSGVYHVLIAT  527 (787)
Q Consensus       448 ~~~~~~~~k~~~L~~~L~~~~~~~kvLVF~~s~~~a~~l~~~L~~~g~~v~~lhg~~~~~eR~~~l~~F~~G~~~VLVaT  527 (787)
                      ..+. ...|...|+++|...  ..++||||+++..++.+++.|...++.+..+||++++.+|..+++.|++|+.+|||||
T Consensus       281 ~~~~-~~~k~~~l~~~l~~~--~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT  357 (434)
T 2db3_A          281 YEVN-KYAKRSKLIEILSEQ--ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT  357 (434)
T ss_dssp             EECC-GGGHHHHHHHHHHHC--CTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEEC
T ss_pred             EEeC-cHHHHHHHHHHHHhC--CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEc
Confidence            7764 456778888877654  3459999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccCCCCCccEEEEecCCCCHHHHHHHhhccCCCCCCCcEEEEEEcc-ccHHHHHHHHHHHHHcCCCccHHHHH
Q 003910          528 DVAARGLDIKSIKSVVNFDIARDMDMHVHRIGRTGRAGDKDGTAYTLVTQ-KEARFAGELVNSLIAAGQNVSMELMD  603 (787)
Q Consensus       528 ~v~~rGlDip~v~~VI~~d~p~s~~~y~QriGR~gR~G~~~G~~i~l~~~-~d~~~~~~l~~~l~~~~~~vp~~l~~  603 (787)
                      +++++|||+|++++||+||+|+++.+|+||+||+||.| +.|.|++|+++ ++...+.++++.|..+++.||++|.+
T Consensus       358 ~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g-~~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp~~l~~  433 (434)
T 2db3_A          358 SVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVG-NNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRT  433 (434)
T ss_dssp             GGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTT-CCEEEEEEECTTTCGGGHHHHHHHHHHTTCCCCGGGC-
T ss_pred             hhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCC-CCCEEEEEEeccccHHHHHHHHHHHHHcCCCCCHHHHh
Confidence            99999999999999999999999999999999999999 68999999994 57889999999999999999999865



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 787
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-62
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-60
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 3e-56
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 3e-56
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-55
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-50
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 2e-49
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 9e-49
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-43
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-42
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-37
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 2e-31
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-30
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 5e-30
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 4e-25
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-22
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 4e-22
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 4e-21
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 6e-21
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 6e-18
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-15
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 9e-15
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-13
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 1e-11
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 2e-11
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 4e-11
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-09
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-07
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 7e-05
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 1e-04
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 2e-04
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 3e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 8e-04
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  204 bits (521), Expect = 8e-62
 Identities = 74/209 (35%), Positives = 120/209 (57%), Gaps = 8/209 (3%)

Query: 226 TFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGR-DIIGIAKTGSGKTAAFVLPMI 284
            F +   S  +++AI  +G+EKPT IQ + +P+ L+   +I+  A+TGSGKTA+F +P+I
Sbjct: 5   NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64

Query: 285 VHIMDQPELQKEEGPIGVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKE 344
             + +        G   +I  PTRELA Q+  E +    +  ++++ +YGG +   Q K 
Sbjct: 65  ELVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKA 118

Query: 345 LKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDEADRMFDLGFEPQIRSIVGQIRPDR 404
           LK    IV+ TPGR++D +    L +  V Y +LDEAD M ++GF   +  I+     D+
Sbjct: 119 LK-NANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDK 177

Query: 405 QTLLFSATMPRKVEKLAREILSDPVRVTV 433
           + LLFSATMPR++  LA++ + D   +  
Sbjct: 178 RILLFSATMPREILNLAKKYMGDYSFIKA 206


>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query787
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.98
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.94
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.93
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.92
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.92
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.88
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.88
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.82
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.77
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.76
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.74
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.7
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.7
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.68
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.68
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.67
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.66
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.65
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.63
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.56
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.55
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.54
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.51
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.39
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.24
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.09
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.56
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.52
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.38
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.0
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.98
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.43
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.99
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.82
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.65
d2qy9a2211 GTPase domain of the signal recognition particle r 95.61
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.45
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 95.32
d1vmaa2213 GTPase domain of the signal recognition particle r 95.21
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.07
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.02
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.88
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.48
d1okkd2207 GTPase domain of the signal recognition particle r 94.45
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 94.27
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.18
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 94.1
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.04
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.56
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.27
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.07
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.32
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.15
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.05
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 91.97
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.81
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.44
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.92
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 90.85
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 89.45
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.38
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 89.34
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 89.28
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 89.27
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.5
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.34
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 88.19
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 86.09
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 85.91
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 85.72
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 85.05
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.4
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 83.94
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 83.93
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 82.95
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 82.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.84
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 80.78
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.2e-41  Score=342.60  Aligned_cols=209  Identities=33%  Similarity=0.573  Sum_probs=198.3

Q ss_pred             CCccCCccccCCCHHHHHHHHHCCCCCCcHHHHHHHHHHHcCCCEEEEccCCCchhHHHHHHHHHHHhcCcccccCCCCE
Q 003910          221 PRPVKTFEDCGFSTQLMHAISKQGYEKPTSIQCQALPIILSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELQKEEGPI  300 (787)
Q Consensus       221 P~pi~sf~~~~l~~~l~~~l~~~g~~~ptp~Q~~ai~~il~grdvii~a~TGsGKTla~llp~l~~l~~~~~~~~~~~p~  300 (787)
                      .....+|++++|++.++++|.+.||..|||+|.++||.+++|+|++++|+||||||++|++|+++++...     ...++
T Consensus        13 ~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~-----~~~~~   87 (222)
T d2j0sa1          13 VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ-----VRETQ   87 (222)
T ss_dssp             CCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT-----SCSCC
T ss_pred             CCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc-----ccCce
Confidence            4556799999999999999999999999999999999999999999999999999999999999988554     35688


Q ss_pred             EEEEcCcHHHHHHHHHHHHHHhhhcCceEEEEECCCChHHHHHHHhcCCcEEEeCHHHHHHHHHhccccccceeEEEEec
Q 003910          301 GVICAPTRELAHQIYLETKKFAKSHGIRVSAVYGGMSKLDQFKELKAGCEIVIATPGRLIDMLKMKALTMSRVTYLVLDE  380 (787)
Q Consensus       301 vLIl~PtreLa~Qi~~~~~~~~~~~~i~v~~~~gg~~~~~~~~~l~~~~dIIV~Tp~~L~~~l~~~~~~l~~i~~lViDE  380 (787)
                      +||++|||+||.|+++.+++++...++++.+++||.....+...+..+++|||+||++|.+++....+.+.++++|||||
T Consensus        88 ~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDE  167 (222)
T d2j0sa1          88 ALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDE  167 (222)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEET
T ss_pred             eEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecc
Confidence            99999999999999999999999899999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCChHHHHHHhhhcCCCceEEEEeccCcHHHHHHHHHHhCCCeEEEec
Q 003910          381 ADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPRKVEKLAREILSDPVRVTVG  434 (787)
Q Consensus       381 ah~m~~~~f~~~i~~il~~~~~~~q~ll~SAT~~~~v~~l~~~~l~~p~~i~v~  434 (787)
                      ||+|++.+|...+..|+..++..+|+++||||+++.+.++++.++.+|+.|.++
T Consensus       168 aD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         168 ADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             HHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             hhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence            999999999999999999999999999999999999999999999999988764



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure