Citrus Sinensis ID: 003936


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-----
MSKINSEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQRQRL
ccccccccccccHHHcccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEccccccccHHHHHHHHcccccccccccccccccEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEccccccccccccccccccccEEEEEEccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEccccEEEEEEEEEEccccccc
cccccccccccHHHHcccccccEEEEcccccccccccHHHccccccEEEEcccccccccccccccccEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEcccccccccccccccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccccccccccHHHccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEcccccccccccccccccEEEcccccccccccHHHccHHHHHHHcccccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEEccccccHHHccccEEEEEEEcccccEEEEccEEEEEEccccc
mskinseiqinpytfsKMTELRLLKFcgsknkcmvhslegvpftelryfewhqfplktlniLHWENLVslkmpgskvtQLWDDVQNLVSLKRIDLKYSKLLtklpdlslaqnleildlgycssltetHSSIQYLNklevldldrcksltslptsihsKYLKRLVLRgcsnlknlpkmtschlrstlpllgvgieelpssIKCLSNIGELLIYSCKRLENISSSIFKLQFlesirihrcpnlqflempscnidgtrskeqpsselklkkcprpeslpsgqcmfksltsleiidcpnferlpdeLGNLQALNRLIIDGTAIRELPEGLGQLALLSKlelkncselEYISSSIFKLKSVEsieisncsnlkgfpeipfcnidgsgieripssvlklnkcskleslpsslcmfksltsleiidckklerlpdelGNLEALEELRvegtgireVPKSLAQLALSKLKlkkcssfeslpsrlyvsksltsleiidcknfmrlpdeignLEYLKVLTIKgtairevpeslgqlsslEWLVLSDNNLQIIPESLNQLSSLVSLKLsnnnleriperldplsslkyLDLFENNLDRipeylrsfptsipseftSLRLSVDlrnclkldpnelSEIIkdgwmkqsvngetyitksmyfpgneipkwfrhqstgstislktpqptgynklMGFAFCVVVACSVseccrhesveddrkcnlfDVVCdrrsegydsytssylgkishvesdhvflgssifagensckrsdeFFFHIDrsccevkkcgihFVHAQRQRL
mskinseiqinpytfskMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLtslptsihskylkRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTrskeqpsselklkkcprpeslpsgQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLkkcssfeslpsrlyvsksltsleiidckNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNleriperldplssLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNElseiikdgwmkqsVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRhesveddrkcnlfDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQRQRL
MSKINSEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPkslaqlalsklklkkcssfeslPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPEslnqlsslvslklsnnnlERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGfafcvvvacsvseccRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQRQRL
*******IQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCN*****************************CMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVH******
*SKINSEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQR***
MSKINSEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNID**********************LPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQRQRL
*****SEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKINSEIQINPYTFSKMTELRLLKFCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTLNILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLKLDPNELSEIIKDGWMKQSVNGETYITKSMYFPGNEIPKWFRHQSTGSTISLKTPQPTGYNKLMGFAFCVVVACSVSECCRHESVEDDRKCNLFDVVCDRRSEGYDSYTSSYLGKISHVESDHVFLGSSIFAGENSCKRSDEFFFHIDRSCCEVKKCGIHFVHAQRQRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query785 2.2.26 [Sep-21-2011]
O235301301 Protein SUPPRESSOR OF npr no no 0.621 0.375 0.307 3e-47
Q403921144 TMV resistance protein N N/A no 0.385 0.264 0.319 5e-28
Q9SZ671895 Probable WRKY transcripti no no 0.300 0.124 0.371 8e-25
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.485 0.372 0.272 3e-22
O825001095 Putative disease resistan no no 0.314 0.225 0.349 9e-22
B4N9T4641 Leucine-rich repeat prote N/A no 0.593 0.726 0.268 1e-19
B4LXW1614 Leucine-rich repeat prote N/A no 0.605 0.773 0.268 1e-19
B4JTV9622 Leucine-rich repeat prote N/A no 0.605 0.763 0.268 2e-19
Q8C0R9853 Leucine-rich repeat and d yes no 0.583 0.536 0.254 3e-19
B3LWU3641 Leucine-rich repeat prote N/A no 0.6 0.734 0.264 6e-19
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 182/591 (30%), Positives = 274/591 (46%), Gaps = 103/591 (17%)

Query: 10   INPYTFSKMTELRLLK--FCGSKNKCMVHSLEGVPFTELRYFEWHQFPLKTL-NILHWEN 66
            I+  +F  M  L+ L+  + G   + +V+    +P  +LR  +W   PLK+L +    E 
Sbjct: 537  IDKESFKGMRNLQYLEIGYYGDLPQSLVY----LPL-KLRLLDWDDCPLKSLPSTFKAEY 591

Query: 67   LVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTE 126
            LV+L M  SK+ +LW+    L SLK ++L+YS  L ++PDLSLA NLE LDL  C SL  
Sbjct: 592  LVNLIMKYSKLEKLWEGTLPLGSLKEMNLRYSNNLKEIPDLSLAINLEELDLVGCKSLVT 651

Query: 127  THSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMT-------- 178
              SSIQ   KL  LD+  CK L S PT ++ + L+ L L GC NL+N P +         
Sbjct: 652  LPSSIQNATKLIYLDMSDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDF 711

Query: 179  ----------SCHLRSTLPLLGVGIEELPSSIKCL------SNIGELLIYSCKRLENISS 222
                       C     LP    G++ L    +C+        +  L +   K  E +  
Sbjct: 712  PEGRNEIVVEDCFWNKNLP---AGLDYLDCLTRCMPCEFRPEQLAFLNVRGYKH-EKLWE 767

Query: 223  SIFKLQFLESIRIHRCPNLQFLEMPSCNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMF 282
             I  L  LE + +    NL   E+P        SK      L L  C    +LPS     
Sbjct: 768  GIQSLGSLEGMDLSESENLT--EIPDL------SKATKLESLILNNCKSLVTLPSTIGNL 819

Query: 283  KSLTSLEIIDCPNFERLPDELGNLQALNRLIIDG---------------------TAIRE 321
              L  LE+ +C   E LP ++ NL +L  L + G                     TAI E
Sbjct: 820  HRLVRLEMKECTGLEVLPTDV-NLSSLETLDLSGCSSLRSFPLISTNIVWLYLENTAIEE 878

Query: 322  LPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFP----EIPFCN 377
            +P  +G L  L +LE+K C+ LE + + +  L S+E++++S CS+L+ FP     I +  
Sbjct: 879  IPSTIGNLHRLVRLEMKKCTGLEVLPTDV-NLSSLETLDLSGCSSLRSFPLISESIKWLY 937

Query: 378  IDGSGIERIPS-------SVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDEL 430
            ++ + IE IP          LKLN C  L +LP+++   + L S E+ +C  LE LP ++
Sbjct: 938  LENTAIEEIPDLSKATNLKNLKLNNCKSLVTLPTTIGNLQKLVSFEMKECTGLEVLPIDV 997

Query: 431  G-------NLEALEELR-------------VEGTGIREVPKSLAQLA-LSKLKLKKCSSF 469
                    +L     LR             +E T I E+P ++  L  L KL++K+C+  
Sbjct: 998  NLSSLMILDLSGCSSLRTFPLISTNIVWLYLENTAIEEIPSTIGNLHRLVKLEMKECTGL 1057

Query: 470  ESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVP 520
            E LP+ + +S SL  L++  C +    P     +E    L ++ TAI EVP
Sbjct: 1058 EVLPTDVNLS-SLMILDLSGCSSLRTFPLISTRIE---CLYLQNTAIEEVP 1104




Disease resistance protein of the TIR-NB-LRR-type. Part of the RPP5 locus that contains a cluster of several paralogous disease resistance (R) genes. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Regulated by RNA silencing. Expression regulated by MOS1 at chromatin level. Negatively regulated at the transcript level by BON1.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 Back     alignment and function description
>sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query785
147802252 1441 hypothetical protein VITISV_020931 [Viti 0.951 0.518 0.313 2e-70
255544956 1403 leucine-rich repeat containing protein, 0.848 0.474 0.312 8e-64
296089409 1161 unnamed protein product [Vitis vinifera] 0.857 0.579 0.287 7e-63
147834354 1284 hypothetical protein VITISV_019700 [Viti 0.656 0.401 0.323 1e-58
147862827 1454 hypothetical protein VITISV_024045 [Viti 0.954 0.515 0.290 2e-58
147821370 1386 hypothetical protein VITISV_013693 [Viti 0.963 0.545 0.294 5e-58
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.608 0.333 0.343 3e-57
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.732 0.391 0.307 2e-56
297807789 1281 hypothetical protein ARALYDRAFT_488633 [ 0.740 0.453 0.295 2e-55
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.588 0.295 0.341 3e-55
>gi|147802252|emb|CAN68265.1| hypothetical protein VITISV_020931 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  273 bits (699), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 276/880 (31%), Positives = 416/880 (47%), Gaps = 133/880 (15%)

Query: 7    EIQINPYTFSKMTELRLLKFCGSKN--KCMVHSLEGVPFTELRYFEWHQFPLKTL-NILH 63
            EIQ N   F+KM  LRLLK   S +  K ++      P  ELRY  W  +PLKTL +  H
Sbjct: 557  EIQCNTKVFTKMKRLRLLKLHWSDHCGKVVLPPNFEFPSQELRYLHWEGYPLKTLPSNFH 616

Query: 64   WENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSS 123
             ENLV L +  S + QLW   + L  LK IDL YSK+LTK+P  S    LEIL+L  C S
Sbjct: 617  GENLVELHLRKSTIKQLWKRSKGLEKLKVIDLSYSKVLTKMPKFSRMPKLEILNLEGCIS 676

