Citrus Sinensis ID: 003951
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 784 | 2.2.26 [Sep-21-2011] | |||||||
| Q39128 | 677 | Potassium channel KAT1 OS | yes | no | 0.863 | 1.0 | 0.625 | 0.0 | |
| Q38849 | 697 | Potassium channel KAT2 OS | no | no | 0.886 | 0.997 | 0.624 | 0.0 | |
| Q6K3T2 | 718 | Potassium channel KAT1 OS | yes | no | 0.637 | 0.696 | 0.642 | 0.0 | |
| Q5JM04 | 502 | Potassium channel KAT3 OS | no | no | 0.589 | 0.920 | 0.679 | 0.0 | |
| Q0JKV1 | 935 | Potassium channel AKT1 OS | no | no | 0.718 | 0.602 | 0.571 | 0.0 | |
| P0C550 | 935 | Potassium channel AKT1 OS | N/A | no | 0.718 | 0.602 | 0.571 | 0.0 | |
| Q38998 | 857 | Potassium channel AKT1 OS | no | no | 0.710 | 0.649 | 0.564 | 0.0 | |
| Q9SCX5 | 880 | Probable potassium channe | no | no | 0.720 | 0.642 | 0.530 | 1e-178 | |
| Q8GXE6 | 888 | Potassium channel AKT6 OS | no | no | 0.735 | 0.649 | 0.526 | 1e-177 | |
| Q5QNI1 | 601 | Potassium channel KAT2 OS | no | no | 0.613 | 0.800 | 0.627 | 1e-173 |
| >sp|Q39128|KAT1_ARATH Potassium channel KAT1 OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 944 bits (2440), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 484/774 (62%), Positives = 562/774 (72%), Gaps = 97/774 (12%)
Query: 1 MSFSCAKNFFQRFCSDELHVESVAHGSFLSSDLLPSLGARINQATKLRRYIISPFNPRYR 60
MS S +NFF+RFC +E +++++ SFLS+DLLPSLGARINQ+TKLR++IISPFNPRYR
Sbjct: 1 MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYR 60
Query: 61 AWEMWLVVLVVYSAWICPFEFAFLTYKKDALLIIDNIVNGFFAIDIILTFFVAYLDSQSY 120
AWEMWLV+LV+YSAWICPF+FAF+TYKKDA+ IIDNIVNGFFAIDIILTFFVAYLDS SY
Sbjct: 61 AWEMWLVLLVIYSAWICPFQFAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSY 120
Query: 121 LLVDDPKKIAIRYMSTWFIFDVCSTAPLQFLALLLTNNISELTFRLLNMLRLWRLRRVSS 180
LLVD PKKIAIRY+STWF FDVCSTAP Q L+LL N SEL FR+L+MLRLWRLRRVSS
Sbjct: 121 LLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGSELGFRILSMLRLWRLRRVSS 180
Query: 181 LFARLEKDIRFNYFWTRCTKLVAVTLFAVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKE 240
LFARLEKDIRFNYFW RCTKL++VTLFA+HCAGCFNYLIADRYP+P KTWIGAVYPNFKE
Sbjct: 181 LFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE 240
Query: 241 ETLWNRYVTAMYWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGLTSYIIGNMTNLVV 300
+LWNRYVTA+YWSITTLTTTGYGD HAENPREMLFDIF+M+FNLGLT+Y+IGNMTNLVV
Sbjct: 241 ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVV 300
Query: 301 HWTSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIR 360
HWTSRTR FR++VRA SEFA+RN LP I DQMLSHICLKFKTEGLKQQETL LPKAIR
Sbjct: 301 HWTSRTRTFRDSVRAASEFASRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIR 360
Query: 361 SSIAHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSG 420
SSIA+YLFFPIV N+YLFQGVS +FLFQLVSD+DAEYFPPKED+ILQNEAPTDLYILVSG
Sbjct: 361 SSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPPKEDIILQNEAPTDLYILVSG 420
Query: 421 AVDLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQ 480
AVD YVDG D+ GKAV G+ FGE+GVLYYRPQPFTVRTTELSQILR+SRTSLM+++
Sbjct: 421 AVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH 480
Query: 481 ANMEDGRIVMNNLFRKLKDQESIGFEYPTTDPGIILHECIGGPTIGSSLSARHQDYPYGD 540
A+ +DGR++MNNLF KL+ Q+SI I S ++ H
Sbjct: 481 AHADDGRVIMNNLFMKLRGQQSIA--------------------IDDSNTSGH------- 513
Query: 541 SSMWETRNLNFLGPQATDIEASKDQDSTACPVDVNSKVEDGQTELNAANQRGHIEMVKVL 600
E R+ +G E +D +DV + D T L A + EMVK +
Sbjct: 514 ----ENRDFKSMG-----WEEWRDSRKDGYGLDVTNPTSD--TALMDAIHKEDTEMVKKI 562
Query: 601 LEGGRNGNKPDAKGWSPKAPAEQPVNRSMYDLLLSYENRTPDEHKVEIMGPEISDNIWNT 660
L+ EQ + R+ KVE E +
Sbjct: 563 LK-------------------EQKIERA----------------KVERSSSETA------ 581
Query: 661 RRKHRRHEWPDVSKSHSKRESIKLGSCISSCSSGEVNKSNKKRITIHMPYQNTRTSQRHL 720
+S++ S K C SS + K +KR+TIHM S+
Sbjct: 582 ------------GRSYANDSSKKDPYCSSSNQIIKPCKREEKRVTIHM------MSESKN 623
Query: 721 GKLIVLPDSIEELLRIAGEKFGGYKFTKVVNAENAEIDDICVIRDGDHLFLLQN 774
GKLI+LP SIEELLR+A EKFGG FTK+ NA+NAEIDD+ VI DGDHL+ N
Sbjct: 624 GKLILLPSSIEELLRLASEKFGGCNFTKITNADNAEIDDLDVIWDGDHLYFSSN 677
|
Highly selective inward-rectifying potassium channel. This voltage-gated channel could mediate long-term potassium influx into guard cells leading to stomatal opening. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. The channel activity is enhanced upon external acidification. Also permeable to ammonium ions. Blocked by tetraethylammonium and barium ions. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q38849|KAT2_ARATH Potassium channel KAT2 OS=Arabidopsis thaliana GN=KAT2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6K3T2|KAT1_ORYSJ Potassium channel KAT1 OS=Oryza sativa subsp. japonica GN=Os02g0245800 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5JM04|KAT3_ORYSJ Potassium channel KAT3 OS=Oryza sativa subsp. japonica GN=Os01g0756700 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5QNI1|KAT2_ORYSJ Potassium channel KAT2 OS=Oryza sativa subsp. japonica GN=Os01g0210700 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 784 | ||||||
| 225444541 | 791 | PREDICTED: potassium channel KAT1 [Vitis | 0.991 | 0.982 | 0.712 | 0.0 | |
| 16516993 | 791 | inward rectifying potassium channel [Vit | 0.991 | 0.982 | 0.711 | 0.0 | |
| 15824823 | 791 | inward rectifying shaker-like K+ channel | 0.991 | 0.982 | 0.710 | 0.0 | |
| 255557325 | 813 | Potassium channel KAT2, putative [Ricinu | 0.974 | 0.939 | 0.700 | 0.0 | |
| 166359597 | 746 | K+ channel protein [Populus euphratica] | 0.950 | 0.998 | 0.689 | 0.0 | |
| 18857685 | 751 | K+ channel protein [Populus tremula x Po | 0.955 | 0.997 | 0.688 | 0.0 | |
| 356523521 | 728 | PREDICTED: potassium channel KAT1-like [ | 0.926 | 0.997 | 0.646 | 0.0 | |
| 109942298 | 766 | inwardly rectifying potassium channel su | 0.965 | 0.988 | 0.627 | 0.0 | |
| 356546496 | 777 | PREDICTED: potassium channel KAT1-like [ | 0.984 | 0.993 | 0.643 | 0.0 | |
| 356557819 | 783 | PREDICTED: potassium channel KAT2-like [ | 0.985 | 0.987 | 0.641 | 0.0 |
| >gi|225444541|ref|XP_002275549.1| PREDICTED: potassium channel KAT1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1138 bits (2944), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 558/783 (71%), Positives = 636/783 (81%), Gaps = 6/783 (0%)
Query: 1 MSFSCAKNFFQRFCSDELHVESVAHGSFLSSDLLPSLGARINQATKLRRYIISPFNPRYR 60
MSFSCAK FFQRFC +E +E + GS SS LLPSLGARINQATKL+++IISPF+PRYR
Sbjct: 1 MSFSCAKAFFQRFCVEEFQMERTSLGSVFSSHLLPSLGARINQATKLQKHIISPFSPRYR 60
Query: 61 AWEMWLVVLVVYSAWICPFEFAFLTYKKDALLIIDNIVNGFFAIDIILTFFVAYLDSQSY 120
AWEM L++LV+YSAWICPFEF FL YK+DAL I DNIVNGFFAIDI+LTFFVAYLD+++Y
Sbjct: 61 AWEMLLIILVIYSAWICPFEFGFLPYKQDALFIFDNIVNGFFAIDIVLTFFVAYLDTETY 120
Query: 121 LLVDDPKKIAIRYMSTWFIFDVCSTAPLQFLALLLTNNISELTFRLLNMLRLWRLRRVSS 180
LLVDD KKIAIRY+STWFIFDVCSTAP + +LL T + S L ++ LNMLRLWRLRRVSS
Sbjct: 121 LLVDDAKKIAIRYISTWFIFDVCSTAPFEAFSLLFTKHNSGLGYKALNMLRLWRLRRVSS 180
Query: 181 LFARLEKDIRFNYFWTRCTKLVAVTLFAVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKE 240
LFARLEKDIRFNYFW RC KL +VTLFAVHCAGCFNYLIADRYPDPE+TWIGAVYPNFKE
Sbjct: 181 LFARLEKDIRFNYFWIRCIKLTSVTLFAVHCAGCFNYLIADRYPDPERTWIGAVYPNFKE 240
Query: 241 ETLWNRYVTAMYWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGLTSYIIGNMTNLVV 300
E LW+RYVT++YWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGLTSY+IGNMTNLVV
Sbjct: 241 ENLWDRYVTSIYWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGLTSYLIGNMTNLVV 300
Query: 301 HWTSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIR 360
HWTSRTR+FR+TVR+ SEFATRN LPP I DQMLSH+CLKFKTEGLKQQ+TL GLP+AIR
Sbjct: 301 HWTSRTRDFRDTVRSASEFATRNQLPPRIQDQMLSHLCLKFKTEGLKQQDTLNGLPRAIR 360
Query: 361 SSIAHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSG 420
SSIAHYLFFPI QNVYLFQGVS DFLFQLVS+++AEYFPP+EDVILQ EAPTD+YILVSG
Sbjct: 361 SSIAHYLFFPIAQNVYLFQGVSQDFLFQLVSEVEAEYFPPREDVILQKEAPTDIYILVSG 420
Query: 421 AVDLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQ 480
AVDLI Y+DG D++LGKAVAGD FGEIGVL YRPQ TVRT+ELSQILRLSRTSLMN+IQ
Sbjct: 421 AVDLIAYIDGHDQILGKAVAGDVFGEIGVLCYRPQSLTVRTSELSQILRLSRTSLMNAIQ 480
Query: 481 ANMEDGRIVMNNLFRKLKDQESIGFEYPTTDPGIILHECIGGPTIGSSLS--ARHQDYPY 538
ANMEDG+I+MNNLF+KLK ES GF P DP IL E I G G SLS H P+
Sbjct: 481 ANMEDGQIIMNNLFKKLKGLESSGFTDPHMDPESILREWIDGVPPGGSLSHAGCHDQSPH 540
Query: 539 GDSSMWETRNLNFLGPQAT-DIEASKDQDSTACPVDVNSKVEDGQTELNAANQRGHIEMV 597
GD S+ E R++ LG +AT +A K +ST C +D NS EDGQT L+ A GH+EMV
Sbjct: 541 GDPSIQEARDIGLLGSEATKKSKADKAHESTGCGIDANSAAEDGQTALHVAVCNGHLEMV 600
Query: 598 KVLLEGGRNGNKPDAKGWSPKAPAEQPVNRSMYDLLLSYEN-RTPDEHKVEIMGPEISDN 656
++LLE G N NK DA+GW+PKA AEQ +S+YDLLLSYEN R DEHK+ +G +D
Sbjct: 601 RILLERGANVNKKDARGWTPKALAEQEGKKSIYDLLLSYENRRLLDEHKIHFIGSGAAD- 659
Query: 657 IWNTRRKHRRHEWPDVSKSHSKRESIKLGS-CISSCSSGEVNKSNKKRITIHMPYQNTRT 715
++ H R P+ S K+ S S S + +V K+R+TIH +QN T
Sbjct: 660 CCTSQGLHTRTGGPNFHNSQFKKVSTNSNSGSPSPPGNKDVMTLTKRRVTIHRQFQNAST 719
Query: 716 SQRHLGKLIVLPDSIEELLRIAGEKFGGYKFTKVVNAENAEIDDICVIRDGDHLFLLQNE 775
SQ GKLI+LPDSIEELL+IAG+KFGGY TKVV+A NAEIDDI VIRDGDHLFLLQNE
Sbjct: 720 SQGQFGKLIILPDSIEELLQIAGQKFGGYNPTKVVSAGNAEIDDISVIRDGDHLFLLQNE 779
Query: 776 GET 778
ET
Sbjct: 780 NET 782
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|16516993|gb|AAL24466.1|AF359522_1 inward rectifying potassium channel [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15824823|gb|AAL09479.1|AF359521_1 inward rectifying shaker-like K+ channel [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557325|ref|XP_002519693.1| Potassium channel KAT2, putative [Ricinus communis] gi|223541110|gb|EEF42666.1| Potassium channel KAT2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|166359597|gb|ABY86891.1| K+ channel protein [Populus euphratica] | Back alignment and taxonomy information |
|---|
| >gi|18857685|emb|CAC87141.1| K+ channel protein [Populus tremula x Populus tremuloides] | Back alignment and taxonomy information |
|---|
| >gi|356523521|ref|XP_003530386.1| PREDICTED: potassium channel KAT1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|109942298|emb|CAK50799.1| inwardly rectifying potassium channel subunit [Daucus carota] | Back alignment and taxonomy information |
|---|
| >gi|356546496|ref|XP_003541662.1| PREDICTED: potassium channel KAT1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356557819|ref|XP_003547208.1| PREDICTED: potassium channel KAT2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 784 | ||||||
| TAIR|locus:2005531 | 697 | KAT2 "potassium channel in Ara | 0.700 | 0.787 | 0.729 | 9.4e-244 | |
| TAIR|locus:2170468 | 677 | KAT1 "potassium channel in Ara | 0.650 | 0.753 | 0.768 | 3.3e-241 | |
| TAIR|locus:2043839 | 857 | KT1 "AT2G26650" [Arabidopsis t | 0.608 | 0.556 | 0.617 | 8.3e-177 | |
| TAIR|locus:2127866 | 880 | KT5 "K+ transporter 5" [Arabid | 0.605 | 0.539 | 0.586 | 7.5e-174 | |
| TAIR|locus:2132065 | 802 | KT2/3 "potassium transport 2/3 | 0.598 | 0.584 | 0.523 | 7.1e-145 | |
| TAIR|locus:2005524 | 662 | KAT3 "AT4G32650" [Arabidopsis | 0.599 | 0.709 | 0.485 | 5.1e-123 | |
| TAIR|locus:2075442 | 828 | SKOR "STELAR K+ outward rectif | 0.729 | 0.690 | 0.325 | 5e-87 | |
| TAIR|locus:2169866 | 820 | GORK "gated outwardly-rectifyi | 0.700 | 0.669 | 0.324 | 1.7e-80 | |
| FB|FBgn0263257 | 1853 | cngl "CNG channel-like" [Droso | 0.613 | 0.259 | 0.250 | 4.3e-27 | |
| FB|FBgn0259145 | 1249 | CG42260 [Drosophila melanogast | 0.540 | 0.339 | 0.240 | 1.2e-24 |
| TAIR|locus:2005531 KAT2 "potassium channel in Arabidopsis thaliana 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2136 (757.0 bits), Expect = 9.4e-244, Sum P(2) = 9.4e-244
Identities = 402/551 (72%), Positives = 465/551 (84%)
Query: 1 MSFSCAKNFFQRFCSDELHVESVAHGSFLSSDLLPSLGARINQATKLRRYIISPFNPRYR 60
MS SC +NFF+RFC +E ++++ H SFLS+DLLPSLGARINQ+TKLR++IISPF+PR+R
Sbjct: 1 MSISCTRNFFKRFCVEEYNMDTFKHSSFLSADLLPSLGARINQSTKLRKHIISPFDPRFR 60
Query: 61 AWEMWLVVLVVYSAWICPFEFAFLTYKKDALLIIDNIVNGFFAIDIILTFFVAYLDSQSY 120
WEMWLV+LV+YSAWICPFEFAF+TYKKDAL IIDNIVNGFFAIDIILTFFVAYLDS SY
Sbjct: 61 GWEMWLVILVIYSAWICPFEFAFITYKKDALFIIDNIVNGFFAIDIILTFFVAYLDSHSY 120
Query: 121 LLVDDPKKIAIRYMSTWFIFDVCSTAPLQFLALLLTNNISELTFXXXXXXXXXXXXXXXX 180
LLVD PKKIAIRY+STWF FDVCSTAP Q L+LL N SE+ F
Sbjct: 121 LLVDKPKKIAIRYLSTWFAFDVCSTAPFQSLSLLFKYNGSEIGFRVLSMLRLWRLRRVSS 180
Query: 181 XFARLEKDIRFNYFWTRCTKLVAVTLFAVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKE 240
FARLEKDIRFNYFWTRCTKL++VTLFAVHCAGCF YLIAD+Y DP KTWIGAVYPNFKE
Sbjct: 181 LFARLEKDIRFNYFWTRCTKLISVTLFAVHCAGCFAYLIADQYHDPTKTWIGAVYPNFKE 240
Query: 241 ETLWNRYVTAMYWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGLTSYIIGNMTNLVV 300
++W+RYVTA+YWSITTLTTTGYGDLHAENPREMLF +F+MLFNLG TSY+IGNMTNLVV
Sbjct: 241 TSVWSRYVTALYWSITTLTTTGYGDLHAENPREMLFFVFFMLFNLGFTSYLIGNMTNLVV 300
Query: 301 HWTSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIR 360
HWTSRTRNFR+TVRA SEFA+RN LPP+I DQMLSHICLKFKTEGLKQQE L GLPKAIR
Sbjct: 301 HWTSRTRNFRDTVRAASEFASRNQLPPNIQDQMLSHICLKFKTEGLKQQEALNGLPKAIR 360
Query: 361 SSIAHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSG 420
SSIA+YLFFPIVQNVYLF GVS +FLFQLVSD+DAEYFPP+EDVILQNEAPTDLYILVSG
Sbjct: 361 SSIANYLFFPIVQNVYLFHGVSRNFLFQLVSDIDAEYFPPREDVILQNEAPTDLYILVSG 420
Query: 421 AVDLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQ 480
AVD YV +D+V GKAV GDAFGEIGVL Y PQPFTVRTTELSQILR+S+ SLM++++
Sbjct: 421 AVDFTVYVGEEDQVQGKAVVGDAFGEIGVLCYTPQPFTVRTTELSQILRISKKSLMSAMR 480
Query: 481 ANMEDGRIVMNNLFRKLKDQESIGFEYPTTDPGIILHE-CIGGPTIGSSLSARHQDYPYG 539
A++EDGR++MNNLF KL+ Q+SI + P ++P +L E +GG G +A Q + +
Sbjct: 481 AHVEDGRVIMNNLFMKLRGQQSIAIDDPNSEPESLLKEWLVGGSKTGEG-NASDQGHGHK 539
Query: 540 DSSMWETRNLN 550
+ ++ N++
Sbjct: 540 YLQLHDSENID 550
|
|
| TAIR|locus:2170468 KAT1 "potassium channel in Arabidopsis thaliana 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043839 KT1 "AT2G26650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127866 KT5 "K+ transporter 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132065 KT2/3 "potassium transport 2/3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005524 KAT3 "AT4G32650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075442 SKOR "STELAR K+ outward rectifier" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169866 GORK "gated outwardly-rectifying K+ channel" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263257 cngl "CNG channel-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0259145 CG42260 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q39128 | KAT1_ARATH | No assigned EC number | 0.6253 | 0.8635 | 1.0 | yes | no |
| Q6K3T2 | KAT1_ORYSJ | No assigned EC number | 0.6421 | 0.6377 | 0.6963 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 784 | |||
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 0.0 | |
| pfam00520 | 194 | pfam00520, Ion_trans, Ion transport protein | 1e-29 | |
| pfam11834 | 69 | pfam11834, DUF3354, Domain of unknown function (DU | 3e-29 | |
| cd00038 | 115 | cd00038, CAP_ED, effector domain of the CAP family | 8e-25 | |
| smart00100 | 120 | smart00100, cNMP, Cyclic nucleotide-monophosphate | 7e-23 | |
| pfam00027 | 91 | pfam00027, cNMP_binding, Cyclic nucleotide-binding | 7e-14 | |
| COG0664 | 214 | COG0664, Crp, cAMP-binding proteins - catabolite g | 5e-12 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 6e-12 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-05 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 2e-05 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 5e-05 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 0.003 |
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
Score = 676 bits (1747), Expect = 0.0
Identities = 342/801 (42%), Positives = 445/801 (55%), Gaps = 64/801 (7%)
Query: 29 LSSDLLPSLG-ARINQAT-KLRRYIISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTY 86
LS +LP LG NQ +IISP + RYR WE +VVLV YSAW+ PFE AFL
Sbjct: 29 LSKVILPPLGVPSYNQNHIGSDGWIISPMDSRYRWWETLMVVLVAYSAWVYPFEVAFLNA 88
Query: 87 K-KDALLIIDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIAIRYMSTWFIFDVCST 145
K L I DN+V+ FFA+DI+LTFFVAY+D ++ LLV D KKIA+RY+STWF+ DV ST
Sbjct: 89 SPKRGLEIADNVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKIAVRYLSTWFLMDVAST 148
Query: 146 APLQFLALLLTNNISE-LTFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRCTKLVAV 204
P Q LA L+T + L++ LL +LR WRLRRV LF RLEKDIRF+YFW RC +L++V
Sbjct: 149 IPFQALAYLITGTVKLNLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLLSV 208
Query: 205 TLFAVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKEETLWNRYVTAMYWSITTLTTTGYG 264
TLF VHCAGC YLIADRYP KTWIGAV PNF+E +LW RY++A+YWSITT+TT GYG
Sbjct: 209 TLFLVHCAGCLYYLIADRYPHQGKTWIGAVIPNFRETSLWIRYISAIYWSITTMTTVGYG 268
Query: 265 DLHAENPREMLFDIFYMLFNLGLTSYIIGNMTNLVVHWTSRTRNFRETVRAVSEFATRNH 324
DLHA N EM+F IFYMLFNLGLT+Y+IGNMTNLVV T RT FR ++ A S F RN
Sbjct: 269 DLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVGRNR 328
Query: 325 LPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIRSSIAHYLFFPIVQNVYLFQGVSHD 384
LPP + DQ+L+++CL+FK E L QQ+ + LPK+I SI +LF P+V+ VYLF+GVS +
Sbjct: 329 LPPRLKDQILAYMCLRFKAESLNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKGVSRE 388
Query: 385 FLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGAVDLIHYVDGQDKVLGKAVAGDAF 444
L LV+ M AEY PP+EDVI+QNEAP D+YI+VSG V++I +++V+G GD F
Sbjct: 389 ILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSGEVEIIDSEGEKERVVGTLGCGDIF 448
Query: 445 GEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQANMEDGRIVMNNLFRKLKDQESIG 504
GE+G L RPQ FT RT LSQ+LRL ++L+ ++Q ED +++ N + K+ +
Sbjct: 449 GEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEAMQTRQEDNVVILKNFLQHHKELHDLN 508
Query: 505 FE-----------YPTTDPGIILHECIGGPTIGSSLSARHQDYPYGDSSMWETRNLNFLG 553
P ++ G + L D GDS G
Sbjct: 509 VGDLLGDNGGEHDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSK----------G 558
Query: 554 PQATDIEASKDQDST-------ACPV---DVN-----------------------SKVED 580
I ASK + AC V D N + + D
Sbjct: 559 RTPLHIAASKGYEDCVLVLLKHACNVHIRDANGNTALWNAISAKHHKIFRILYHFASISD 618
Query: 581 GQTE---LNAANQRGHIEMVKVLLEGGRNGNKPDAKGWSPKAPAEQPVNRSMYDLLLSYE 637
L A +R + +K LL+ G N + D +G + A + M LL+
Sbjct: 619 PHAAGDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQVAMAEDHVDMVRLLIMNG 678
Query: 638 NRTPDEHKVEIMGPEISDNIWNTRRKHRRHEWPDVSKSHSKRESIKLGSCISSCSSGEVN 697
+ + P + R D + GS +
Sbjct: 679 ADVDKANTDDDFSPTELRELLQKRELGHSITIVDSVPADEPDLGRDGGSRPGRLQGTSSD 738
Query: 698 KSNKKRITIHM--PYQNTRTSQRHLGKLIVLPDSIEELLRIAGEKFG-GYKFTKVVNAEN 754
+ R++I+ P GKLI LP S+EEL IAGEK G + V N E
Sbjct: 739 NQCRPRVSIYKGHPLLRNERCCNEAGKLINLPPSLEELKAIAGEKLGFDARKAMVTNEEG 798
Query: 755 AEIDDICVIRDGDHLFLLQNE 775
AEID I VIRD D LF++++E
Sbjct: 799 AEIDSIEVIRDNDKLFVVEDE 819
|
Length = 823 |
| >gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein | Back alignment and domain information |
|---|
| >gnl|CDD|221253 pfam11834, DUF3354, Domain of unknown function (DUF3354) | Back alignment and domain information |
|---|
| >gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 784 | |||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 100.0 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 100.0 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 100.0 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 100.0 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 100.0 | |
| PF11834 | 69 | DUF3354: Domain of unknown function (DUF3354); Int | 99.91 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.88 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.84 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 99.79 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.79 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.72 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.64 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 99.63 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.62 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.61 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.58 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.56 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.56 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.56 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.56 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 99.56 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.55 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 99.55 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.55 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.54 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.54 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.53 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.53 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.52 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.52 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.52 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.51 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.51 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.51 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.51 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.51 | |