Query: 124  LTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTSC--H 181
            L + HSSI  +  L  L+L  C+ L SLP+S+  + L+ L L GC N  N P++     H
Sbjct: 677  LRKLHSSIGDVKMLTYLNLGGCEKLQSLPSSMKFESLEVLHLNGCRNFTNFPEVHENMKH 736

Query: 182  LRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIR------- 234
            L+  L L    IEELPSSI  L+++  L +  C   +        ++FL  +R       
Sbjct: 737  LKE-LYLQKSAIEELPSSIGSLTSLEILDLSECSNFKKFPEIHGNMKFLRELRLNGTGIK 795

Query: 235  -----IHRCPNLQFLEMPSCN----IDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSL 285
                 I    +L+ L++  C+      G     +   EL L    R + LPS      SL
Sbjct: 796  ELPSSIGDLTSLEILBLSECSNFEKFPGIHGNMKFLRELHLNGT-RIKELPSS---IGSL 851

Query: 286  TSLEIID---CPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSE 342
            TSLEI++   C  FE+ PD   N++ L +L +  + I+ELP  +G L  L +L L   + 
Sbjct: 852  TSLEILNLSKCSKFEKFPDIFANMEHLRKLYLSNSGIKELPSNIGNLKHLKELSLDK-TF 910

Query: 343  LEYISSSIFKLKSVESIEISNCSNLKGFPEIPF-------CNIDGSGIERIPSSV----- 390
            ++ +  SI+ L++++++ +  CSN + FPEI           I+ + I  +P S+     
Sbjct: 911  IKELPKSIWSLEALQTLSLRGCSNFEKFPEIQRNMGSLLDLEIEETAITELPLSIGHLTR 970

Query: 391  ---LKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIR 447
               L L  C  L SLPSS+C  KSL  L +  C  LE  P+ L ++E L  L + GT I 
Sbjct: 971  LNSLNLENCKNLRSLPSSICRLKSLKHLSLNCCSNLEAFPEILEDMEHLRSLELRGTAIT 1030

Query: 448  EVPKSLAQL-ALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLE-Y 505
             +P S+  L +L  LKL  C + E+LP+ +     LT+L + +C     LPD + +L+  
Sbjct: 1031 GLPSSIEHLRSLQWLKLINCYNLEALPNSIGNLTCLTTLVVRNCSKLHNLPDNLRSLQCC 1090

Query: 506  LKVLTIKGTAIRE--VPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNN-NL 562
            L  L + G  + E  +P  +  LSSLE+L +S+N+++ IP  + QL  L +L++++   L
Sbjct: 1091 LTTLDLGGCNLMEGGIPRDIWGLSSLEFLDVSENHIRCIPIGIIQLLKLTTLRMNHCLML 1150

Query: 563  ERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSEFTSLRLSVDLRNCLK----- 617
            E IP   D  SSL+ +   E +  R  E L S P  +        L   L NC K     
Sbjct: 1151 EDIP---DLPSSLRRI---EAHGCRCLETLSS-PIHV--------LWSSLLNCFKSLIQA 1195

Query: 618  LDPNELSEIIKDGWMKQSVN-------------GETYITKS-----------MYFPGNE- 652
             D +++    +D   +Q ++              + Y   S           ++ PG+  
Sbjct: 1196 HDSHDVQNEEEDSHKQQDIDLALPTSSGNLDEEEDLYGGNSDEEDGPLGQIDVFIPGSSG 1255

Query: 653  IPKWFRHQSTGSTISLKTPQPTGY--NKLMGFA-FCVVVACSVSECCRHESVED---DRK 706
            IP+W  HQ+ G  + ++ P    Y  N  +GFA F  ++     +    E V+     +K
Sbjct: 1256 IPEWVSHQNKGCEVRIELPM-NWYEDNDFLGFALFFHLLPLDNDDDDDDELVKRYIITQK 1314

Query: 707  CNLFDVVCDRRSE------GYDSYTSSYLGKISHVESD---------HVFLGSSIFAGEN 751
            C L  +  D +SE        DS+  +Y    + V SD         H+ +     +G  
Sbjct: 1315 CKL-TISHDDQSEMVASSISLDSFCEAYRISSNCVSSDPALRVTYVPHIAIPDHYRSG-- 1371

Query: 752  SCKRSDEFFFHIDR---SC-------CEVKKCGIHFVHAQ 781
                   F  H+D    SC        +V+ CGIH ++AQ
Sbjct: 1372 ---WWKNFKAHLDTPFVSCQCGKNRPFKVEGCGIHLIYAQ 1408




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296089409|emb|CBI39228.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834354|emb|CAN69843.1| hypothetical protein VITISV_019700 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862827|emb|CAN78931.1| hypothetical protein VITISV_024045 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147821370|emb|CAN67940.1| hypothetical protein VITISV_013693 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297807789|ref|XP_002871778.1| hypothetical protein ARALYDRAFT_488633 [Arabidopsis lyrata subsp. lyrata] gi|297317615|gb|EFH48037.1| hypothetical protein ARALYDRAFT_488633 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query785
TAIR|locus:2174900968 AT5G40060 [Arabidopsis thalian 0.518 0.420 0.321 5.1e-46
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.625 0.247 0.308 2.1e-39
TAIR|locus:21704081139 AT5G46270 [Arabidopsis thalian 0.440 0.303 0.345 3.7e-39
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.552 0.335 0.316 4.9e-38
TAIR|locus:21514911123 AT5G46450 [Arabidopsis thalian 0.482 0.337 0.321 1e-37
TAIR|locus:21514761168 VICTR "VARIATION IN COMPOUND T 0.494 0.332 0.322 3.8e-37
TAIR|locus:21514661353 VICTL "VARIATION IN COMPOUND T 0.494 0.286 0.322 2e-36
TAIR|locus:21158701234 AT4G08450 [Arabidopsis thalian 0.456 0.290 0.333 2e-36
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.494 0.318 0.312 2.2e-36
TAIR|locus:21704881205 AT5G46260 [Arabidopsis thalian 0.485 0.316 0.322 3.3e-36
TAIR|locus:2174900 AT5G40060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 5.1e-46, Sum P(2) = 5.1e-46
 Identities = 141/439 (32%), Positives = 226/439 (51%)

Query:     1 MSKINSEIQINPYTFSKMTELRLL----KFCGSKNKCMVHSLEGVPFT--ELRYFEWHQF 54
             + +I+ E+ ++   F  M  LR L    K   S  K  +H  E   +   +L+   W ++
Sbjct:   346 VDEIDHELNVHEKAFQGMRNLRFLNIYTKALMSGQKIRLHLPENFDYLPPKLKLLCWDKY 405

Query:    55 PLKTL-NILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNL 113
             P++ L +    ENLV LKM  S++ +LW+ V +L  LK +DL+ SK L ++PDLS+A NL
Sbjct:   406 PMRCLPSSFRPENLVKLKMQESELEKLWEGVGSLTCLKDMDLEKSKNLKEIPDLSMATNL 465

Query:   114 EILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKN 173
             + L+L YCSSL +  SSIQ LNKL  L+++ C +L +LP  I+ K L RL LRGCS L+ 
Sbjct:   466 KTLNLKYCSSLVKISSSIQNLNKLTKLNMEGCTNLETLPAGINLKSLHRLDLRGCSRLRM 525

Query:   174 LPKMTSCHLRSTLPLLGVGIEELPSSI--KCLSNIGELLIYSCKRLENISSSIFKLQFLE 231
              P +++ ++ S L L    IEE PS++  K L ++    + S K  E +      ++ L 
Sbjct:   526 FPDISN-NI-SVLFLDKTSIEEFPSNLHLKKLFDLSMQQMNSEKLWEGVQPLTCLMKMLS 583

Query:   232 SIRIHRCPNLQFLEMPS-----CNIDGTRSKEQPSSELKLKKCPRPESLPSGQCMFKSLT 286
                      L   ++PS     C I   +       EL +++C   ESLP+G   FK L 
Sbjct:   584 PPLAKNFNTLYLSDIPSLVELPCGIQNLKKL----MELSIRRCKNLESLPTG-ANFKYLD 638

Query:   287 SLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYI 346
              L++  C      PD    +  L    ++ T I E+P  +     L+ L +  C++L+Y+
Sbjct:   639 YLDLSGCSKLRSFPDISSTISCL---CLNRTGIEEVPSWIENFVRLTYLTMLECNKLKYV 695

Query:   347 SSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSL 406
             S +IFKLK ++  + S+C  L    E+ +CN     I    ++   +     +    SSL
Sbjct:   696 SLNIFKLKHLDKADFSDCGTLT---EVSWCN---KTISVAAATADNIQPKLLVSEASSSL 749

Query:   407 CMFKSLTSLEIIDCKKLER 425
             C+ KS+  +  I+C KL++
Sbjct:   750 CVQKSV--VRFINCFKLDQ 766


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0016556 "mRNA modification" evidence=RCA
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170408 AT5G46270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170488 AT5G46260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query785
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-53
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-10
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 7e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  200 bits (511), Expect = 1e-53
 Identities = 150/436 (34%), Positives = 225/436 (51%), Gaps = 49/436 (11%)

Query: 7   EIQINPYTFSKMTELRLLKF----CGSKNKCMVHSLEGVPF--TELRYFEWHQFPLKTL- 59
           E+ I+   F  M  L  LKF       K +   H  EG  +   +LR   W ++PL+ + 
Sbjct: 546 ELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMP 605

Query: 60  NILHWENLVSLKMPGSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLG 119
           +    ENLV L+M GSK+ +LWD V +L  L+ IDL+ SK L ++PDLS+A NLE L L 
Sbjct: 606 SNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLS 665

Query: 120 YCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSIHSKYLKRLVLRGCSNLKNLPKMTS 179
            CSSL E  SSIQYLNKLE LD+ RC++L  LPT I+ K L RL L GCS LK+ P +++
Sbjct: 666 DCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDIST 725