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 99.5 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.49 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 99.49 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.48 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.47 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.47 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.47 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.47 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.47 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 99.46 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.45 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 99.45 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 99.44 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 99.44 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 99.44 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.44 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.44 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 99.43 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.43 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.43 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.43 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.43 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.43 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.43 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.42 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.42 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 99.41 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.41 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.41 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.41 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.4 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.39 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.37 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 99.36 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.36 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.36 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.35 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.34 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.33 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.33 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.33 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 99.33 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.32 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 99.31 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.3 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.28 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.27 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.27 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.27 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.26 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.25 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.2 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 99.19 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.16 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 99.16 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.16 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.15 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.15 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.12 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.12 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.12 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.08 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.06 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.0 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.99 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.97 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.94 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.94 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 98.92 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.91 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.91 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.89 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 98.88 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.86 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.84 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.84 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.82 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.81 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 98.79 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.77 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.71 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.67 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.65 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.59 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.49 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 98.47 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.46 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.35 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.3 | |
| PF08412 | 77 | Ion_trans_N: Ion transport protein N-terminal; Int | 98.25 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.21 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 98.19 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.17 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.15 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.07 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.01 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.95 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 97.88 | |
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 97.87 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 97.85 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 97.81 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.74 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.64 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.59 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 97.58 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 97.57 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.5 | |
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 97.46 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.42 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.25 | |
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 97.25 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 97.15 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.1 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 96.95 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 96.93 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.82 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 96.78 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.76 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 96.64 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 96.61 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 96.28 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 96.24 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 96.0 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 95.07 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 94.99 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 94.17 | |
| smart00537 | 89 | DCX Domain in the Doublecortin (DCX) gene product. | 93.92 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 93.9 | |
| KOG3614 | 1381 | consensus Ca2+/Mg2+-permeable cation channels (LTR | 93.81 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 93.72 | |
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 93.23 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 92.86 | |
| PF03607 | 60 | DCX: Doublecortin; InterPro: IPR003533 X-linked li | 91.46 | |
| KOG3599 | 798 | consensus Ca2+-modulated nonselective cation chann | 89.14 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 88.7 | |
| PF00060 | 148 | Lig_chan: Ligand-gated ion channel; InterPro: IPR0 | 88.63 | |
| PF08016 | 425 | PKD_channel: Polycystin cation channel; InterPro: | 88.61 | |
| cd01615 | 78 | CIDE_N CIDE_N domain, found at the N-terminus of t | 88.45 | |
| smart00266 | 74 | CAD Domains present in proteins implicated in post | 87.45 | |