Query: 180 CHLRSTLPLLGVGIEELPSSIKCLSNIGELLIYSCKRLENISSSIFKLQFLESIRIHRCP 239
               S L L    IEE PS+++ L N+ EL++   K  E +   +  L  L ++      
Sbjct: 726 N--ISWLDLDETAIEEFPSNLR-LENLDELILCEMKS-EKLWERVQPLTPLMTMLSPSLT 781

Query: 240 NLQFLEMPSCNIDGTRSKEQPSS--------ELKLKKCPRPESLPSGQCMFKSLTSLEII 291
            L   ++PS         E PSS         L+++ C   E+LP+G    +SL SL++ 
Sbjct: 782 RLFLSDIPSL-------VELPSSIQNLHKLEHLEIENCINLETLPTG-INLESLESLDLS 833

Query: 292 DCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSELEYISSSIF 351
            C      PD   N+  LN   +  T I E+P  + + + LS L++  C+ L+ +S +I 
Sbjct: 834 GCSRLRTFPDISTNISDLN---LSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNIS 890

Query: 352 KLKSVESIEISNCSNLKGFPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKS 411
           KLK +E+++ S+C  L         + +GS       S + +   +    LPS++C+   
Sbjct: 891 KLKHLETVDFSDCGALTE------ASWNGS------PSEVAMATDNIHSKLPSTVCIN-- 936

Query: 412 LTSLEIIDCKKLERLP 427
                 I+C  L++  
Sbjct: 937 -----FINCFNLDQEA 947


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 785
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
KOG4237498 consensus Extracellular matrix protein slit, conta 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.18
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.84
PLN03150623 hypothetical protein; Provisional 98.65
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.65
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PLN03150623 hypothetical protein; Provisional 98.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.49
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.47
PRK15386426 type III secretion protein GogB; Provisional 98.46
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG4341483 consensus F-box protein containing LRR [General fu 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.14
PRK15386426 type III secretion protein GogB; Provisional 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.91
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.8
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.68
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.2
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.79
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.28
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.38
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.12
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.38
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.25
KOG4308478 consensus LRR-containing protein [Function unknown 91.17
KOG4308478 consensus LRR-containing protein [Function unknown 90.66
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.94
smart0037026 LRR Leucine-rich repeats, outliers. 89.94
smart0037026 LRR Leucine-rich repeats, outliers. 89.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.9
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.74
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 84.12
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.64
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=1.3e-46  Score=456.58  Aligned_cols=174  Identities=48%  Similarity=0.775  Sum_probs=155.0

Q ss_pred             CCccccceecCHHHHhcccccceeeeecCCCc----cccccCCCCCC--CceEEEEecCCCCccccc-ccccCceEEEcC
Q 003936            1 MSKINSEIQINPYTFSKMTELRLLKFCGSKNK----CMVHSLEGVPF--TELRYFEWHQFPLKTLNI-LHWENLVSLKMP   73 (785)
Q Consensus         1 ~s~~~~~~~i~~~~f~~l~~Lr~L~l~~~~~~----~~~~~~~~~~~--~~L~~L~l~~~~l~~lp~-~~l~~L~~L~L~   73 (785)
                      |+++ +++.++.++|.+|++|+.|.++++...    ...++|+++..  .+||+|+|++++++.+|. +.+++|++|+|+
T Consensus       541 ~~~~-~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~  619 (1153)
T PLN03210        541 IDEI-DELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQ  619 (1153)
T ss_pred             cCcc-ceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECc
Confidence            3556 578899999999999999999876421    23567888777  789999999999999999 889999999999


Q ss_pred             CCCcccccccccCCCCCcEEecCCCccccCCCCCccccccceeccccccCccccccccccCCcccEEecCCCCCCCcCCC
Q 003936           74 GSKVTQLWDDVQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPT  153 (785)
Q Consensus        74 ~~~i~~l~~~~~~l~~L~~L~Ls~n~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~p~  153 (785)
                      +++++.+|.++..+++|+.|+|+++...+.+|+++.+++|++|+|++|.....+|..++++++|+.|++++|..++.+|.
T Consensus       620 ~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~  699 (1153)
T PLN03210        620 GSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPT  699 (1153)
T ss_pred             CccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCC
Confidence            99999999999999999999999998888899999999999999999998999999999999999999999999999998


Q ss_pred             ccccccccEEeccCCcCCCCCC
Q 003936          154 SIHSKYLKRLVLRGCSNLKNLP  175 (785)
Q Consensus       154 ~~~l~~L~~L~ls~~~~l~~lp  175 (785)
                      .+++++|+.|++++|..++.+|
T Consensus       700 ~i~l~sL~~L~Lsgc~~L~~~p  721 (1153)
T PLN03210        700 GINLKSLYRLNLSGCSRLKSFP  721 (1153)
T ss_pred             cCCCCCCCEEeCCCCCCccccc
Confidence            7788889999998886555544



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query785
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-10
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-09
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 9e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 50/171 (29%), Positives = 74/171 (43%), Gaps = 18/171 (10%) Query: 274 SLPSGQCMFKSLTSLEIIDCPNFERLPDELGNLQA---------LNRLIIDGTAIRELPE 324 +LP+ L L I CP LP+ L + A L L ++ T IR LP Sbjct: 141 ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPA 200 Query: 325 GLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLKGFPEIPFCNIDGSGIE 384 + L L L+++N S L + +I L +E +++ C+ L+ +P I G Sbjct: 201 SIANLQNLKSLKIRN-SPLSALGPAIHHLPKLEELDLRGCTALRNYPPI----FGG---- 251 Query: 385 RIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEA 435 R P L L CS L +LP + L L++ C L RLP + L A Sbjct: 252 RAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPA 302
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query785
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  161 bits (409), Expect = 3e-44
 Identities = 74/348 (21%), Positives = 135/348 (38%), Gaps = 60/348 (17%)

Query: 283 KSLTSLEIIDCPNFERLPDELGNLQALNRLIIDGTAIRELPEGLGQLALLSKLELKNCSE 342
               +L            D L   Q       +                  ++E +    
Sbjct: 12  SGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRW---HSAWRQANSNNP-QIETRTGRA 67

Query: 343 LEYISSSIFKLKSV--ESIEISNCSNLKGFPEIPFC-------NIDGSGIERIPSSVLKL 393
           L+  +  +         ++E+ +   L  FP+  F         ID +G+  +P ++ + 
Sbjct: 68  LKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQF 126

Query: 394 NK-------CSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEA---------LE 437
                     + L +LP+S+     L  L I  C +L  LP+ L + +A         L+
Sbjct: 127 AGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQ 186

Query: 438 ELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLP 497
            LR+E TGIR +P S+A L                       ++L SL+I +      L 
Sbjct: 187 SLRLEWTGIRSLPASIANL-----------------------QNLKSLKIRNSP-LSALG 222

Query: 498 DEIGNLEYLKVLTIKG-TAIREVPESLGQLSSLEWLVLSD-NNLQIIPESLNQLSSLVSL 555
             I +L  L+ L ++G TA+R  P   G  + L+ L+L D +NL  +P  +++L+ L  L
Sbjct: 223 PAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL 282

Query: 556 KLSNN-NLERIPERLDPLSSLKYLDLFENNLDRIPEYLRSFPTSIPSE 602
            L    NL R+P  +  L +   + +  +   ++ ++    P + P+E
Sbjct: 283 DLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQHR---PVARPAE 327


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query785
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.18
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.14
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.04
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.01
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.43
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.85
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.9
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-54  Score=512.33  Aligned_cols=559  Identities=18%  Similarity=0.214  Sum_probs=372.0

Q ss_pred             HHHhcccccceeeeecCCCccccccCC--CCCC-CceEEEEecCCCCc-cccc---ccccCceEEEcCCCCcccc-ccc-
Q 003936           13 YTFSKMTELRLLKFCGSKNKCMVHSLE--GVPF-TELRYFEWHQFPLK-TLNI---LHWENLVSLKMPGSKVTQL-WDD-   83 (785)
Q Consensus        13 ~~f~~l~~Lr~L~l~~~~~~~~~~~~~--~~~~-~~L~~L~l~~~~l~-~lp~---~~l~~L~~L~L~~~~i~~l-~~~-   83 (785)
                      ..|.++++||+|++++|.+.+  .+|.  .+.. ++|++|++++|.+. .+|.   ..+++|++|++++|.++.. +.. 
T Consensus        94 ~~~~~l~~L~~L~Ls~n~l~~--~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~  171 (768)
T 3rgz_A           94 SGFKCSASLTSLDLSRNSLSG--PVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGW  171 (768)
T ss_dssp             CCCCCCTTCCEEECCSSEEEE--EGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHH
T ss_pred             hhhccCCCCCEEECCCCcCCC--cCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhh
Confidence            456777777777777777642  2444  5555 77788888777765 3333   4677788888888877744 333 


Q ss_pred             --ccCCCCCcEEecCCCccccCCCCCccccccceeccccccCccccccccccCCcccEEecCCCCCCCcCCCcc-ccccc
Q 003936           84 --VQNLVSLKRIDLKYSKLLTKLPDLSLAQNLEILDLGYCSSLTETHSSIQYLNKLEVLDLDRCKSLTSLPTSI-HSKYL  160 (785)
Q Consensus        84 --~~~l~~L~~L~Ls~n~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~p~~~-~l~~L  160 (785)
                        +.++++|++|++++|.+....+ +..+++|++|++++|.+.+.+|. ++++++|++|++++|...+.+|..+ .+++|
T Consensus       172 ~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L  249 (768)
T 3rgz_A          172 VLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTEL  249 (768)
T ss_dssp             HHTTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSC
T ss_pred             hhhccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCC
Confidence              6777888888888887654443 47788888888888887776666 8888888888888887777777777 78888