| cd01617 | 80 | DCX Ubiquitin-like domain of DCX. DCX The ubiquiti | 87.45 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 87.44 | |
| PF02017 | 78 | CIDE-N: CIDE-N domain; InterPro: IPR003508 This do | 87.18 | |
| cd06538 | 79 | CIDE_N_FSP27 CIDE_N domain of FSP27 proteins. The | 87.03 | |
| cd06539 | 78 | CIDE_N_A CIDE_N domain of CIDE-A proteins. The CID | 85.06 | |
| cd06537 | 81 | CIDE_N_B CIDE_N domain of CIDE-B proteins. The CID | 83.75 | |
| cd06536 | 80 | CIDE_N_ICAD CIDE_N domain of ICAD. The CIDE_N (cel | 83.53 |
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-114 Score=1032.97 Aligned_cols=744 Identities=44% Similarity=0.699 Sum_probs=632.5
Q ss_pred cccCCCCCCCcchhh--chhhhccCCcEeCCCChhHHHHHHHHHHHHHHHHHHHhhhhhcccCCC-ccchhHHHHHHHHH
Q 003951 26 GSFLSSDLLPSLGAR--INQATKLRRYIISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTYKK-DALLIIDNIVNGFF 102 (784)
Q Consensus 26 ~~~~~~~~~~~~~~~--~~~~~~~~~~ii~P~s~~~~~W~~~~~~~~~~~~~~~p~~~~F~~~~~-~~~~~~~~~~~~~f 102 (784)
..++|+.++|++|++ .++..+.++|+|+|+++++++|+++++++++|++|++||+++|....+ ..++++|++++++|
T Consensus 26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~P~~~~~~~Wd~~~~~~~~y~~~~~p~~~~F~~~~~~~~~~~~d~i~~~~F 105 (823)
T PLN03192 26 LRNLSKVILPPLGVPSYNQNHIGSDGWIISPMDSRYRWWETLMVVLVAYSAWVYPFEVAFLNASPKRGLEIADNVVDLFF 105 (823)
T ss_pred hhhcchhhccccCCCccccCccccCCeEECCCCcHHHHHHHHHHHHHHHHHHHHHHHHHeeCCCCCCCeeeHHHHHHHHH
Confidence 447899999999998 356668999999999999999999999999999999999999975443 46789999999999
Q ss_pred HHhhheeeeEeEEeCCCeEEeeChHHHHHHHhhhhhHHHhhhccchHHHHHHHhcC-CchhHHHHHHHHHHHHHHHHHHH
Q 003951 103 AIDIILTFFVAYLDSQSYLLVDDPKKIAIRYMSTWFIFDVCSTAPLQFLALLLTNN-ISELTFRLLNMLRLWRLRRVSSL 181 (784)
Q Consensus 103 ~iDi~l~f~t~y~~~~~~~~v~~~~~i~~~Yl~~~f~~Dlis~lP~~~i~~~~~~~-~~~~~~~il~llrllRl~r~~~~ 181 (784)
++||+++|+++|++++++.+|+||++|+++|+++||++|++|++|++++...+... .....+.+++++|++|+.|+.++
T Consensus 106 ~iDi~l~f~~ay~d~~~~~lV~d~~~I~~~Yl~~~f~~Dlis~lP~~~i~~~~~~~~~~~~~~~~l~llrl~Rl~ri~~~ 185 (823)
T PLN03192 106 AVDIVLTFFVAYIDPRTQLLVRDRKKIAVRYLSTWFLMDVASTIPFQALAYLITGTVKLNLSYSLLGLLRFWRLRRVKQL 185 (823)
T ss_pred HHHHHhheeEEEEeCCCcEEEeCHHHHHHHHHHHhHHHHHHHHhHHHHHHHHhcCCccchHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999899999999999999999999999999998876555432 22245778999999999999999
Q ss_pred HHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCcccccccCCCCCCchHHHHHHHHHHHhhhcccc
Q 003951 182 FARLEKDIRFNYFWTRCTKLVAVTLFAVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKEETLWNRYVTAMYWSITTLTTT 261 (784)
Q Consensus 182 ~~~l~~~~~~~~~~~~~~~li~~~l~~~h~~aci~y~i~~~~~~~~~~Wi~~~~~~~~~~~~~~~Y~~slyw~i~tltTv 261 (784)
+.++++..++++.+.+++++++++++++||+||+||+++..++.++.+|++...+++.+.++|.+|+.|+||+++|||||
T Consensus 186 ~~~le~~~~~~~~~~~~~kli~~~l~~~H~~aC~~y~i~~~~~~~~~~Wi~~~~~~~~~~s~~~~Yi~slYwai~TmtTV 265 (823)
T PLN03192 186 FTRLEKDIRFSYFWIRCARLLSVTLFLVHCAGCLYYLIADRYPHQGKTWIGAVIPNFRETSLWIRYISAIYWSITTMTTV 265 (823)
T ss_pred HHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCchHHHhhhccccCcHHHHHHHHHHHHHHHHhhc
Confidence 99999999999999999999999999999999999999987777888999987788999999999999999999999999
Q ss_pred ccCCcccCCchhHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhHhHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHH
Q 003951 262 GYGDLHAENPREMLFDIFYMLFNLGLTSYIIGNMTNLVVHWTSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKF 341 (784)
Q Consensus 262 GyGDi~p~~~~e~i~~i~~~l~g~~~~a~~ig~i~~ii~~~~~~~~~~~~~~~~~~~~m~~~~l~~~l~~~v~~~~~~~~ 341 (784)
||||++|.|..|++|++++|++|+++|||++|+|++++.+.++++++|+++++.+++||+++++|+++|+||++|++++|
T Consensus 266 GYGDi~p~t~~E~i~~i~~ml~g~~~~a~~ig~i~~li~~~~~~~~~f~~~~~~~~~ym~~~~lp~~lq~ri~~y~~~~~ 345 (823)
T PLN03192 266 GYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVGRNRLPPRLKDQILAYMCLRF 345 (823)
T ss_pred cCCCcCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCcHHHHHhcCCHHHHHHHHHHhhhhhhccccccccCCHHHHHHHHHcCcccccccCCeEEecCCCCCeEEEEEecE
Q 003951 342 KTEGLKQQETLVGLPKAIRSSIAHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGA 421 (784)
Q Consensus 342 ~~~~~~~~~~l~~Lp~~Lr~~i~~~~~~~~l~~~~lf~~~s~~~l~~l~~~~~~~~~~~~e~I~~~g~~~~~ly~I~~G~ 421 (784)
+.++.+++++++.||++||.+|.++++.++++++++|+++|++++.+|+..+++++|+|||.|+.+||.++++|||++|+
T Consensus 346 ~~~~~~~~~~l~~Lp~~Lr~~i~~~l~~~~l~~~~lF~~~s~~~l~~L~~~~~~~~~~pge~I~~qge~~~~lY~I~~G~ 425 (823)
T PLN03192 346 KAESLNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSGE 425 (823)
T ss_pred hhccccHHHHHHHcCHHHHHHHHHHHHHHHHhhCcchhcCCHHHHHHHHHhhheeeeCCCCEEEECCCCCceEEEEEecE
Confidence 98889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEeecCceeEEEEecCCCeeehhhhhcCCCceeEEEEccceEEEEecHHHHHHHHHhcHHHHHHHHHHHHHHHHhhc
Q 003951 422 VDLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQANMEDGRIVMNNLFRKLKDQE 501 (784)
Q Consensus 422 v~v~~~~~g~~~~~~~l~~G~~fGe~~~l~~~~~~~tv~a~~~~~l~~l~~~~f~~ll~~~p~~~~~~~~~l~~~l~~~~ 501 (784)
|+++...+|++.++..+++|++|||.+++++.|++++++|.+.|++++|++++|.++++.+|++...+++++.+++++.+
T Consensus 426 V~i~~~~~~~e~~l~~l~~Gd~FGE~~~l~~~p~~~t~ra~~~s~ll~l~~~~f~~ll~~~p~d~~~i~~~~l~~~~~l~ 505 (823)
T PLN03192 426 VEIIDSEGEKERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEAMQTRQEDNVVILKNFLQHHKELH 505 (823)
T ss_pred EEEEEecCCcceeeEEccCCCEecchHHhcCCCCCCeEEEcccEEEEEEEHHHHHHHHHHhhHHHHHHHHHHHHHhhhhc
Confidence 99997677888899999999999999999999999999999999999999999999999999999999999999887755
Q ss_pred ccccc---------------------CCCCChhhhhhhhc--cCCCCCCCCCCCCCCCCCCC--------Cccccccccc
Q 003951 502 SIGFE---------------------YPTTDPGIILHECI--GGPTIGSSLSARHQDYPYGD--------SSMWETRNLN 550 (784)
Q Consensus 502 ~~~~~---------------------~~~~~~~~~l~~Ll--g~~~~~~d~~g~t~l~~~~~--------~~~~~~~~~~ 550 (784)
++... ++..++...++.++ |+|+|..|.+|+||||.|.. .+++.|++++
T Consensus 506 ~l~v~~ll~~~~~~~~~~~~~~~L~~Aa~~g~~~~l~~Ll~~G~d~n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~gadin 585 (823)
T PLN03192 506 DLNVGDLLGDNGGEHDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKHACNVH 585 (823)
T ss_pred cccHHHHHhhcccccCCccchhHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcChHHHHHHHHhcCCCCC
Confidence 43211 22335666677777 89999999999999998543 3567788887
Q ss_pred cc---CCCchhhhh-hcCcc----cccCCCCCCCCCCCCccHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCchhhhc
Q 003951 551 FL---GPQATDIEA-SKDQD----STACPVDVNSKVEDGQTELNAANQRGHIEMVKVLLEGGRNGNKPDAKGWSPKAPAE 622 (784)
Q Consensus 551 ~~---g~~~l~~a~-~~~~~----ll~~g~~~~~~d~~g~T~Lh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~tpl~~A~ 622 (784)
.. |.||+|.|| .++.+ |++.|+..+ +.+|.||||.||..|+.+++++|+++|||+|.+|.+|+||||+|+
T Consensus 586 ~~d~~G~TpL~~A~~~g~~~iv~~L~~~~~~~~--~~~~~~~L~~Aa~~g~~~~v~~Ll~~Gadin~~d~~G~TpLh~A~ 663 (823)
T PLN03192 586 IRDANGNTALWNAISAKHHKIFRILYHFASISD--PHAAGDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQVAM 663 (823)
T ss_pred CcCCCCCCHHHHHHHhCCHHHHHHHHhcCcccC--cccCchHHHHHHHhCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHH
Confidence 76 999999999 56666 666666544 356789999999999999999999999999999999999999999
Q ss_pred cCCChhHHHHHHhcCCCCCCCccccccCCCcccc-cccccccccCccCCCCCcCccchhh-cccCCCccCC---CCCccc
Q 003951 623 QPVNRSMYDLLLSYENRTPDEHKVEIMGPEISDN-IWNTRRKHRRHEWPDVSKSHSKRES-IKLGSCISSC---SSGEVN 697 (784)
Q Consensus 623 ~~g~~~i~~lL~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~-~~~~~~~s~~---~~~~~~ 697 (784)
..||.+++++|+++||+......-. ...+.+ .+..+..+.... ........... ....+..+.. ......
T Consensus 664 ~~g~~~iv~~Ll~~GAdv~~~~~~g---~~t~~~l~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 738 (823)
T PLN03192 664 AEDHVDMVRLLIMNGADVDKANTDD---DFSPTELRELLQKRELGHS--ITIVDSVPADEPDLGRDGGSRPGRLQGTSSD 738 (823)
T ss_pred HCCcHHHHHHHHHcCCCCCCCCCCC---CCCHHHHHHHHHHhhhCce--eeeccCCCccccccccccccccccccccccc
Confidence 9999999999999999832211100 000000 000000000000 00000000000 0000000000 011122
Q ss_pred CCCcceEEEeCCCCCCccc--cccCcEEEEccccHHHHHHHHhhhcCCC-cceeeeeCCCceeeeeeeeecCCEEEEEec
Q 003951 698 KSNKKRITIHMPYQNTRTS--QRHLGKLIVLPDSIEELLRIAGEKFGGY-KFTKVVNAENAEIDDICVIRDGDHLFLLQN 774 (784)
Q Consensus 698 ~~~~~Rvti~~~~~~~~~~--~~~~gk~~~~p~s~~ell~~a~~~~~~~-~~~~~~~~~ga~id~i~~ird~~~l~~~~~ 774 (784)
.....|++++..||..... ..+.|+++++|.|++||.++|++|||+. .-+.+.++||||||||+|||||||||+|++
T Consensus 739 ~~~~~~~~~~~~~p~~~~~~~~~~~g~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 818 (823)
T PLN03192 739 NQCRPRVSIYKGHPLLRNERCCNEAGKLINLPPSLEELKAIAGEKLGFDARKAMVTNEEGAEIDSIEVIRDNDKLFVVED 818 (823)
T ss_pred cccCceEEEecCCCcccccccccccCeEEeCCccHHHHHHHHHHHhCCCcccceeecCCCceeeeeEEEecCCEEEEeec
Confidence 3335699999999965533 5689999999999999999999999953 334689999999999999999999999988
Q ss_pred CC
Q 003951 775 EG 776 (784)
Q Consensus 775 ~~ 776 (784)
++
T Consensus 819 ~~ 820 (823)
T PLN03192 819 ED 820 (823)
T ss_pred cc
Confidence 54
|
|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >PF08412 Ion_trans_N: Ion transport protein N-terminal; InterPro: IPR013621 This domain is found to the N terminus of IPR005821 from INTERPRO in voltage- and cyclic nucleotide-gated K/Na ion channels | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00537 DCX Domain in the Doublecortin (DCX) gene product | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3614 consensus Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03607 DCX: Doublecortin; InterPro: IPR003533 X-linked lissencephaly is a severe brain malformation affecting males | Back alignment and domain information |
|---|
| >KOG3599 consensus Ca2+-modulated nonselective cation channel polycystin [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory | Back alignment and domain information |
|---|
| >PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys | Back alignment and domain information |
|---|
| >cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45) | Back alignment and domain information |
|---|
| >smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation | Back alignment and domain information |
|---|
| >cd01617 DCX Ubiquitin-like domain of DCX | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >PF02017 CIDE-N: CIDE-N domain; InterPro: IPR003508 This domain consists of caspase-activated (CAD) nucleases, which induce DNA fragmentation and chromatin condensation during apoptosis, and the cell death activator proteins CIDE-A and CIDE-B, which are inhibitors of CAD nuclease | Back alignment and domain information |
|---|
| >cd06538 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins | Back alignment and domain information |
|---|
| >cd06539 CIDE_N_A CIDE_N domain of CIDE-A proteins | Back alignment and domain information |
|---|
| >cd06537 CIDE_N_B CIDE_N domain of CIDE-B proteins | Back alignment and domain information |
|---|
| >cd06536 CIDE_N_ICAD CIDE_N domain of ICAD | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 784 | ||||
| 2ptm_A | 198 | Structure And Rearrangements In The Carboxy-Termina | 3e-10 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-05 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-05 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 2e-05 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-05 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-05 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 4e-05 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 4e-05 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-05 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-05 | ||
| 3r6s_A | 247 | Crystal Structure Of Glxr Transcription Factor From | 6e-05 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 8e-05 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-04 | ||
| 2qvs_B | 310 | Crystal Structure Of Type Iia Holoenzyme Of Camp-De | 2e-04 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-04 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 3e-04 | ||
| 3idb_B | 161 | Crystal Structure Of (108-268)riib:c Holoenzyme Of | 5e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 5e-04 | ||
| 3i59_A | 249 | Crystal Structure Of Mtbcrp In Complex With N6-Camp | 7e-04 | ||
| 3idc_B | 164 | Crystal Structure Of (102-265)riib:c Holoenzyme Of | 8e-04 | ||
| 3tnq_A | 416 | Structure And Allostery Of The Pka Riib Tetrameric | 8e-04 | ||
| 3tnp_B | 416 | Structure And Allostery Of The Pka Riib Tetrameric | 8e-04 | ||
| 3i54_A | 249 | Crystal Structure Of Mtbcrp In Complex With Camp Le | 8e-04 |
| >pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 | Back alignment and structure |
|
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|3R6S|A Chain A, Crystal Structure Of Glxr Transcription Factor From Corynebacterium Glutamicum With Camp Length = 247 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|3I59|A Chain A, Crystal Structure Of Mtbcrp In Complex With N6-Camp Length = 249 | Back alignment and structure |
| >pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 | Back alignment and structure |
| >pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 | Back alignment and structure |
| >pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 | Back alignment and structure |
| >pdb|3I54|A Chain A, Crystal Structure Of Mtbcrp In Complex With Camp Length = 249 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 | Back alignment and structure |
|---|
Score = 116 bits (294), Expect = 4e-30
Identities = 39/196 (19%), Positives = 86/196 (43%), Gaps = 3/196 (1%)
Query: 303 TSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIRSS 362
S +R +RE ++ V E+ LP H+ +++L + +++ + ++ + ++IR
Sbjct: 4 DSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQD 63
Query: 363 IAHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGAV 422
+A+Y +V +V F G +F+ ++V+ ++ E F P + VI + ++ + G V
Sbjct: 64 VANYNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIV 123
Query: 423 DLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQAN 482
D+ + + G FGEI +L + +V+ + LS +
Sbjct: 124 DI---IMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETYCTLFSLSVQHFNQVLDEF 180
Query: 483 MEDGRIVMNNLFRKLK 498
+ + R+L
Sbjct: 181 PAMRKTMEEIAVRRLT 196
|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Length = 343 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Length = 340 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 784 | |||
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 100.0 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 99.97 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 99.97 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 99.97 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.93 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.87 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.86 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 99.81 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 99.77 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 99.76 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 99.76 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.74 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.74 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.74 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.74 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.74 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 99.74 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 99.73 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 99.73 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 99.72 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 99.72 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.71 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 99.71 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 99.71 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.7 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.7 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 99.69 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 99.69 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.69 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.69 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.69 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.68 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.68 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 99.68 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.68 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.68 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 99.68 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.68 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.67 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 99.67 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.67 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.67 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 99.67 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.66 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.66 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.66 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.66 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.65 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.65 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 99.65 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.64 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.64 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.64 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.64 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.63 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 99.63 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.63 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 99.63 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.63 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.63 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.62 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 99.62 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.62 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.62 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 99.62 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.62 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.62 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.62 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.62 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.62 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.62 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.61 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.61 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.61 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 99.6 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.6 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.6 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.6 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.6 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.6 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.6 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.59 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.59 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.59 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.59 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.59 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.59 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.59 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.59 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 99.58 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.58 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.58 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.58 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.58 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 99.57 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 99.57 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 99.57 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.57 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.57 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.56 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 99.56 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.56 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.56 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.56 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.56 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.56 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.56 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.56 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.56 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.56 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.55 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.55 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.55 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.55 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.55 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.55 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.55 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.55 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.55 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.54 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.54 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.54 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.54 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.54 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.54 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.54 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.53 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.53 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.53 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.53 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.52 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.52 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.52 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.52 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.52 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 99.51 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.51 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.51 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.51 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.51 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.5 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.5 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.5 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.49 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.49 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.49 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.49 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 99.49 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.48 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.48 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.48 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 99.47 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.47 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.47 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.46 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.46 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.46 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.44 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.44 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.43 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.4 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.39 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 99.38 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.38 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.35 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.34 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.32 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.31 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 99.31 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.3 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.29 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.28 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 99.27 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.27 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.22 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.2 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.19 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.13 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.05 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.02 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 98.97 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.94 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.9 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 98.84 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 98.82 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 98.79 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 98.76 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.75 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 98.74 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.57 | |
| 2kyh_A | 147 | KVAP, voltage-gated potassium channel; ION channel | 98.41 | |
| 1ors_C | 132 | Potassium channel; voltage-dependent, voltage sens | 98.35 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 98.33 | |
| 2dnf_A | 108 | Doublecortin domain-containing protein 2; structur | 97.25 | |
| 1mg4_A | 113 | Doublecortin, doublecortin-like kinase (N-terminal | 87.54 | |
| 2eel_A | 91 | Cell death activator CIDE-A; CIDE-N domain, cell d | 85.13 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 81.75 |
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-38 Score=346.85 Aligned_cols=347 Identities=17% Similarity=0.204 Sum_probs=141.9
Q ss_pred eCCCChhHHHHHHHHHHHHHHHHHHHhhhhhcccCCC--ccchhHHHHHHHHHHHhhheeeeEeEEeCCCeEEeeChHHH
Q 003951 52 ISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTYKK--DALLIIDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKI 129 (784)
Q Consensus 52 i~P~s~~~~~W~~~~~~~~~~~~~~~p~~~~F~~~~~--~~~~~~~~~~~~~f~iDi~l~f~t~y~~~~~~~~v~~~~~i 129 (784)
+.|+|+. ++.+++++++.+++++..+.......+ ..+..++.++.++|++|+++++..+ +. +
T Consensus 3 ~~p~s~~---f~~~~~~~i~ls~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~f~~e~~~r~~~~---~~-------~--- 66 (355)
T 3beh_A 3 VLPFLRI---YAPLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKR---RA-------G--- 66 (355)
T ss_dssp ----CCS---SSSHHHHHHHHHHHHHHHHTSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CS-------C---
T ss_pred CCchhHH---HHHHHHHHHHHHHHHHHHHcccchhhhHHHHHHHHHhHHHHHHHHHHHHhcccc---cc-------c---
Confidence 4677774 467777777777777777643221111 2234556666677899999998432 11 0
Q ss_pred HHHHh-hhhhHHHhhhc-cchHHHHHHHhcCCchhHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHHHH
Q 003951 130 AIRYM-STWFIFDVCST-APLQFLALLLTNNISELTFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRCTKLVAVTLF 207 (784)
Q Consensus 130 ~~~Yl-~~~f~~Dlis~-lP~~~i~~~~~~~~~~~~~~il~llrllRl~r~~~~~~~l~~~~~~~~~~~~~~~li~~~l~ 207 (784)
..|. +.|.++|++++ +|+..+. .. .. ...+++|++|++|+.|..+.++.+...... ....+..+++.+++
T Consensus 67 -~~~~~~~~~i~Dl~~i~~p~~~~~--~~-~~--~~~r~lr~~R~lrl~r~~~~~~~l~~~l~~--~~~~l~~~~~~~~~ 138 (355)
T 3beh_A 67 -VVRDRTPKIAIDVLAVLVPLAAFL--LD-GS--PDWSLYCAVWLLKPLRDSTFFPVLGRVLAN--EARNLIGVTTLFGV 138 (355)
T ss_dssp -SSCCCHHHHHHHHHHHHHHHHHHH--SC-CS--GGGGGGGGGGGSHHHHTCSSHHHHHHHHHH--THHHHHHHHHHHHH
T ss_pred -ceeccCcchHHHHHHHHHHHHHHH--hc-cc--hhHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHH
Confidence 1233 56789999998 6885432 11 11 123455566666665554444444433221 12345666677778
Q ss_pred HHHHHHHHHHHHhhcCCCCCCcccccccCCCCCCchHHHHHHHHHHHhhhccccccCCcccCCchhHHHHHHHHHHHHHH
Q 003951 208 AVHCAGCFNYLIADRYPDPEKTWIGAVYPNFKEETLWNRYVTAMYWSITTLTTTGYGDLHAENPREMLFDIFYMLFNLGL 287 (784)
Q Consensus 208 ~~h~~aci~y~i~~~~~~~~~~Wi~~~~~~~~~~~~~~~Y~~slyw~i~tltTvGyGDi~p~~~~e~i~~i~~~l~g~~~ 287 (784)
++|++||++|.++... +.+.+..|.+|+||+++||||+||||++|.|+.|+++++++|++|+++
T Consensus 139 ~~~~~a~~~~~~e~~~----------------~~~~f~~~~~s~y~~~~t~ttvGygd~~p~t~~~~~~~~~~~~~g~~~ 202 (355)
T 3beh_A 139 VLFAVALAAYVIERDI----------------QPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGI 202 (355)
T ss_dssp HHHHHHHHHHHHHTTT----------------CHHHHSSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhhcCC----------------CCcccccHHHHHHHHHhheeecCCCCCCCCChhHHHHHHHHHHHHHHH
Confidence 8899999999987421 112345699999999999999999999999999999999999999999
Q ss_pred HHHHHhhHHHHHHHHhHhHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHhhcCCcHHHHHhcCCHHHHHHHHHHh
Q 003951 288 TSYIIGNMTNLVVHWTSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIRSSIAHYL 367 (784)
Q Consensus 288 ~a~~ig~i~~ii~~~~~~~~~~~~~~~~~~~~m~~~~l~~~l~~~v~~~~~~~~~~~~~~~~~~l~~Lp~~Lr~~i~~~~ 367 (784)
+++++|.+++.+.+..++ ++++ -
T Consensus 203 ~~~~~~~i~~~~~~~~~~----------------------------~~~~-----------------------------~ 225 (355)
T 3beh_A 203 FGLWAGILATGFYQEVRR----------------------------GDFV-----------------------------R 225 (355)
T ss_dssp HHHHHHHHHHHHHHHHHH----------------------------HHHH-----------------------------H
T ss_pred HHHHHHHHHHHHHHHHHH----------------------------Hhhc-----------------------------c
Confidence 999999998766432110 0000 0
Q ss_pred hhhhhccccccccCCHHHHHHHHHcCcccccccCCeEEecCCCCCeEEEEEecEEEEEEeecCceeEEEEecCCCeeehh
Q 003951 368 FFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGAVDLIHYVDGQDKVLGKAVAGDAFGEI 447 (784)
Q Consensus 368 ~~~~l~~~~lf~~~s~~~l~~l~~~~~~~~~~~~e~I~~~g~~~~~ly~I~~G~v~v~~~~~g~~~~~~~l~~G~~fGe~ 447 (784)
..+.++++++|++++++++++++..++.+.|+|||.|+++||.++++|+|.+|.|+++... ...+++|++|||.
T Consensus 226 ~~~~l~~~~lf~~ls~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~~~------~~~l~~G~~fGe~ 299 (355)
T 3beh_A 226 NWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPN------PVELGPGAFFGEM 299 (355)
T ss_dssp HHC-----------------------------------------------------------------------------
T ss_pred cchhhhcccccccCCHHHHHHHHHhceEEEECCCCEEEeCCCcCceEEEEEeeEEEEEECC------eeEECCCCEEeeh
Confidence 2467888999999999999999999999999999999999999999999999999998432 2578999999999
Q ss_pred hhhcCCCceeEEEEccceEEEEecHHHHHHHHHhcHHHHHHHHHHHHHHHHhhc
Q 003951 448 GVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQANMEDGRIVMNNLFRKLKDQE 501 (784)
Q Consensus 448 ~~l~~~~~~~tv~a~~~~~l~~l~~~~f~~ll~~~p~~~~~~~~~l~~~l~~~~ 501 (784)
+++.+.|++++++|.++|+++.+++++|.++++++|++.+.+.+.+.+|+++..
T Consensus 300 ~~l~~~~~~~~~~A~~~~~l~~i~~~~f~~ll~~~p~~~~~l~~~l~~rl~~~~ 353 (355)
T 3beh_A 300 ALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAA 353 (355)
T ss_dssp ------------------------------------------------------
T ss_pred HHhCCCCcceEEEECccEEEEEEeHHHHHHHHHHCHHHHHHHHHHHHHHHHhhc
Confidence 999999999999999999999999999999999999999999999988887643
|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >2dnf_A Doublecortin domain-containing protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mg4_A Doublecortin, doublecortin-like kinase (N-terminal domain); DCX domain, microtubule bundling, cortex development, transferase; 1.50A {Homo sapiens} SCOP: d.15.11.1 PDB: 1mfw_A 1mjd_A 2bqq_A 2xrp_I* | Back alignment and structure |
|---|
| >2eel_A Cell death activator CIDE-A; CIDE-N domain, cell death- inducing DFFA-like effector A, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 784 | ||||
| d1q3ea_ | 193 | b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu | 2e-15 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 7e-13 | |
| d1cx4a1 | 136 | b.82.3.2 (A:130-265) Regulatory subunit of Protein | 6e-12 | |
| d1ne6a1 | 136 | b.82.3.2 (A:109-244) Regulatory subunit of Protein | 2e-11 | |
| d1cx4a2 | 147 | b.82.3.2 (A:266-412) Regulatory subunit of Protein | 5e-11 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 5e-10 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 6e-09 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 2e-08 | |
| d1o7fa2 | 155 | b.82.3.2 (A:13-167) Regulatory domain of Epac2, do | 2e-08 | |
| d2gaua2 | 142 | b.82.3.2 (A:10-151) Transcriptional regulator PG03 | 3e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.002 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.003 | |
| d1ne6a2 | 132 | b.82.3.2 (A:245-376) Regulatory subunit of Protein | 7e-08 | |
| d1wgpa_ | 137 | b.82.3.2 (A:) Probable cyclic nucleotide-gated ion | 8e-08 | |
| d1o7fa3 | 124 | b.82.3.2 (A:322-445) Regulatory domain of Epac2, d | 1e-07 | |
| d1vp6a_ | 133 | b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo | 2e-07 | |
| d1i5za2 | 132 | b.82.3.2 (A:6-137) Catabolite gene activator prote | 3e-07 | |
| d1zyba2 | 147 | b.82.3.2 (A:1-147) Probable transcription regulato | 8e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-04 | |
| d2oz6a2 | 134 | b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei | 3e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-04 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 7e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-04 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.003 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 6e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 9e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 9e-04 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-04 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.001 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 6e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.001 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.002 |
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: cAMP-binding domain-like family: cAMP-binding domain domain: HCN pacemaker channel species: Mouse (Mus musculus) [TaxId: 10090]
Score = 73.1 bits (178), Expect = 2e-15
Identities = 34/195 (17%), Positives = 78/195 (40%), Gaps = 4/195 (2%)
Query: 304 SRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIRSSI 363
S R ++E + V ++ + + LP ++ + +++ + + L L +R I
Sbjct: 2 SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEI 61
Query: 364 AHYLFFPIVQNVYLFQGVSHDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGAVD 423
++ +V ++ LF +F+ +++ + E F P + +I + +Y + G V
Sbjct: 62 VNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVS 121
Query: 424 LIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTTELSQILRLSRTSLMNSIQANM 483
++ + K G FGEI +L + +VR ++ LS + ++
Sbjct: 122 VLT----KGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP 177
Query: 484 EDGRIVMNNLFRKLK 498
R +L
Sbjct: 178 MMRRAFETVAIDRLD 192
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 784 | |||
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 99.97 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.78 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.78 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 99.76 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.76 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.76 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 99.74 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.74 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 99.73 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 99.7 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.7 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.69 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.67 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 99.67 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 99.66 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.65 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.65 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.65 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.63 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 99.62 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.61 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 99.61 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.61 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 99.6 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.6 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.56 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.54 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.53 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.53 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 99.48 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.48 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.48 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.46 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.44 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.4 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.38 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.37 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.36 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.36 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.35 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.35 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.35 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.34 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.32 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.32 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.32 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.3 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.24 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.23 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.18 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.07 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 98.99 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.93 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.19 | |
| d1orsc_ | 132 | Potassium channel KVAP {Archaeon Aeropyrum pernix | 98.1 | |
| d1mg4a_ | 101 | Doublecortin-like kinase Dclk {Human (Homo sapiens | 91.56 | |
| d2bgca2 | 131 | Listeriolysin regulatory protein PrfA, N-terminal | 91.06 | |
| d1f2ri_ | 100 | Inhibitor of caspase-activated DNase (ICAD), DFF45 | 90.26 | |
| d1d4ba_ | 122 | Cell death-inducing effector B (CIDE-B), N-termina | 85.23 |
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: cAMP-binding domain-like family: cAMP-binding domain domain: HCN pacemaker channel species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97 E-value=1.9e-30 Score=254.25 Aligned_cols=192 Identities=18% Similarity=0.331 Sum_probs=181.3
Q ss_pred hHhHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHhhcCCcHHHHHhcCCHHHHHHHHHHhhhhhhccccccccCC
Q 003951 303 TSRTRNFRETVRAVSEFATRNHLPPHIHDQMLSHICLKFKTEGLKQQETLVGLPKAIRSSIAHYLFFPIVQNVYLFQGVS 382 (784)
Q Consensus 303 ~~~~~~~~~~~~~~~~~m~~~~l~~~l~~~v~~~~~~~~~~~~~~~~~~l~~Lp~~Lr~~i~~~~~~~~l~~~~lf~~~s 382 (784)
++..++|++++..+++||+.+++|++|+.||++|+++.|+.++.+++++++.||+.|+.++..+++.++++++|+|++++
T Consensus 1 ds~~~~f~~~~~~i~~~m~~~~i~~~l~~rv~~y~~~~~~~~~~~~~~i~~~lp~~l~~~i~~~~~~~~l~~~~~F~~~~ 80 (193)
T d1q3ea_ 1 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANAD 80 (193)
T ss_dssp CHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHSCHHHHHHHHHHHTHHHHHHCHHHHTSC
T ss_pred ChhHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHhhcccccHHHHHHHCCcchhHHHHHHHHHHHHhcchHHHhhh
Confidence 35678999999999999999999999999999999999988889999999999999999999999999999999999999
Q ss_pred HHHHHHHHHcCcccccccCCeEEecCCCCCeEEEEEecEEEEEEeecCceeEEEEecCCCeeehhhhhcCCCceeEEEEc
Q 003951 383 HDFLFQLVSDMDAEYFPPKEDVILQNEAPTDLYILVSGAVDLIHYVDGQDKVLGKAVAGDAFGEIGVLYYRPQPFTVRTT 462 (784)
Q Consensus 383 ~~~l~~l~~~~~~~~~~~~e~I~~~g~~~~~ly~I~~G~v~v~~~~~g~~~~~~~l~~G~~fGe~~~l~~~~~~~tv~a~ 462 (784)
+.++.+|+..++.+.|.|||+|+.+||.++.+|||.+|.|+++. +++. ...+++|++|||.+++.+.+++++++|.
T Consensus 81 ~~~l~~l~~~~~~~~~~~g~~I~~~g~~~~~ly~i~~G~v~v~~--~~~~--~~~l~~G~~fGe~~~~~~~~~~~~~~a~ 156 (193)
T d1q3ea_ 81 PNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLT--KGNK--EMKLSDGSYFGEICLLTRGRRTASVRAD 156 (193)
T ss_dssp HHHHHHHHTTCEEEEECTTCEEECTTSBCCEEEEEEECCEEEEC---CCC--EEEECTTCEECHHHHHHCSBCSSEEEES
T ss_pred HHHHHHHHHHHHHHhhccCceecccCCCCcceeEeeeeeEEeec--CCcc--eeeeccceeeeeeeccCCCcccccceec
Confidence 99999999999999999999999999999999999999999984 2222 4578999999999999999999999999
Q ss_pred cceEEEEecHHHHHHHHHhcHHHHHHHHHHHHHHHH
Q 003951 463 ELSQILRLSRTSLMNSIQANMEDGRIVMNNLFRKLK 498 (784)
Q Consensus 463 ~~~~l~~l~~~~f~~ll~~~p~~~~~~~~~l~~~l~ 498 (784)
++|+++.|++++|.++++.+|++.+.+...+.+||+
T Consensus 157 ~~~~l~~l~~~~f~~ll~~~p~~~~~~~~~~~~RL~ 192 (193)
T d1q3ea_ 157 TYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLD 192 (193)
T ss_dssp SCEEEEEEEHHHHHHHHHHSGGGHHHHHHHHHHHHT
T ss_pred CceEEEEEeHHHHHHHHHHCHHHHHHHHHHHHHHcC
Confidence 999999999999999999999999999999988875
|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1mg4a_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1f2ri_ d.15.2.1 (I:) Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d4ba_ d.15.2.1 (A:) Cell death-inducing effector B (CIDE-B), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|