Q ss_pred             cEEeccCCcCCCCCCCcccccccccccccccccc-ccCcchhcc-ccccceeccccccccccchhhhcccccccccccCC
Q 003936          161 KRLVLRGCSNLKNLPKMTSCHLRSTLPLLGVGIE-ELPSSIKCL-SNIGELLIYSCKRLENISSSIFKLQFLESIRIHRC  238 (785)
Q Consensus       161 ~~L~ls~~~~l~~lp~~~~~~L~~~L~l~~~~i~-~lp~~l~~l-~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~  238 (785)
                      ++|++++|...+.+|.....+|+ +|++++|.+. .+|..+... ++|++|++++|.+.+.+|..++.+++|+.|+++++
T Consensus       250 ~~L~Ls~n~l~~~~~~~~l~~L~-~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n  328 (768)
T 3rgz_A          250 KLLNISSNQFVGPIPPLPLKSLQ-YLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSN  328 (768)
T ss_dssp             CEEECCSSCCEESCCCCCCTTCC-EEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSS
T ss_pred             CEEECCCCcccCccCccccCCCC-EEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCC
Confidence            88888888766677766557788 8888888886 788887764 88889999888888888888888888888877653


Q ss_pred             --------------CCCccccCCCcccCCCCCccC-----CcccccccCCCCCCCCCCCccC--CCCCcEEecccCCCCC
Q 003936          239 --------------PNLQFLEMPSCNIDGTRSKEQ-----PSSELKLKKCPRPESLPSGQCM--FKSLTSLEIIDCPNFE  297 (785)
Q Consensus       239 --------------~~L~~L~l~~n~~~~~~~~~~-----~~~~L~l~~~~~~~~~~~~~~~--l~~L~~L~l~~~~~~~  297 (785)
                                    ++|++|++++|.+++.....+     ....+++++|...+.+|..+..  +++|+.|++.+|...+
T Consensus       329 ~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~  408 (768)
T 3rgz_A          329 NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG  408 (768)
T ss_dssp             EEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEE
T ss_pred             cccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccc
Confidence                          456666666666653322211     2233555566555555555444  5566666666665555


Q ss_pred             CCCccccCccccceeeccCcccc-cCCccccCccccceecccCccCCccccccccCCCCCCEEEeeCCCCCC-------C
Q 003936          298 RLPDELGNLQALNRLIIDGTAIR-ELPEGLGQLALLSKLELKNCSELEYISSSIFKLKSVESIEISNCSNLK-------G  369 (785)
Q Consensus       298 ~lp~~l~~l~~L~~L~L~~n~i~-~lp~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~-------~  369 (785)
                      .+|..+.++++|++|++++|.++ .+|..++.+++|++|++++|.+.+.+|..+..+++|+.|++++|....       .
T Consensus       409 ~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~  488 (768)
T 3rgz_A          409 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN  488 (768)
T ss_dssp             ECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             ccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhc
Confidence            56666666666666666666665 455556666666666666666666666666666666666666654221       1


Q ss_pred             CCCCceeccCCCCCcccCccccccCCCCCCccCCccccCCCCCcEEEeccccCCCcCCcccCCcccchhhhccCcccc-c
Q 003936          370 FPEIPFCNIDGSGIERIPSSVLKLNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIR-E  448 (785)
Q Consensus       370 lp~l~~l~l~~~~i~~lp~~~l~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~L~~n~i~-~  448 (785)
                      ++.|+.+++++|.+.               +.+|.+++.+++|+.|++++|.+.+.+|..++.+++|+.|++++|.++ .
T Consensus       489 l~~L~~L~L~~N~l~---------------~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~  553 (768)
T 3rgz_A          489 CTNLNWISLSNNRLT---------------GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGT  553 (768)
T ss_dssp             CTTCCEEECCSSCCC---------------SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESB
T ss_pred             CCCCCEEEccCCccC---------------CcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCc
Confidence            223333333333222               234444555555555555555555555555555555555555555554 4


Q ss_pred             cChhhhhhh-hcccccccCC----------------------CCccCCccccCCCCCCEEEeeCCcCcccCCCccccccc
Q 003936          449 VPKSLAQLA-LSKLKLKKCS----------------------SFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEY  505 (785)
Q Consensus       449 lp~~~~~l~-L~~L~l~~~~----------------------~~~~lp~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~  505 (785)
                      +|..+.... +..+.+....                      ..+..+..+..++.++.+++..+...+.+|..++.+++
T Consensus       554 ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~  633 (768)
T 3rgz_A          554 IPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS  633 (768)
T ss_dssp             CCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBC
T ss_pred             CChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcccc
Confidence            554443321 1111111100                      01111222223334444455556666777888888999


Q ss_pred             cceEEecCeecc-ccCcccCCCCCCcEEEccCCcccc-ccccccCCCCCCEEEcccCCCCC-CCCcCcCCCCCCEEeCCC
Q 003936          506 LKVLTIKGTAIR-EVPESLGQLSSLEWLVLSDNNLQI-IPESLNQLSSLVSLKLSNNNLER-IPERLDPLSSLKYLDLFE  582 (785)
Q Consensus       506 L~~L~L~~n~l~-~lp~~~~~l~~L~~L~Ls~n~l~~-lp~~l~~l~~L~~L~L~~n~l~~-lp~~l~~l~~L~~L~l~~  582 (785)
                      |+.|++++|.++ .+|..++.+++|+.|+|++|++++ +|..++.+++|+.|+|++|++++ +|..+..+++|++|++++
T Consensus       634 L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~  713 (768)
T 3rgz_A          634 MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSN  713 (768)
T ss_dssp             CCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCS
T ss_pred             ccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcC
Confidence            999999999998 679999999999999999999984 89999999999999999999985 799999999999999999


Q ss_pred             CCCC-CCccc
Q 003936          583 NNLD-RIPEY  591 (785)
Q Consensus       583 n~l~-~lp~~  591 (785)
                      |+++ .+|+.
T Consensus       714 N~l~g~iP~~  723 (768)
T 3rgz_A          714 NNLSGPIPEM  723 (768)
T ss_dssp             SEEEEECCSS
T ss_pred             CcccccCCCc
Confidence            9964 66653



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 785
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 65.8 bits (159), Expect = 7e-12
 Identities = 36/191 (18%), Positives = 73/191 (38%), Gaps = 9/191 (4%)

Query: 393 LNKCSKLESLPSSLCMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKS 452
           L   +   S  + L +  +L  L +   +  +     L +L  L +L +    I  +   
Sbjct: 202 LIATNNQISDITPLGILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAPL 259

Query: 453 LAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLEIIDCKNFMRLPDEIGNLEYLKVLTIK 512
                L++LKL         P     + +         +N +     I NL+ L  LT+ 
Sbjct: 260 SGLTKLTELKLGANQISNISPLAGLTALTNLE----LNENQLEDISPISNLKNLTYLTLY 315

Query: 513 GTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIPERLDPL 572
              I ++   +  L+ L+ L  ++N +  +  SL  L+++  L   +N +  +   L  L
Sbjct: 316 FNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANL 372

Query: 573 SSLKYLDLFEN 583
           + +  L L + 
Sbjct: 373 TRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query785
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.5
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.11
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.93  E-value=4.7e-25  Score=236.71  Aligned_cols=146  Identities=23%  Similarity=0.329  Sum_probs=101.3

Q ss_pred             cCCCCCcEEEeccccCCCcCCcccCCcccchhhhccCccccccChhhhhhhhcccccccCCCCccCCccccCCCCCCEEE
Q 003936          407 CMFKSLTSLEIIDCKKLERLPDELGNLEALEELRVEGTGIREVPKSLAQLALSKLKLKKCSSFESLPSRLYVSKSLTSLE  486 (785)
Q Consensus       407 ~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~L~~n~i~~lp~~~~~l~L~~L~l~~~~~~~~lp~~~~~~~~L~~L~  486 (785)
                      ..+++|+.|++++|.+.+..  .+..+++|+.|+++++.++.+++. ..                       ++.++.+.
T Consensus       238 ~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~~~~l~~~~~~-~~-----------------------~~~l~~l~  291 (384)
T d2omza2         238 ASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQISNISPL-AG-----------------------LTALTNLE  291 (384)
T ss_dssp             GGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCCCCGGG-TT-----------------------CTTCSEEE
T ss_pred             hcccccchhccccCccCCCC--cccccccCCEeeccCcccCCCCcc-cc-----------------------cccccccc
Confidence            34455555555555443322  144555666666666655554421 11                       25667777


Q ss_pred             eeCCcCcccCCCccccccccceEEecCeeccccCcccCCCCCCcEEEccCCccccccccccCCCCCCEEEcccCCCCCCC
Q 003936          487 IIDCKNFMRLPDEIGNLEYLKVLTIKGTAIREVPESLGQLSSLEWLVLSDNNLQIIPESLNQLSSLVSLKLSNNNLERIP  566 (785)
Q Consensus       487 l~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp  566 (785)
                      +..|.+.+  ...+..+++++.|++++|.++.+++ +..+++|++|++++|+++.++ .++++++|++|++++|++++++
T Consensus       292 ~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~  367 (384)
T d2omza2         292 LNENQLED--ISPISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLT  367 (384)
T ss_dssp             CCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCG
T ss_pred             cccccccc--ccccchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCCh
Confidence            77766554  2346667788888888888887754 778889999999999888876 5888899999999999998876


Q ss_pred             CcCcCCCCCCEEeCCCC
Q 003936          567 ERLDPLSSLKYLDLFEN  583 (785)
Q Consensus       567 ~~l~~l~~L~~L~l~~n  583 (785)
                      + +.++++|+.|+|++|
T Consensus       368 ~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         368 P-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             G-GTTCTTCSEEECCCE
T ss_pred             h-hccCCCCCEeeCCCC
Confidence            4 788899999999886



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure