Citrus Sinensis ID: 003990

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRNEGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLRRKKSN

cEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEEcEEEEcccccHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHcccccccccccEEcccccEEEcHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHcccccEEEcccEEEEEEEEccccccEEEEEEEEEEEEccEEEEEEcccEEEEcccccccHHHHHHccccccccccccccccccEEEEEEccccccccccHHHHcccccccEEEEEcccccccccccccEEcccccccHHHHccccccccHHHHHHHcccccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc

cEEEEccEcccHHcccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHccHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHEccccccHHHHHHHHccccccccccccccccHcccccccccccccccccHccEEEEccccHHHHHHHHHcccEEEccccccccccccccccEEEEEEEEEEccEHHHHHHHHHHHHcccEEEEEccccccccHHccccccccHHHEEcccccccccccEEEEccccEEccccHEcEEEEEcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEcEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEcccEEEEEccccccHHHHHHcccccccccccHccccEEEEEEccccccccccccHHcccHccccEEEEcccccccccccccEEEEcccccccccHEEEccccccccHHHHHHHcccEEEEEcccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccEEEccccccccccccccccEEEccccEEEEEEcEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccc

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDtflpavdvktaasiDKDIADFFRAsasaagtperlggLMSERLKHPKKWLVRLCLWLLSTCIgslvlcgrycfsskfpymhsftqlpqkkrdAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVneknenlswkaigykgpdpefktksMQRKTlrneglndddddegqnddgheeeaelygplykglinmqlprnivadslrqvgfpvsvrnkrnaapssiaspslvikCDAVvvgsgsgggLIAGVLAKAGYKVLVLEKGsycarsnlsllegkTMDQMYLAGGMLATDDMGVILLAGstvgggstinwsasiktpkhvANEWCDEYELKLFESDLYKEAMEVVCERMgvqseveeegfnNAVLRRGCkelgypvnniprnsppdhycgwcclgckdgskkgtseTWLVDLVnsgnsailpgcEAIEVLHKKrrdrnvatgVAFEFQYMgakdicvvESKVTIVACgalstpnllkrsglknanigknlhlhpvtmawgyfpktsssgewpeekktsyEGGIMTAMSttvgnfgksgygaviqtpalhpgmfsslmpwvsgadiklrmckfsrTAHIFVLArdqgsgtvnspysISYQMEAMDEENLKKGIEKILRILAAAGaeeigthhckgkiinvkkASSEEFERFVKeessrplrdlstplssahqmgscrmgidpktSVVNQMGETWGVEGLYladtsvfptalgvnpmVTVQAIAYCTAQSVLDVLRRKKSN

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRAsasaagtperLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVneknenlswkaigykgpdpefktksmQRKTLrneglndddddegQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKrnaapssiaspslvIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGvqseveeegfnNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVnsgnsailPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGAlstpnllkrsgLKNANIGKNLHLHPVTMAWGYfpktsssgewpEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFvlardqgsgtvnSPYSISYQMEAMDEENLKKGIEKILRILAAAGaeeigthhckgkiinvkkasSEEFERfvkeessrplrdlstplssahqmgscrMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLRRKKSN

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRneglndddddegqnddgheeeAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDavvvgsgsgggliagvlaKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLRRKKSN

*********KETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRAS************LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGY*****************************************LYGPLYKGLINMQLPRNIVADSLRQVGFPVSVR**********ASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFP*****************GGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQM******NLKKGIEKILRILAAAGAEEIGTHHCKGKIINVK******************************************TSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVL******

*VVE***IDKETLQLW*********SLSSQEMESLSALCDTFLPAVDVK*****D******FR******GTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRNEGLNDDDDDE**********AELYGPLYKGLINMQLPRNIVADSLRQVGFPVSV****************VIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARD******NSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSV***L******

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRNEGLN***************EAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKT***********TSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSE***************************GSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLRRKKSN

MVVELGSIDKETLQLWGEENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKT********************************LYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRN**********SPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLRR****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		781	2.2.26 [Sep-21-2011]
O65709		726	Long-chain-alcohol oxidas	yes	no	0.927	0.997	0.609	0.0
B5WWZ8		749	Long-chain-alcohol oxidas	N/A	no	0.918	0.957	0.409	1e-157
B5WWZ9		750	Long-chain-alcohol oxidas	N/A	no	0.902	0.94	0.401	1e-147
Q9LW56		746	Long-chain-alcohol oxidas	no	no	0.896	0.938	0.398	1e-140
Q94BP3		748	Long-chain-alcohol oxidas	no	no	0.907	0.947	0.384	1e-137
Q9ZWB9		758	Long-chain-alcohol oxidas	no	no	0.924	0.952	0.359	1e-134
Q11157		629	Uncharacterized GMC-type	yes	no	0.615	0.764	0.296	2e-38
P55582		505	Uncharacterized GMC-type	yes	no	0.612	0.946	0.256	4e-32
Q2MF66		546	6'''-hydroxyparomomycin C	N/A	no	0.588	0.842	0.226	3e-13
B5ZUG2		549	Choline dehydrogenase OS=	yes	no	0.569	0.810	0.219	2e-07

>sp\|O65709\|FAO4A_ARATH Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana GN=FAO4A PE=3 SV=2	Back alignment and function desciption

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/750 (60%), Positives = 567/750 (75%), Gaps = 26/750 (3%)

Query: 32  MESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGLMSERLKHPKKWLV 91
           MESL A+CDTF+ ++D      +D  +A +F ASAS  GTP+R+  LMSERL HPKKW++
Sbjct: 1   MESLVAICDTFISSIDDSGVGHVDDCVAGYFSASASQTGTPDRVARLMSERLHHPKKWIL 60

Query: 92  RLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYK 151
           R  LWLLST IGSLVLCG   F+ +FPY   F +LP+K+R+ +L++WS SYF  LRML++
Sbjct: 61  RAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLFR 120

Query: 152 AMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRNEGLNDDDDDEGQN 211
            +KL+  LVFFTQV+EK  NL+WKAIGY GP P+                + D + E   
Sbjct: 121 TIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPD----------------HSDHEVELNE 164

Query: 212 DDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIK 271
           +   ++  E++GPLY G+++++ PR  V   L   GF VS   KRN   SSI+ P + I+
Sbjct: 165 EKKKKKPEEIFGPLYNGIVDLKSPREAVEKKLAGRGFAVS-NQKRNTNGSSISDPVMKIQ 223

Query: 272 CDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLAT 331
           CDAVVVGSGSGGG+ AGVLAKAGYKVLV+E G+Y ARS LSLLEG+ MD MYL+GG+LAT
Sbjct: 224 CDAVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLAT 283

Query: 332 DDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERM 391
            D  V++LAGSTVGGGSTINWSASIKTP+HV  EW ++ +L++F SDLY+EAM+VVC+RM
Sbjct: 284 SDTNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRM 343

Query: 392 GVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWL 451
           GVQ    EEGFNN VLR+GC++LG PV NIPRN+P DHYCG+CCLGCK G K+GTSETWL
Sbjct: 344 GVQCGFVEEGFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWL 403

Query: 452 VDLVNSGNSAILPGCEAIEVLHK-KRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACG 510
           VDLV S N  ILPGC+A EV++  ++  +  ATGVAF F     ++I VVES+VTIVACG
Sbjct: 404 VDLVESDNGLILPGCQATEVMYDCEQGKKKKATGVAFAF----GEEIYVVESRVTIVACG 459

Query: 511 ALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMS 570
           AL TP+LLKRSGLKN+NIG+NL LHPV MAWG+FP+     +WPE+KK SYEGGIMTAMS
Sbjct: 460 ALRTPHLLKRSGLKNSNIGRNLCLHPVVMAWGWFPEED---KWPEKKKKSYEGGIMTAMS 516

Query: 571 TTVGNFGKSGYGA-VIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGS 629
           + V     S YG  VIQTPALHPGMFS ++PW S  D K RM KFSRTAHIF L RD+G+
Sbjct: 517 SVVIEETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGT 576

Query: 630 GTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEF 689
           GT++S   I Y +   DEE+LK G+E++L+ILAAAGAEEIGTHH +G+ +NV+ ASS E 
Sbjct: 577 GTIDSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEI 636

Query: 690 ERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFP 749
           ERFV+EESS+PL+DLS  + SAHQMGSCRMGI P+ S V   GETW VE L++ADTSVFP
Sbjct: 637 ERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFP 696

Query: 750 TALGVNPMVTVQAIAYCTAQSVLDVLRRKK 779
           TALGVNPMVTVQ+IAYC   +V+DVL++KK
Sbjct: 697 TALGVNPMVTVQSIAYCIGLNVVDVLKKKK 726

Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 3EC: .EC: 2EC: 0

>sp\|B5WWZ8\|FAO1_LOTJA Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus GN=FAO1 PE=1 SV=1	Back alignment and function description

>sp\|B5WWZ9\|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1	Back alignment and function description

>sp\|Q9LW56\|FAO3_ARATH Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana GN=FAO3 PE=1 SV=1	Back alignment and function description

>sp\|Q94BP3\|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana GN=FAO4B PE=2 SV=2	Back alignment and function description

>sp\|Q9ZWB9\|FAO1_ARATH Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana GN=FAO1 PE=3 SV=2	Back alignment and function description

>sp\|Q11157\|Y492_MYCTU Uncharacterized GMC-type oxidoreductase Rv0492c/MT0511/MT0512 OS=Mycobacterium tuberculosis GN=Rv0492c PE=3 SV=2	Back alignment and function description

>sp\|P55582\|Y4NJ_RHISN Uncharacterized GMC-type oxidoreductase y4nJ OS=Rhizobium sp. (strain NGR234) GN=NGR_a02320 PE=3 SV=1	Back alignment and function description

>sp\|Q2MF66\|LIVQ_STRLV 6'''-hydroxyparomomycin C oxidase OS=Streptomyces lividus GN=livQ PE=1 SV=1	Back alignment and function description

>sp\|B5ZUG2\|BETA_RHILW Choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		781
356496483		809	PREDICTED: long-chain-alcohol oxidase FA	0.987	0.953	0.671	0.0
225427625		793	PREDICTED: long-chain-alcohol oxidase FA	0.985	0.970	0.671	0.0
357484415		853	GMC-type oxidoreductase, putative [Medic	0.988	0.905	0.649	0.0
357517451		810	GMC-type oxidoreductase, putative [Medic	0.988	0.953	0.691	0.0
224129586		748	predicted protein [Populus trichocarpa]	0.941	0.982	0.683	0.0
356531545		748	PREDICTED: long-chain-alcohol oxidase FA	0.951	0.993	0.685	0.0
255557817		710	electron carrier, putative [Ricinus comm	0.891	0.980	0.703	0.0
356558886		743	PREDICTED: long-chain-alcohol oxidase FA	0.944	0.993	0.692	0.0
356559057		749	PREDICTED: long-chain-alcohol oxidase FA	0.948	0.989	0.682	0.0
297800118		725	hypothetical protein ARALYDRAFT_914728 [	0.924	0.995	0.609	0.0

>gi\|356496483\|ref\|XP_003517097.1\| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]	Back alignment and taxonomy information

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/785 (67%), Positives = 632/785 (80%), Gaps = 14/785 (1%)

Query: 2   VVELGSIDKETLQLWGEEN----HCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKD 57
           VVELGSID + L L   E         N+LS ++M+SL ALCDT LP+VD     S D+ 
Sbjct: 32  VVELGSIDTQRLLLSNGEREKKLQPLTNTLSPRQMKSLYALCDTILPSVDHFVDTS-DES 90

Query: 58  IADFFRASASAAGTPERLGGLMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKF 117
           +  F++ SAS  GTPER G ++SE+LKHP   L++  LWLLST  G+L+ CG  CFS++F
Sbjct: 91  VTKFYQISASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQF 150

Query: 118 PYMHSFTQLPQKKRDAVLVSWSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAI 177
           P++H++  LP +KR  ++ SWSLSY  H RML++ +KLL LL+FFTQ++E  +N++WKAI
Sbjct: 151 PFIHTYPDLPLQKRQQIMRSWSLSYLRHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAI 210

Query: 178 GYKGPDPEFKTKSMQRKTLRNEGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRN 237
           GY GPDPEFK +      L++  L D     GQ D   E+  E+ GPLYKGL+++  PR+
Sbjct: 211 GYCGPDPEFKAR------LKSHFL-DGTSKGGQEDKEDEDAEEVIGPLYKGLVHLNYPRD 263

Query: 238 IVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKV 297
           I AD+L+++GFPVSV  +++ A ++++SPSLVI+CDAVVVGSGSGGG+IAGVLAKAGYKV
Sbjct: 264 ITADALKRLGFPVSVIRQKHKAAANLSSPSLVIQCDAVVVGSGSGGGVIAGVLAKAGYKV 323

Query: 298 LVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIK 357
           LVLEKG Y AR+NLSLLEG TMDQMYL GG++A+DDMGV +L+GSTVGGGS INWSA IK
Sbjct: 324 LVLEKGGYSARNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVGGGSAINWSACIK 383

Query: 358 TPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYP 417
           TP+HV  EW D++ L+LFES+LY+EA+  VCE+M VQSE+E+EGFNNA+LR+GC+E+GYP
Sbjct: 384 TPQHVCKEWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMGYP 443

Query: 418 VNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKR- 476
           V+NIPRNS  DHYCGWCC+GCKDG KKGTSETWLVDLV SGN AILPGCEAI+VLHKK+ 
Sbjct: 444 VSNIPRNSASDHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHKKKE 503

Query: 477 -RDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLH 535
            RDR +A GVAFEF+Y G KDICVVESKVTIVACGALSTP LLK+SGL+N NIG+NLHLH
Sbjct: 504 GRDRKIARGVAFEFEYKGTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNLHLH 563

Query: 536 PVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMF 595
           PV MAWGYFP    S  WPE  K SYEGGIMTAMST V  F +SGYGAVIQTP+LHPGMF
Sbjct: 564 PVAMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHPGMF 623

Query: 596 SSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIE 655
           S + PW SG DI+ RM KFSRTAHIF LARDQGSGTV +P  ISY+   +DEENLKKGIE
Sbjct: 624 SIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPAGVDEENLKKGIE 683

Query: 656 KILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMG 715
           K+LRILAAAGAEEIGTHH KG+ +NVK+    EFE+FVKEESSR L DL+TPL SAHQMG
Sbjct: 684 KVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESSRSLTDLTTPLCSAHQMG 743

Query: 716 SCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVL 775
           SCRMG +PK S VNQ GETW VEGLY+ADTSVFPTALGVNPMVTVQAIAYCTAQSV++VL
Sbjct: 744 SCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVVEVL 803

Query: 776 RRKKS 780
           RRK++
Sbjct: 804 RRKRT 808

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225427625\|ref\|XP_002269629.1\| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357484415\|ref\|XP_003612495.1\| GMC-type oxidoreductase, putative [Medicago truncatula] gi\|355513830\|gb\|AES95453.1\| GMC-type oxidoreductase, putative [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357517451\|ref\|XP_003629014.1\| GMC-type oxidoreductase, putative [Medicago truncatula] gi\|355523036\|gb\|AET03490.1\| GMC-type oxidoreductase, putative [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224129586\|ref\|XP_002328753.1\| predicted protein [Populus trichocarpa] gi\|222839051\|gb\|EEE77402.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356531545\|ref\|XP_003534338.1\| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]	Back alignment and taxonomy information

>gi\|255557817\|ref\|XP_002519938.1\| electron carrier, putative [Ricinus communis] gi\|223540984\|gb\|EEF42542.1\| electron carrier, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356558886\|ref\|XP_003547733.1\| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]	Back alignment and taxonomy information

>gi\|356559057\|ref\|XP_003547818.1\| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]	Back alignment and taxonomy information

>gi\|297800118\|ref\|XP_002867943.1\| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. lyrata] gi\|297313779\|gb\|EFH44202.1\| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		781
TAIR\|locus:2140401		726	AT4G19380 "AT4G19380" [Arabido	0.706	0.760	0.624	1.1e-238
UNIPROTKB\|B5WWZ8		749	FAO1 "Long-chain-alcohol oxida	0.685	0.714	0.435	1.8e-146
UNIPROTKB\|Q7XDG3		784	LOC_Os10g33460 "GMC oxidoreduc	0.682	0.679	0.424	6e-133
UNIPROTKB\|Q6K9N5		770	OJ1234_B11.20 "Os02g0621800 pr	0.678	0.688	0.418	6e-133
TAIR\|locus:2090900		746	FAO3 "AT3G23410" [Arabidopsis	0.683	0.715	0.433	2.9e-131
TAIR\|locus:2024157		758	AT1G03990 "AT1G03990" [Arabido	0.644	0.663	0.412	1.8e-129
TAIR\|locus:2139895		748	AT4G28570 [Arabidopsis thalian	0.686	0.716	0.410	4.9e-127
ASPGD\|ASPL0000057677		745	AN0623 [Emericella nidulans (t	0.590	0.618	0.336	2.9e-72
DICTYBASE\|DDB_G0292042		781	DDB_G0292042 "glucose-methanol	0.636	0.636	0.314	2.3e-70
CGD\|CAL0006030		704	orf19.6143 [Candida albicans (	0.585	0.649	0.329	6.1e-66

TAIR\|locus:2140401 AT4G19380 "AT4G19380" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1814 (643.6 bits), Expect = 1.1e-238, Sum P(2) = 1.1e-238
 Identities = 351/562 (62%), Positives = 428/562 (76%)

Query:   220 ELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAAPSSIASPSLVIKCDXXXXXX 279
             E++GPLY G+++++ PR  V   L   GF VS   KRN   SSI+ P + I+CD      
Sbjct:   173 EIFGPLYNGIVDLKSPREAVEKKLAGRGFAVS-NQKRNTNGSSISDPVMKIQCDAVVVGS 231

Query:   280 XXXXXXXXXXXXKAGYKVLVLEKGSYCARSNLSLLEGKTMDQMYLAGGMLATDDMGVILL 339
                         KAGYKVLV+E G+Y ARS LSLLEG+ MD MYL+GG+LAT D  V++L
Sbjct:   232 GSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVIL 291

Query:   340 AGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEE 399
             AGSTVGGGSTINWSASIKTP+HV  EW ++ +L++F SDLY+EAM+VVC+RMGVQ    E
Sbjct:   292 AGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVE 351

Query:   400 EGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGN 459
             EGFNN VLR+GC++LG PV NIPRN+P DHYCG+CCLGCK G K+GTSETWLVDLV S N
Sbjct:   352 EGFNNEVLRKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESDN 411

Query:   460 SAILPGCEAIEVLHK-KRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLL 518
               ILPGC+A EV++  ++  +  ATGVAF F     ++I VVES+VTIVACGAL TP+LL
Sbjct:   412 GLILPGCQATEVMYDCEQGKKKKATGVAFAF----GEEIYVVESRVTIVACGALRTPHLL 467

Query:   519 KRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGK 578
             KRSGLKN+NIG+NL LHPV MAWG+FP+     +WPE+KK SYEGGIMTAMS+ V     
Sbjct:   468 KRSGLKNSNIGRNLCLHPVVMAWGWFPEED---KWPEKKKKSYEGGIMTAMSSVVIEETH 524

Query:   579 SGYGA-VIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYS 637
             S YG  VIQTPALHPGMFS ++PW S  D K RM KFSRTAHIF L RD+G+GT++S   
Sbjct:   525 SSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTY 584

Query:   638 ISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEES 697
             I Y +   DEE+LK G+E++L+ILAAAGAEEIGTHH +G+ +NV+ ASS E ERFV+EES
Sbjct:   585 IDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREES 644

Query:   698 SRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPM 757
             S+PL+DLS  + SAHQMGSCRMGI P+ S V   GETW VE L++ADTSVFPTALGVNPM
Sbjct:   645 SKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPM 704

Query:   758 VTVQAIAYCTAQSVLDVLRRKK 779
             VTVQ+IAYC   +V+DVL++KK
Sbjct:   705 VTVQSIAYCIGLNVVDVLKKKK 726

GO:0005575 "cellular_component" evidence=ND

GO:0009055 "electron carrier activity" evidence=ISS

GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA

GO:0046577 "long-chain-alcohol oxidase activity" evidence=IEA;IBA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA;IBA

UNIPROTKB\|B5WWZ8 FAO1 "Long-chain-alcohol oxidase FAO1" [Lotus japonicus (taxid:34305)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7XDG3 LOC_Os10g33460 "GMC oxidoreductase family protein, expressed" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6K9N5 OJ1234_B11.20 "Os02g0621800 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2090900 FAO3 "AT3G23410" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024157 AT1G03990 "AT1G03990" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139895 AT4G28570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000057677 AN0623 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0292042 DDB_G0292042 "glucose-methanol-choline oxidoreductase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

CGD\|CAL0006030 orf19.6143 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O65709	FAO4A_ARATH	1, ., 1, ., 3, ., 2, 0	0.6093	0.9270	0.9972	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.3.20	0.946
3rd Layer	1.1.3	0.963
3rd Layer	1.1.99.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pm.C_scaffold_86000052	hypothetical protein (748 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		781
pfam00732		218	pfam00732, GMC_oxred_N, GMC oxidoreductase	1e-72
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	2e-45
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	4e-25
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-06
COG1233		487	COG1233, COG1233, Phytoene dehydrogenase and relat	6e-06
TIGR02462		544	TIGR02462, pyranose_ox, pyranose oxidase	1e-05
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	2e-05
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	2e-04
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	3e-04
COG1053		562	COG1053, SdhA, Succinate dehydrogenase/fumarate re	8e-04
PRK10015		429	PRK10015, PRK10015, oxidoreductase; Provisional	0.001
pfam13450		66	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-	0.001
PRK06292		460	PRK06292, PRK06292, dihydrolipoamide dehydrogenase	0.001
PRK12839		572	PRK12839, PRK12839, hypothetical protein; Provisio	0.001
pfam00890		401	pfam00890, FAD_binding_2, FAD binding domain	0.002
PRK10157		428	PRK10157, PRK10157, putative oxidoreductase FixC;	0.002
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	0.003
TIGR02032		295	TIGR02032, GG-red-SF, geranylgeranyl reductase fam	0.004

>gnl\|CDD\|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase	Back alignment and domain information

 Score =  236 bits (603), Expect = 1e-72
 Identities = 97/222 (43%), Positives = 131/222 (59%), Gaps = 7/222 (3%)

Query: 319 MDQMYLAGGML-ATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFES 377
            D +Y  GG   + +   +IL AGSTVGGGS++NWSA I+TP  V +EW  E+ L+ +  
Sbjct: 1   YDYLYEGGGSAGSVNGRRMILPAGSTVGGGSSVNWSACIRTPAAVLDEWASEFGLEGWGY 60

Query: 378 DLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLG 437
           D Y   M+ V   +GV ++  EE   N  L +  +ELGYPV  +PRNS   HYCG+C LG
Sbjct: 61  DDYLPYMDKVEGPLGVTTKGIEESPLNQALLKAAEELGYPVEAVPRNSNGCHYCGFCGLG 120

Query: 438 CKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDI 497
           C  G+K+ T+ TWL   +   N  IL G +A +++   R  R  A GV       G K +
Sbjct: 121 CPTGAKQSTARTWLRPALER-NLRILTGAKAEKIIILGRGGR--AVGVEARDGGGGIKRL 177

Query: 498 CVVESKVTIVACGALSTPNLLKRSGL-KNAN-IGKNLHLHPV 537
            +  +K  +VA GAL+TP LL RSGL KN + +GKNL LHPV
Sbjct: 178 -ITAAKEVVVAAGALNTPPLLLRSGLGKNPHPVGKNLQLHPV 218

This family of proteins bind FAD as a cofactor. Length = 218

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|131515 TIGR02462, pyranose_ox, pyranose oxidase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|182194 PRK10015, PRK10015, oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain	Back alignment and domain information

>gnl\|CDD\|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|237223 PRK12839, PRK12839, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|216176 pfam00890, FAD_binding_2, FAD binding domain	Back alignment and domain information

>gnl\|CDD\|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		781
PRK02106		560	choline dehydrogenase; Validated	100.0
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	100.0
KOG1238		623	consensus Glucose dehydrogenase/choline dehydrogen	100.0
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	100.0
PLN02785		587	Protein HOTHEAD	100.0
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	100.0
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	100.0
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	99.94
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.45
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.43
PRK08274		466	tricarballylate dehydrogenase; Validated	99.43
PRK07121		492	hypothetical protein; Validated	99.42
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.41
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.38
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	99.38
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	99.36
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.34
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	99.34
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	99.34
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	99.33
PLN02815		594	L-aspartate oxidase	99.32
PRK06175		433	L-aspartate oxidase; Provisional	99.32
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.31
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.3
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	99.3
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.3
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	99.29
COG2081		408	Predicted flavoproteins [General function predicti	99.29
PRK07804		541	L-aspartate oxidase; Provisional	99.28
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	99.28
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	99.28
PRK07395		553	L-aspartate oxidase; Provisional	99.28
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	99.23
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	99.22
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	99.22
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	99.22
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	99.22
PRK12839		572	hypothetical protein; Provisional	99.22
PRK09077		536	L-aspartate oxidase; Provisional	99.22
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	99.21
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	99.21
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.21
PRK07512		513	L-aspartate oxidase; Provisional	99.21
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	99.2
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.2
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	99.19
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.19
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	99.19
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	99.18
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	99.17
PRK08275		554	putative oxidoreductase; Provisional	99.17
PRK08071		510	L-aspartate oxidase; Provisional	99.17
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	99.16
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	99.16
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	99.16
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	99.15
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	99.15
PLN02464		627	glycerol-3-phosphate dehydrogenase	99.14
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.14
COG0579		429	Predicted dehydrogenase [General function predicti	99.13
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	99.13
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	99.13
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	99.12
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	99.11
COG3573		552	Predicted oxidoreductase [General function predict	99.1
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	99.1
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	99.1
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	99.09
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	99.07
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	99.05
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	99.05
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	99.04
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	99.04
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	99.04
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	99.03
PTZ00383		497	malate:quinone oxidoreductase; Provisional	99.02
PRK11728		393	hydroxyglutarate oxidase; Provisional	99.01
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	99.0
PRK05257		494	malate:quinone oxidoreductase; Validated	98.98
PLN02661		357	Putative thiazole synthesis	98.97
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	98.96
PRK08401		466	L-aspartate oxidase; Provisional	98.96
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	98.95
PRK13339		497	malate:quinone oxidoreductase; Reviewed	98.94
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	98.9
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	98.87
PRK10157		428	putative oxidoreductase FixC; Provisional	98.87
PF13618		131	Gluconate_2-dh3: Gluconate 2-dehydrogenase subunit	98.86
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	98.83
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	98.82
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	98.8
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	98.79
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.79
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	98.73
PRK10015		429	oxidoreductase; Provisional	98.69
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.69
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	98.68
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.67
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	98.66
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.64
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.64
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	98.62
PRK06185		407	hypothetical protein; Provisional	98.6
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	98.56
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	98.54
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	98.52
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.48
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	98.47
PLN02985		514	squalene monooxygenase	98.41
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	98.4
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.39
TIGR00275		400	flavoprotein, HI0933 family. The model when search	98.37
PRK07208		479	hypothetical protein; Provisional	98.37
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.35
PRK06126		545	hypothetical protein; Provisional	98.34
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	98.34
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	98.34
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	98.33
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	98.33
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	98.31
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	98.31
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	98.29
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	98.28
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	98.27
PLN02697		529	lycopene epsilon cyclase	98.26
KOG2415		621	consensus Electron transfer flavoprotein ubiquinon	98.26
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	98.24
PRK08244		493	hypothetical protein; Provisional	98.24
PLN02463		447	lycopene beta cyclase	98.24
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.23
PRK06184		502	hypothetical protein; Provisional	98.21
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	98.21
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	98.21
PRK08163		396	salicylate hydroxylase; Provisional	98.2
PRK06847		375	hypothetical protein; Provisional	98.2
PRK11445		351	putative oxidoreductase; Provisional	98.2
KOG2665		453	consensus Predicted FAD-dependent oxidoreductase [	98.19
PRK06834		488	hypothetical protein; Provisional	98.19
KOG2853		509	consensus Possible oxidoreductase [General functio	98.17
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	98.13
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	98.12
PRK07233		434	hypothetical protein; Provisional	98.1
PRK07190		487	hypothetical protein; Provisional	98.09
PRK08132		547	FAD-dependent oxidoreductase; Provisional	98.07
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	98.04
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	98.04
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	98.03
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	98.03
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	98.03
PLN02612		567	phytoene desaturase	97.99
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	97.97
PRK07588		391	hypothetical protein; Provisional	97.96
KOG2852		380	consensus Possible oxidoreductase [General functio	97.93
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	97.91
PRK06116		450	glutathione reductase; Validated	97.9
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.9
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	97.89
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	97.89
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	97.89
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	97.88
PRK12831		464	putative oxidoreductase; Provisional	97.87
PRK06370		463	mercuric reductase; Validated	97.87
PTZ00058		561	glutathione reductase; Provisional	97.86
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.86
KOG2311		679	consensus NAD/FAD-utilizing protein possibly invol	97.86
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	97.85
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	97.84
PRK07538		413	hypothetical protein; Provisional	97.84
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	97.83
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	97.82
PLN02546		558	glutathione reductase	97.82
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	97.81
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	97.8
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	97.77
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	97.77
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	97.77
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	97.76
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	97.73
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	97.73
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	97.72
TIGR02053		463	MerA mercuric reductase. This model represents the	97.7
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.7
PLN02487		569	zeta-carotene desaturase	97.69
PLN02507		499	glutathione reductase	97.67
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	97.66
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	97.66
PRK13748		561	putative mercuric reductase; Provisional	97.65
PRK14694		468	putative mercuric reductase; Provisional	97.65
PRK09126		392	hypothetical protein; Provisional	97.65
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.63
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.62
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.62
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.61
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.61
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	97.61
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	97.59
PRK08013		400	oxidoreductase; Provisional	97.58
KOG2960		328	consensus Protein involved in thiamine biosynthesi	97.58
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.57
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.57
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	97.54
PRK07045		388	putative monooxygenase; Reviewed	97.53
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	97.53
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.51
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	97.5
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	97.5
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	97.47
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	97.47
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.47
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	97.46
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	97.43
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	97.43
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	97.43
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	97.42
PRK14727		479	putative mercuric reductase; Provisional	97.42
PTZ00052		499	thioredoxin reductase; Provisional	97.42
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.42
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	97.41
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	97.4
PTZ00367		567	squalene epoxidase; Provisional	97.39
PLN02576		496	protoporphyrinogen oxidase	97.38
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	97.38
PRK09897		534	hypothetical protein; Provisional	97.38
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	97.32
PRK09564		444	coenzyme A disulfide reductase; Reviewed	97.32
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	97.31
PLN02268		435	probable polyamine oxidase	97.3
PRK11883		451	protoporphyrinogen oxidase; Reviewed	97.27
PRK07846		451	mycothione reductase; Reviewed	97.26
PRK07236		386	hypothetical protein; Provisional	97.25
PRK06753		373	hypothetical protein; Provisional	97.22
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	97.21
PRK06996		398	hypothetical protein; Provisional	97.2
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	97.17
PRK10262		321	thioredoxin reductase; Provisional	97.14
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	97.14
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	97.13
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	97.13
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.13
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	97.11
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	97.1
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	97.07
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	97.06
PRK08294		634	phenol 2-monooxygenase; Provisional	97.06
COG3349		485	Uncharacterized conserved protein [Function unknow	97.06
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	97.04
PRK05868		372	hypothetical protein; Validated	97.03
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	96.95
PLN02568		539	polyamine oxidase	96.94
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	96.93
PLN02676		487	polyamine oxidase	96.92
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	96.9
KOG0405		478	consensus Pyridine nucleotide-disulphide oxidoredu	96.89
PRK06475		400	salicylate hydroxylase; Provisional	96.88
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	96.85
PRK12416		463	protoporphyrinogen oxidase; Provisional	96.82
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	96.8
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	96.78
PRK07845		466	flavoprotein disulfide reductase; Reviewed	96.78
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	96.78
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	96.73
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	96.72
KOG4716		503	consensus Thioredoxin reductase [Posttranslational	96.55
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	96.52
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	96.51
PLN02529		738	lysine-specific histone demethylase 1	96.48
PLN02328		808	lysine-specific histone demethylase 1 homolog	96.46
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	96.41
KOG1399		448	consensus Flavin-containing monooxygenase [Seconda	96.35
PRK12779		944	putative bifunctional glutamate synthase subunit b	96.33
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	96.23
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	96.21
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	96.2
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	96.19
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	96.14
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	96.02
PLN02852		491	ferredoxin-NADP+ reductase	95.99
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	95.88
PRK14989		847	nitrite reductase subunit NirD; Provisional	95.88
PRK12814		652	putative NADPH-dependent glutamate synthase small	95.82
PRK06567		1028	putative bifunctional glutamate synthase subunit b	95.81
PLN03000		881	amine oxidase	95.78
PRK12770		352	putative glutamate synthase subunit beta; Provisio	95.76
PLN02976		1713	amine oxidase	95.72
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	95.59
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	95.47
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	95.45
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	95.13
KOG2403		642	consensus Succinate dehydrogenase, flavoprotein su	95.12
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	95.1
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	95.04
PRK13984		604	putative oxidoreductase; Provisional	94.83
KOG4405		547	consensus GDP dissociation inhibitor [Signal trans	94.75
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	94.66
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	94.61
PRK10262		321	thioredoxin reductase; Provisional	94.53
PTZ00188		506	adrenodoxin reductase; Provisional	94.52
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	94.42
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	94.38
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	94.28
PRK13512		438	coenzyme A disulfide reductase; Provisional	93.95
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	93.8
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	93.71
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	93.22
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	92.99
COG2907		447	Predicted NAD/FAD-binding protein [General functio	92.82
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	92.72
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	92.03
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	91.89
KOG3851		446	consensus Sulfide:quinone oxidoreductase/flavo-bin	91.19
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	91.15
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	90.73
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	90.67
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	90.61
COG0569		225	TrkA K+ transport systems, NAD-binding component [	90.57
KOG0399		2142	consensus Glutamate synthase [Amino acid transport	90.38
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	90.28
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	90.16
KOG1800		468	consensus Ferredoxin/adrenodoxin reductase [Nucleo	89.54
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	89.39
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	88.62
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	88.45
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	88.4
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	88.38
KOG0404		322	consensus Thioredoxin reductase [Posttranslational	88.02
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	87.9
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	87.89
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	87.88
TIGR02053		463	MerA mercuric reductase. This model represents the	87.27
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	87.01
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	86.99
PRK07846		451	mycothione reductase; Reviewed	86.88
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.77
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	86.74
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.71
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	86.47
PRK06370		463	mercuric reductase; Validated	86.46
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.44
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.43
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	86.27
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	86.2
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	86.01
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.87
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	85.87
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	85.84
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.67
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	85.61
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	85.56
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	85.45
PRK13512		438	coenzyme A disulfide reductase; Provisional	85.09
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	84.77
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	84.73
KOG2755		334	consensus Oxidoreductase [General function predict	84.69
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	84.56
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	84.54
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	84.42
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	84.27
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	84.11
PRK06719		157	precorrin-2 dehydrogenase; Validated	84.09
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	84.02
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	83.91
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.91
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	83.83
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	83.75
PRK04148		134	hypothetical protein; Provisional	83.73
PRK15116		268	sulfur acceptor protein CsdL; Provisional	83.72
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	83.67
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	83.65
COG4529		474	Uncharacterized protein conserved in bacteria [Fun	83.58
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	83.54
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	83.18
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	83.17
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	83.15
PRK09564		444	coenzyme A disulfide reductase; Reviewed	82.82
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	82.63
PTZ00153		659	lipoamide dehydrogenase; Provisional	82.58
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	82.4
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	82.33
PRK07845		466	flavoprotein disulfide reductase; Reviewed	82.32
PRK06116		450	glutathione reductase; Validated	82.22
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	82.08
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	82.02
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	81.83
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	81.79
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	81.59
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	81.41
PRK14989		847	nitrite reductase subunit NirD; Provisional	81.28
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	81.26
PRK13748		561	putative mercuric reductase; Provisional	81.25
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	81.25
PRK14694		468	putative mercuric reductase; Provisional	81.11
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	81.0
PLN02507		499	glutathione reductase	80.95
PTZ00058		561	glutathione reductase; Provisional	80.92
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	80.85
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	80.73
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	80.44
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	80.24
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	80.17
PLN02546		558	glutathione reductase	80.14

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

Probab=100.00  E-value=2.6e-64  Score=587.32  Aligned_cols=477  Identities=21%  Similarity=0.243  Sum_probs=336.3

Q ss_pred             CCCcccEEEECCCchHHHHHHHHHh-CCCeEEEEcCCCCCCCCC-c---cc-----ccCCchhhhhhhCCccccCCCcee
Q 003990          268 LVIKCDAVVVGSGSGGGLIAGVLAK-AGYKVLVLEKGSYCARSN-L---SL-----LEGKTMDQMYLAGGMLATDDMGVI  337 (781)
Q Consensus       268 ~~~~~DVIVVGsG~~G~vaA~~LA~-~G~kVlVLEkG~~~~~~~-~---~~-----~~~~~~~~~y~~~~~~~~~~~~~~  337 (781)
                      ++.+|||||||||++|+++|.+||+ +|++|||||+|+.....+ .   +.     .....+.|.|...+.....++.+.
T Consensus         2 ~~~~~D~iIVG~G~aG~vvA~rLae~~g~~VlvlEaG~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~   81 (560)
T PRK02106          2 TTMEYDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQMPAALAFPLQGKRYNWAYETEPEPHMNNRRME   81 (560)
T ss_pred             CCCcCcEEEECCcHHHHHHHHHHHhCCCCeEEEecCCCcccCCCcceeCcHHHHHhcCCCceeeceecccCCCCCCCeee
Confidence            4567999999999999999999999 799999999997542111 1   10     011223455555444334556788


Q ss_pred             eeecceecCcchhcccccccCChhhHHHHHHHhcCCCcChhhhhHHHHhhhhhccc-------------cCCCccCCccH
Q 003990          338 LLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGV-------------QSEVEEEGFNN  404 (781)
Q Consensus       338 ~~~G~~lGGgs~in~~~~~r~~~~~~~~W~~~~gl~~~~~~~~~~~~~~v~~~l~v-------------~~~~~~~~~~~  404 (781)
                      +.+|++|||+|.+|++.++|+.+.+|+.|....|.+.|+++++.+++++++..+.-             ...........
T Consensus        82 ~~~g~~lGGsS~iN~~~~~R~~~~Dfd~w~~~~g~~~Ws~~~l~py~~k~E~~~~~~~~~~g~~gp~~~~~~~~~~~~~~  161 (560)
T PRK02106         82 CPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLEGWSYADCLPYFKKAETRDGGEDDYRGGDGPLSVTRGKPGTNPLF  161 (560)
T ss_pred             cccccccCCCCCccceEEecCCHHHHHHHHhhcCCCCCCHHHHHHHHHHhhccCCCCccccCCCCCEEEeCCCCCCCHHH
Confidence            89999999999999999999999999999977677889999999999998876521             10001123345


Q ss_pred             HHHHHHHHHcCCCCCCCCCCCCCCCcceeccccCCCCcccchhhhchHHHhhCCCeEEecCcEEEEEEccCCCCcceEEE
Q 003990          405 AVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATG  484 (781)
Q Consensus       405 ~~l~~~~~~lG~~~~~~p~n~~~~~~~g~~~~gc~~g~k~s~~~~~L~~a~~~gn~~i~~~~~V~~I~~~~gg~~~ra~G  484 (781)
                      +.+.++++++|++... +.+...+.+++.|...|..|.|.++..+||.++.+++|++|++++.|++|+++++    +++|
T Consensus       162 ~~~~~a~~~lG~~~~~-~~~~~~~~g~~~~~~~~~~g~R~s~~~~~l~~a~~~~nl~i~~~a~V~rI~~~~~----~a~G  236 (560)
T PRK02106        162 QAFVEAGVQAGYPRTD-DLNGYQQEGFGPMDRTVTNGRRWSAARAYLDPALKRPNLTIVTHALTDRILFEGK----RAVG  236 (560)
T ss_pred             HHHHHHHHHcCCCcCC-CCCCCCCceeEEEeeecCCCEEEChHHHhhccccCCCCcEEEcCCEEEEEEEeCC----eEEE
Confidence            7888999999998765 3454445566677778999999999999999998899999999999999999743    8999


Q ss_pred             EEEEEeeCCceeEEEEeccEEEEeccCCCCHHHHHHcCCCC---------------CcccccccccccceeeccccCCCC
Q 003990          485 VAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKN---------------ANIGKNLHLHPVTMAWGYFPKTSS  549 (781)
Q Consensus       485 V~~~~~~~g~g~~~~i~Ak~VVLAaGai~Tp~LLl~SGi~~---------------p~VG~nL~dHp~~~~~~~~~~~~~  549 (781)
                      |++.+.   .+....+.||+||||||+|+||+|||+|||++               |+||+||+|||.+.+...+++...
T Consensus       237 V~~~~~---~~~~~~~~ak~VILaaGai~TP~LLl~SGIG~~~~L~~~gI~~~~dlP~VG~NL~dH~~~~~~~~~~~~~~  313 (560)
T PRK02106        237 VEYERG---GGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDLPGVGENLQDHLEVYIQYECKQPVS  313 (560)
T ss_pred             EEEEeC---CcEEEEEeeeeEEEccCCCCCHHHHhhcCCCChHHHHhcCCceEeeCCCCCcChhhCccceEEEEeCCCcc
Confidence            999862   23445567899999999999999999999987               569999999999877655443321


Q ss_pred             CCC-Ccccc----ccCC---CCCceeeecccccCcCCCCCCceecCCC-CCccchhccCCCCcchhHHHHHhhcCCceEE
Q 003990          550 SGE-WPEEK----KTSY---EGGIMTAMSTTVGNFGKSGYGAVIQTPA-LHPGMFSSLMPWVSGADIKLRMCKFSRTAHI  620 (781)
Q Consensus       550 ~~~-~~~~~----~~~~---~gg~~ts~~~~~~~~~~~~~~~~le~~~-~~p~~~~~~~p~~~g~~~~~~~~~~~~~~~~  620 (781)
                      ... ...+.    ...|   ..|+.........       +....... ..|.....+.|.......... .........
T Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~-------~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~~~~~  385 (560)
T PRK02106        314 LYPALKWWNKPKIGAEWLFTGTGLGASNHFEAG-------GFIRSRAGVDWPNIQYHFLPVAIRYDGSNA-VKGHGFQAH  385 (560)
T ss_pred             cccccchhhhhHHHHHHHhcCCCCcccccccee-------eEEecCCCCCCCCeEEEEeeccccccCCCC-CCCCeEEEE
Confidence            000 00000    0000   1111110000000       00000000 011111111111000000000 000111223


Q ss_pred             EEEeecCCCceEecC-------cc--ccCCCChhhHHHHHHHHHHHHHHHHHcCccccc-ccccCCccccccCCCHHHHH
Q 003990          621 FVLARDQGSGTVNSP-------YS--ISYQMEAMDEENLKKGIEKILRILAAAGAEEIG-THHCKGKIINVKKASSEEFE  690 (781)
Q Consensus       621 ~~l~~d~s~G~V~~~-------p~--i~y~~~~~D~~~l~~~~~~~~~i~~~~ga~~i~-~~~~~~~~~~~~~~~~~~~~  690 (781)
                      +.+.+|.++|+|++.       |.  ++|..++.|++.+.++++.+++++.+++++.+. .+..++.    ...++++++
T Consensus       386 ~~~~~P~srG~V~L~s~d~~~~P~i~~~y~~~~~D~~~~~~~~~~~~~i~~~~~~~~~~~~~~~p~~----~~~~~~~~~  461 (560)
T PRK02106        386 VGPMRSPSRGSVKLKSADPRAHPSILFNYMSTEQDWREFRDAIRLTREIMAQPALDPYRGREISPGA----DVQTDEEID  461 (560)
T ss_pred             EEecCCcceEEEEEeCCCCccCceEccccCCCHHHHHHHHHHHHHHHHHHcChhhhhccccccCCCc----ccCCHHHHH
Confidence            456789999999863       43  589999999999999999999999888765532 1122221    124788999


Q ss_pred             HHHHhhccCCCCCCCCCccccccccCccCCCCCCCccccCCCceeccCCcEEecCCcCCCCCCCCChhHHHHHHHHHHHH
Q 003990          691 RFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQS  770 (781)
Q Consensus       691 ~~~~~~~~~~~~~~~~~~~s~H~~GTcrMG~~~~~gVVD~~~rv~g~~nL~V~DaSvfPt~~g~NP~lTi~AlA~~iA~~  770 (781)
                      +|+++..          .+++|++||||||.+| +||||++|||||++||||+|+||||+.+++||++||||+|+++|++
T Consensus       462 ~~i~~~~----------~~~~H~~GTcrMG~d~-~sVVD~~~rV~Gv~nLrVvDaSv~P~~~~~np~~ti~aiaeraAd~  530 (560)
T PRK02106        462 AFVREHA----------ETAYHPSCTCKMGTDP-MAVVDPEGRVHGVEGLRVVDASIMPTITNGNLNAPTIMIAEKAADL  530 (560)
T ss_pred             HHHHhcc----------CcCcccCCCeecCCCC-CeeECCCCEEeccCCeEEeeccccCCCCCcchHHHHHHHHHHHHHH
Confidence            9998742          5789999999999987 8999999999999999999999999999999999999999999998


Q ss_pred             HHHHH
Q 003990          771 VLDVL  775 (781)
Q Consensus       771 ia~~l  775 (781)
                      |.+..
T Consensus       531 I~~~~  535 (560)
T PRK02106        531 IRGRT  535 (560)
T ss_pred             HhccC
Confidence            87643

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PF13618 Gluconate_2-dh3: Gluconate 2-dehydrogenase subunit 3	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown]	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>KOG2853 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>KOG2852 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only]	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion]	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>KOG2755 consensus Oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>COG4529 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		781
3ljp_A		546	Crystal Structure Of Choline Oxidase V464a Mutant L		2e-06
3nne_A		546	Crystal Structure Of Choline Oxidase S101a Mutant L		3e-06
2jbv_A		546	Crystal Structure Of Choline Oxidase Reveals Insigh		3e-06

>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546

Back alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 91/356 (25%), Positives = 139/356 (39%), Gaps = 73/356 (20%) Query: 440 DGSKKGTSETWLVDLVNSGNSAILPGCEAIE-VLHKKRRDRNVATGVAFEFQYMGAKDIC 498 DG++ +S +++ +V N +L G A + V RR TGV G Sbjct: 204 DGTRSSSSVSYIHPIVEQENFTLLTGLRARQLVFDADRR----CTGVDIVDSAFGHTHRL 259 Query: 499 VVESKVTIVACGALSTPNLLKRSGLKNA---------------NIGKNLHLHP--VTMAW 541 ++V +++ GA+ TP LL SG+ A +G++L HP V Sbjct: 260 TARNEV-VLSTGAIDTPKLLMLSGIGPAAHLAEHGIEVLVDSPGVGEHLQDHPEGVVQFE 318 Query: 542 GYFPKTSSSGEW-------PEEKKTSYEGGIMTAMSTTVG-NFGKSGYGAVIQTPALHPG 593 P + S +W P E +M S N + GY P G Sbjct: 319 AKQPMVAESTQWWEIGIFTPTEDGLDRPDLMMHYGSVPFDMNTLRHGY------PTTENG 372 Query: 594 MFSSLMPWVSGA----DIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEEN 649 SL P V+ A ++LR F RD+ V+ Y E D Sbjct: 373 F--SLTPNVTHARSRGTVRLRSRDF----------RDKP--MVDPRYFTD--PEGHDMRV 416 Query: 650 LKKGIEKILRILA-AAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPL 708 + GI K I A A AE G G V+ + EE + ++++ T Sbjct: 417 MVAGIRKAREIAAQPAMAEWTGRELSPG----VEAQTDEELQDYIRK----------THN 462 Query: 709 SSAHQMGSCRMG-IDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAI 763 ++ H +G+ RMG ++ + S ++ GV GL +AD SV P + VNP +TV I Sbjct: 463 TAYHPVGTVRMGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVTVNPNITVMMI 518

PyMOL of 3ljp

>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546

Back alignment and structure

>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		781
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	2e-64
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	4e-53
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	2e-42
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	2e-15
1gpe_A		587	Protein (glucose oxidase); oxidoreductase(flavopro	1e-14
3qvp_A		583	Glucose oxidase; oxidoreductase; HET: NAG BMA MAN	6e-13
3t37_A		526	Probable dehydrogenase; BET alpha beta fold, ADP b	1e-11
1ju2_A		536	HydroxynitrIle lyase; flavin, GMC oxidoreductase,	3e-10
3fim_B		566	ARYL-alcohol oxidase; AAO, lignin degradation, oxi	4e-10
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	5e-10
3q9t_A		577	Choline dehydrogenase and related flavoproteins; g	7e-10
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	1e-06
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	2e-06
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	4e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-06
3atr_A		453	Conserved archaeal protein; saturating double bond	7e-06
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	8e-06
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	2e-05
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	3e-05
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	5e-05
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	5e-05
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	1e-04
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	1e-04
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	2e-04
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	2e-04
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	2e-04

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504	Back alignment and structure

 Score =  222 bits (567), Expect = 2e-64
 Identities = 80/545 (14%), Positives = 155/545 (28%), Gaps = 99/545 (18%)

Query: 273 DAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCAR------------------------ 308
            AVV+G+G G  + A  L +AG + L+LE G    +                        
Sbjct: 7   PAVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKRSSWFKNR 66

Query: 309 -----SNLSLLEGKTMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVA 363
                 +   L+    +    AG +   +   + +  G  VGGGS +N   +++  +   
Sbjct: 67  TEAPLGSFLWLDVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGGMAVEPKRSYF 126

Query: 364 NEWCDEYELKLFESDLYKEAMEV--VCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNI 421
            E     +        +  A  +  V        E  E      V R    + G     +
Sbjct: 127 EEILPRVDSSEMYDRYFPRANSMLRVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFV 186

Query: 422 PRN------------SPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAI 469
           P                P        +   +  K+   +T+L   + +G   I    +  
Sbjct: 187 PNVYDFGYMQREAAGEVPKSALATEVIYGNNHGKQSLDKTYLAAALGTGKVTIQTLHQVK 246

Query: 470 EVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRSGLKNANIG 529
            +     +D   A  V  +           +  +   +  G+L +  LL R+        
Sbjct: 247 TIRQ--TKDGGYALTVEQKDTDGKLLATKEISCRYLFLGAGSLGSTELLVRARDTGTLPN 304

Query: 530 KNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMSTTVGNFGKS-GYGAVIQTP 588
            N  +       G                 +        M    G    S     +    
Sbjct: 305 LNSEVGAGWGPNG-----------------NIMTARANHMWNPTGAHQSSIPALGIDAWD 347

Query: 589 ALHPGMFSSLMPWVSGADIKLRM-CKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDE 647
                +F+ + P  +G +  + +    ++         D  +      ++        + 
Sbjct: 348 NSDSSVFAEIAPMPAGLETWVSLYLAITKNPQRGTFVYDAATDRAKLNWT-----RDQNA 402

Query: 648 ENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTP 707
             +        RI  A G                          +  +     L+  +  
Sbjct: 403 PAVNAAKALFDRINKANGT------------------------IYRYDLFGTQLKAFADD 438

Query: 708 LSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCT 767
               H +G C +G        +  G   G + LY+ D S+ P ++GVNP VT+ A+A   
Sbjct: 439 FC-YHPLGGCVLG-----KATDDYGRVAGYKNLYVTDGSLIPGSVGVNPFVTITALAERN 492

Query: 768 AQSVL 772
            + ++
Sbjct: 493 VERII 497

PyMOL of 1n4w

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546	Back alignment and structure

>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587	Back alignment and structure

>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583	Back alignment and structure

>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526	Back alignment and structure

>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536	Back alignment and structure

>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546	Back alignment and structure

>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453	Back alignment and structure

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		781
3fim_B		566	ARYL-alcohol oxidase; AAO, lignin degradation, oxi	100.0
3t37_A		526	Probable dehydrogenase; BET alpha beta fold, ADP b	100.0
3qvp_A		583	Glucose oxidase; oxidoreductase; HET: NAG BMA MAN	100.0
1gpe_A		587	Protein (glucose oxidase); oxidoreductase(flavopro	100.0
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	100.0
3q9t_A		577	Choline dehydrogenase and related flavoproteins; g	100.0
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	100.0
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	100.0
1ju2_A		536	HydroxynitrIle lyase; flavin, GMC oxidoreductase,	100.0
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	100.0
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	100.0
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	99.54
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	99.38
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	99.37
3dme_A		369	Conserved exported protein; structural genomics, P	99.33
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	99.26
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	99.25
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	99.25
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	99.24
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	99.24
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	99.24
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	99.22
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	99.2
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	99.19
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	99.16
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	99.15
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	99.14
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	99.14
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	99.13
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	99.11
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	99.11
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	99.08
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	99.07
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	99.06
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	99.03
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	99.0
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	99.0
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	98.98
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	98.97
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	98.94
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	98.93
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	98.92
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	98.9
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	98.88
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	98.88
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	98.82
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	98.82
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	98.78
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	98.76
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	98.75
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	98.74
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	98.74
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	98.73
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	98.73
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	98.7
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	98.61
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	98.6
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	98.59
3atr_A		453	Conserved archaeal protein; saturating double bond	98.58
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	98.57
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	98.56
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	98.54
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	98.54
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	98.52
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	98.52
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	98.49
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	98.49
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	98.48
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	98.46
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	98.44
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	98.43
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	98.43
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	98.42
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	98.41
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	98.4
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	98.39
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	98.38
2cul_A		232	Glucose-inhibited division protein A-related PROT	98.38
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	98.32
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	98.31
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	98.3
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	98.29
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	98.25
2bry_A		497	NEDD9 interacting protein with calponin homology a	98.22
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	98.21
3r9u_A		315	Thioredoxin reductase; structural genomics, center	98.21
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	98.19
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	98.18
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	98.18
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	98.16
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	98.13
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	98.13
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	98.12
4fk1_A		304	Putative thioredoxin reductase; structural genomic	98.07
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	98.05
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	98.04
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	98.03
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	98.03
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	98.0
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	97.99
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	97.97
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	97.96
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	97.95
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	97.9
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	97.89
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	97.84
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	97.84
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	97.79
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	97.79
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	97.77
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	97.75
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	97.74
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	97.73
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	97.71
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	97.68
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	97.64
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	97.63
4b63_A		501	L-ornithine N5 monooxygenase; oxidoreductase, side	97.61
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	97.61
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	97.61
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	97.6
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	97.59
2e1m_A		376	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	97.59
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	97.59
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	97.59
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	97.58
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	97.58
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	97.57
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.57
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	97.56
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	97.55
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	97.55
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	97.54
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	97.51
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	97.5
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	97.5
3g3e_A		351	D-amino-acid oxidase; FAD, flavoprotein, oxidoredu	97.5
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	97.49
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	97.49
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	97.49
4dna_A		463	Probable glutathione reductase; structural genomic	97.49
3ihm_A		430	Styrene monooxygenase A; rossman fold, anti-parall	97.49
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	97.48
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	97.47
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	97.47
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	97.46
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	97.45
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	97.43
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	97.42
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	97.38
1ojt_A		482	Surface protein; redox-active center, glycolysis,	97.37
1fec_A		490	Trypanothione reductase; redox-active center, oxid	97.37
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	97.36
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	97.36
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	97.35
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	97.35
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	97.34
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	97.34
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	97.33
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	97.32
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	97.32
3g5s_A		443	Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy	97.3
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	97.3
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	97.27
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	97.27
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	97.27
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	97.27
3c4a_A		381	Probable tryptophan hydroxylase VIOD; alpha-beta p	97.26
4hb9_A		412	Similarities with probable monooxygenase; flavin,	97.26
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	97.25
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	97.24
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	97.24
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	97.24
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	97.21
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	97.21
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	97.2
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	97.2
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	97.2
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	97.19
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	97.18
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	97.14
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.12
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	97.1
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	97.08
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	97.07
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	97.04
2vdc_G		456	Glutamate synthase [NADPH] small chain; oxidoreduc	96.99
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	96.99
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	96.88
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	96.85
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	96.78
1o94_A		729	Tmadh, trimethylamine dehydrogenase; electron tran	96.75
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	96.74
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	96.72
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	96.72
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	96.72
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	96.71
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	96.66
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	96.63
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	96.63
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	96.63
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	96.62
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	96.61
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	96.6
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	96.59
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	96.57
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	96.54
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	96.53
3sx6_A		437	Sulfide-quinone reductase, putative; sulfide:quino	96.51
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	96.43
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	96.31
1lqt_A		456	FPRA; NADP+ derivative, oxidoreductase, structural	96.23
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	96.16
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	96.0
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	95.95
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	95.91
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	95.86
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	95.76
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	95.71
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	95.69
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	95.65
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	95.65
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	95.61
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	95.59
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	95.47
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	95.42
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	95.35
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	95.35
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	95.31
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	95.31
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	95.28
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	95.19
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	95.02
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	94.99
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	94.92
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	94.68
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	94.57
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	94.53
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	94.13
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	94.02
4dna_A		463	Probable glutathione reductase; structural genomic	93.75
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	93.21
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	92.42
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	92.35
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	92.27
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	92.23
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	91.81
1id1_A		153	Putative potassium channel protein; RCK domain, E.	91.37
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	91.21
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	91.19
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	90.28
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	90.27
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	90.17
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	89.96
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	89.88
3ado_A		319	Lambda-crystallin; L-gulonate 3-dehydrogenase, str	89.7
3i83_A		320	2-dehydropantoate 2-reductase; structural genomics	89.45
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	89.39
3hn2_A		312	2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str	89.27
3c85_A		183	Putative glutathione-regulated potassium-efflux S	88.63
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	88.39
1f0y_A		302	HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive	88.1
3l4b_C		218	TRKA K+ channel protien TM1088B; potassium channel	87.8
4e12_A		283	Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1	87.68
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	87.43
1ks9_A		291	KPA reductase;, 2-dehydropantoate 2-reductase; PAN	87.32
3ghy_A		335	Ketopantoate reductase protein; oxidoreductase, NA	87.23
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	87.06
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	87.0
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	86.88
3g17_A		294	Similar to 2-dehydropantoate 2-reductase; structur	86.73
2raf_A		209	Putative dinucleotide-binding oxidoreductase; NP_7	86.54
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	86.35
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	85.93
2ew2_A		316	2-dehydropantoate 2-reductase, putative; alpha-str	85.85
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	85.79
1ojt_A		482	Surface protein; redox-active center, glycolysis,	85.67
1jw9_B		249	Molybdopterin biosynthesis MOEB protein; MOEB: mod	85.58
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	85.55
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	85.5
3ego_A		307	Probable 2-dehydropantoate 2-reductase; structural	85.41
2dpo_A		319	L-gulonate 3-dehydrogenase; structural genomics, N	85.16
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	85.16
3hwr_A		318	2-dehydropantoate 2-reductase; YP_299159.1, PANE/A	85.11
2y0c_A		478	BCEC, UDP-glucose dehydrogenase; oxidoreductase, c	85.05
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	84.9
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	84.81
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	84.77
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	84.7
1lld_A		319	L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N	84.6
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	84.51
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	84.48
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	84.29
3k6j_A		460	Protein F01G10.3, confirmed by transcript evidenc;	84.13
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	83.93
3dfz_A		223	SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase	83.86
1z82_A		335	Glycerol-3-phosphate dehydrogenase; TM0378, struct	83.78
1zcj_A		463	Peroxisomal bifunctional enzyme; peroxisomal multi	83.44
1pzg_A		331	LDH, lactate dehydrogenase; apicomplexa, APAD, tet	83.22
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	83.11
1zej_A		293	HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural	83.09
1bg6_A		359	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L	83.09
1txg_A		335	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid	83.08
1mv8_A		436	GMD, GDP-mannose 6-dehydrogenase; rossman fold, do	82.62
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	82.6
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	82.59
3gg2_A		450	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd	82.33
1kyq_A		274	Met8P, siroheme biosynthesis protein Met8; homodim	82.31
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	82.07
3k96_A		356	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA	81.87
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	81.87
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	81.77
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	81.74
3l9w_A		413	Glutathione-regulated potassium-efflux system Pro	81.27
3g79_A		478	NDP-N-acetyl-D-galactosaminuronic acid dehydrogen;	81.2
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	81.04
4g65_A		461	TRK system potassium uptake protein TRKA; structur	80.9
1jay_A		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma	80.89
1nyt_A		271	Shikimate 5-dehydrogenase; alpha/beta domains, WID	80.77
3dtt_A		245	NADP oxidoreductase; structural genomics, joint ce	80.59
3mog_A		483	Probable 3-hydroxybutyryl-COA dehydrogenase; struc	80.46
2vns_A		215	Metalloreductase steap3; metal-binding, transmembr	80.24
1evy_A		366	Glycerol-3-phosphate dehydrogenase; rossmann fold,	80.16
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	80.14
3rui_A		340	Ubiquitin-like modifier-activating enzyme ATG7; au	80.09
2v6b_A		304	L-LDH, L-lactate dehydrogenase; oxidoreductase, ra	80.03

>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii}	Back alignment and structure

Probab=100.00  E-value=8e-65  Score=587.79  Aligned_cols=482  Identities=16%  Similarity=0.155  Sum_probs=340.3

Q ss_pred             cccEEEECCCchHHHHHHHHHh-CCCeEEEEcCCCCCCCCC---cc-----cccCCchhhhhhhCCccccCCCceeeeec
Q 003990          271 KCDAVVVGSGSGGGLIAGVLAK-AGYKVLVLEKGSYCARSN---LS-----LLEGKTMDQMYLAGGMLATDDMGVILLAG  341 (781)
Q Consensus       271 ~~DVIVVGsG~~G~vaA~~LA~-~G~kVlVLEkG~~~~~~~---~~-----~~~~~~~~~~y~~~~~~~~~~~~~~~~~G  341 (781)
                      +|||||||||++||++|.+|++ .|++|||||+|+......   .|     ....+.++|.|.+.+.....++.+.+.+|
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~~~~r~~~~~rG   81 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAGYNGRSIAYPRG   81 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGGGTTCCCBCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCCCCCceEeccCC
Confidence            5999999999999999999999 699999999998653221   11     11125577888888877788889999999


Q ss_pred             ceecCcchhcccccccCChhhHHHHHHHhcCCCcChhhhhHHHHhhhhhcccc-----------------------CCCc
Q 003990          342 STVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQ-----------------------SEVE  398 (781)
Q Consensus       342 ~~lGGgs~in~~~~~r~~~~~~~~W~~~~gl~~~~~~~~~~~~~~v~~~l~v~-----------------------~~~~  398 (781)
                      ++|||+|++|+++|.|+.+.+|+.|++..|.+.|.++++.+++.+.+......                       ....
T Consensus        82 k~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~~~~~  161 (566)
T 3fim_B           82 RMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGF  161 (566)
T ss_dssp             CBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEBSCSS
T ss_pred             cEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeeecCCC
Confidence            99999999999999999999999999877889999999999999877654211                       0011


Q ss_pred             cCCccHHHHHHHHHHc--CCCCCCCCCCCCCCCcceeccccCCCCcccchhhhchHHHhhCCCeEEecCcEEEEEEccCC
Q 003990          399 EEGFNNAVLRRGCKEL--GYPVNNIPRNSPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKR  476 (781)
Q Consensus       399 ~~~~~~~~l~~~~~~l--G~~~~~~p~n~~~~~~~g~~~~gc~~g~k~s~~~~~L~~a~~~gn~~i~~~~~V~~I~~~~g  476 (781)
                       .......+.++++++  |++... ..|.....++++|...+..+.|.++..+||.++.+++|++|++++.|+||+++..
T Consensus       162 -~~~~~~~~~~a~~~~~~G~~~~~-d~n~~~~~G~~~~~~~~~~g~R~sa~~ayL~p~~~r~NL~Vlt~a~V~rIl~~~~  239 (566)
T 3fim_B          162 -PTPLDDRVLATTQEQSEEFFFNP-DMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNSGT  239 (566)
T ss_dssp             -CCTHHHHHHHHHHHTHHHHCBCS-CGGGSCCCEEEECCBSEETTEECCHHHHTHHHHTTCTTEEEESSCEEEEEECCEE
T ss_pred             -CCHHHHHHHHHHHHHhcCCCccC-CCCCCCcceEEeeeeecCCCEEcCHHHHHhhhhccCCCeEEECCCEEEEEEeecC
Confidence             112346788999999  988754 3465666788888888888999999999999999999999999999999999810


Q ss_pred             -CCcceEEEEEEEEeeCCce-eEEEEec-cEEEEeccCCCCHHHHHHcCCCC---------------Ccccccccccccc
Q 003990          477 -RDRNVATGVAFEFQYMGAK-DICVVES-KVTIVACGALSTPNLLKRSGLKN---------------ANIGKNLHLHPVT  538 (781)
Q Consensus       477 -g~~~ra~GV~~~~~~~g~g-~~~~i~A-k~VVLAaGai~Tp~LLl~SGi~~---------------p~VG~nL~dHp~~  538 (781)
                       ++.++|+||++..   ..+ +..+|+| |+||||||+|+||+|||+|||++               |.||+||+||+.+
T Consensus       240 ~~g~~rA~GVe~~~---~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH~~~  316 (566)
T 3fim_B          240 TNGLPAFRCVEYAE---QEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDHLLL  316 (566)
T ss_dssp             ETTEEECCEEEEES---STTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCCEEE
T ss_pred             CCCCCEEEEEEEEE---CCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcCccc
Confidence             0124899999985   223 5678999 89999999999999999999974               7899999999987


Q ss_pred             eeeccccCCCCCC---CCcc-c-----cccCCCCCceeeecccccCcCCCC-----CCceec--CCCCCccchhccCCCC
Q 003990          539 MAWGYFPKTSSSG---EWPE-E-----KKTSYEGGIMTAMSTTVGNFGKSG-----YGAVIQ--TPALHPGMFSSLMPWV  602 (781)
Q Consensus       539 ~~~~~~~~~~~~~---~~~~-~-----~~~~~~gg~~ts~~~~~~~~~~~~-----~~~~le--~~~~~p~~~~~~~p~~  602 (781)
                      .+....+......   .... .     .......|++++.......|-...     +....+  .....|.....+.+..
T Consensus       317 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~pd~~~~~~~~~  396 (566)
T 3fim_B          317 PAAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTALIANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETIFSNQW  396 (566)
T ss_dssp             CCEEEESCSCSSGGGGTCHHHHHHHHHHHHHHSCSGGGCCSCSEEEEECCCTTCGGGGTSCCCSSSTTSCSEEEEEESSC
T ss_pred             eEEEEeCCCcccchhhcChHHHHHHHHHHHhcCCCCcccChhhheeeeccccchhhhhhhccccccCCCCCEEEEecccc
Confidence            5422222211100   0000 0     000012344332111000000000     000000  0001111111111100


Q ss_pred             cchhHHHHHhhcCCceEEEEEeecCCCceEecC-------cc--ccCCCChhhHHHHHHHHHHHHHHHHHcCcccccc-c
Q 003990          603 SGADIKLRMCKFSRTAHIFVLARDQGSGTVNSP-------YS--ISYQMEAMDEENLKKGIEKILRILAAAGAEEIGT-H  672 (781)
Q Consensus       603 ~g~~~~~~~~~~~~~~~~~~l~~d~s~G~V~~~-------p~--i~y~~~~~D~~~l~~~~~~~~~i~~~~ga~~i~~-~  672 (781)
                      ....+. .............+++|.|+|+|+++       |.  ++|+.++.|++.++++++.+++|+.+.+++.+.. +
T Consensus       397 ~~~~~~-~~~~~~~~~~~~~l~~P~SrG~V~L~s~dp~~~P~i~~~yl~~~~D~~~~~~~~~~~~~i~~~~~~~~~~~~~  475 (566)
T 3fim_B          397 FHPAIP-RPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNLRFLSGQAWADFVIRP  475 (566)
T ss_dssp             CCTTSC-CCSSCCEEEEEEEESSCSCCBEEECSSSCTTSCCEEECCTTCSHHHHHHHHHHHHHHHHHHTSGGGTTTEEEE
T ss_pred             hhhccc-CCCCCCEEEEEEeecCCccceEEEecCCCCCCCceeccccCCCccHHHHHHHHHHHHHHHHhCcccCCccccc
Confidence            000000 00000112344567899999999874       33  4888999999999999999999998777766432 2


Q ss_pred             ccCCccccccCCCHHHHHHHHHhhccCCCCCCCCCccccccccCccCCCCCCC-ccccCCCceeccCCcEEecCCcCCCC
Q 003990          673 HCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKT-SVVNQMGETWGVEGLYLADTSVFPTA  751 (781)
Q Consensus       673 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~H~~GTcrMG~~~~~-gVVD~~~rv~g~~nL~V~DaSvfPt~  751 (781)
                      ..++.   ....+|+++++|+++..          .+.+|++||||||++++. ||||+++||||++||||+||||||+.
T Consensus       476 ~~P~~---~~~~sd~~~~~~ir~~~----------~t~~H~~GTc~Mg~~~~~~~VVD~~lrV~Gv~~LrVvDaSv~P~~  542 (566)
T 3fim_B          476 FDPRL---RDPTDDAAIESYIRDNA----------NTIFHPVGTASMSPRGASWGVVDPDLKVKGVDGLRIVDGSILPFA  542 (566)
T ss_dssp             SSGGG---SCTTCHHHHHHHHHHHC----------EECSCCBCTTCBCCTTCSSCSBCTTCBBTTCBSEEECSGGGCCSC
T ss_pred             cCCCc---ccccchHHHHHHHhhcc----------cccccccCccccCCcccCCccCCCCCeEccCCCcEEcccccCCCC
Confidence            22320   12358999999999853          688999999999999887 99999999999999999999999999


Q ss_pred             CCCCChhHHHHHHHHHHHHH
Q 003990          752 LGVNPMVTVQAIAYCTAQSV  771 (781)
Q Consensus       752 ~g~NP~lTi~AlA~~iA~~i  771 (781)
                      +++||++|+||+|+++|+.|
T Consensus       543 ~~~n~~~~~~~iaekaAd~I  562 (566)
T 3fim_B          543 PNAHTQGPIYLVGKQGADLI  562 (566)
T ss_dssp             CSSCTHHHHHHHHHHHHHHH
T ss_pred             CCcCcHHHHHHHHHHHHHHH
Confidence            99999998888765555544

PyMOL of 3fim

>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti}	Back alignment and structure

>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A*	Back alignment and structure

>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae}	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A*	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A*	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida}	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A*	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472}	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense}	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A*	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A*	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A*	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*	Back alignment and structure

>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A*	Back alignment and structure

>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus}	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens}	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A*	Back alignment and structure

>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima}	Back alignment and structure

>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A*	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A*	Back alignment and structure

>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp}	Back alignment and structure

>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis}	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis}	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha}	Back alignment and structure

>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans}	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium}	Back alignment and structure

>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima}	Back alignment and structure

>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus}	Back alignment and structure

>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6	Back alignment and structure

>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6	Back alignment and structure

>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A*	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis}	Back alignment and structure

>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii}	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A*	Back alignment and structure

>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1}	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus}	Back alignment and structure

>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*	Back alignment and structure

>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP}	Back alignment and structure

>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli}	Back alignment and structure

>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A*	Back alignment and structure

>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A*	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A*	Back alignment and structure

>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		781
d3coxa1		370	c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of	1e-25
d1n4wa1		367	c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of	4e-24
d1n4wa1		367	c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of	0.003
d1kdga1		360	c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain	1e-18
d1kdga1		360	c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain	2e-04
d2f5va1		379	c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W	4e-17
d2f5va1		379	c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W	3e-16
d1cf3a1		385	c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper	5e-15
d1cf3a1		385	c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper	1e-06
d1gpea1		391	c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic	4e-13
d1gpea1		391	c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic	0.004
d1ju2a1		351	c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {	2e-10
d2bcgg1		297	c.3.1.3 (G:5-301) Guanine nucleotide dissociation	8e-08
d1d5ta1		336	c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di	1e-07
d1d4ca2		322	c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (	3e-06
d2i0za1		251	c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B	1e-05
d1lvla1		220	c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd	2e-05
d1ebda1		223	c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd	3e-05
d1gesa1		217	c.3.1.5 (A:3-146,A:263-335) Glutathione reductase	3e-05
d2bs2a2		336	c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo	4e-05
d1k0ia1		292	c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr	5e-05
d2gqfa1		253	c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H	9e-05
d2v5za1		383	c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H	9e-05
d1ryia1		276	c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {	1e-04
d1y0pa2		308	c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (	1e-04
d1jnra2		356	c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct	1e-04
d1v59a1		233	c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd	2e-04
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	2e-04
d1qo8a2		317	c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (	2e-04
d1seza1		373	c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox	3e-04
d1onfa1		259	c.3.1.5 (A:1-153,A:271-376) Glutathione reductase	3e-04
d2ivda1		347	c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox	3e-04
d1neka2		330	c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase	3e-04
d2iida1		370	c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M	4e-04
d3lada1		229	c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd	5e-04
d2gf3a1		281	c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac	5e-04
d3grsa1		221	c.3.1.5 (A:18-165,A:291-363) Glutathione reductase	5e-04
d1h6va1		235	c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin	6e-04
d1i8ta1		298	c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu	7e-04
d1ojta1		229	c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh	8e-04
d1dxla1		221	c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd	8e-04
d1chua2		305	c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E	0.001
d1mo9a1		261	c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop	0.001
d2voua1		265	c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr	0.001
d2bi7a1		314	c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu	0.001
d2dw4a2		449	c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist	0.002

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Cholesterol oxidase of GMC family
species: Brevibacterium sterolicum [TaxId: 1702]

 Score =  107 bits (268), Expect = 1e-25
 Identities = 51/322 (15%), Positives = 91/322 (28%), Gaps = 52/322 (16%)

Query: 271 KCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTM----------- 319
           +  A+V+GSG GG + A  L +AG    ++E G               M           
Sbjct: 7   RVPALVIGSGYGGAVAALRLTQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLA 66

Query: 320 -----------------DQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHV 362
                                  G + +    G+ +  G  VGGGS +N   ++   ++ 
Sbjct: 67  DKTDQPVSNFMGFGINKSIDRYVGVLDSERFSGIKVYQGRGVGGGSLVNGGMAVTPKRNY 126

Query: 363 ANEWCDEYELKLFESDLYK--EAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNN 420
             E     +     +  +        V        E  E        R+  +  G+    
Sbjct: 127 FEEILPSVDSNEMYNKYFPRANTGLGVNNIDQAWFESTEWYKFARTGRKTAQRSGFTTAF 186

Query: 421 IPRNS------------PPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEA 468
           +P                     G   +   +  KK   +T+L     +G   I      
Sbjct: 187 VPNVYDFEYMKKEAAGQVTKSGLGGEVIYGNNAGKKSLDKTYLAQAAATGKLTITTLHRV 246

Query: 469 IEVLHKKRRDRNVATGVAFEFQYMGAKDICVVESKVTIVACGALSTPNLLKRS----GLK 524
            +V          +  +    +        VV +     A G++ T  LL        L 
Sbjct: 247 TKVAPAT--GSGYSVTMEQIDEQGNVVATKVVTADRVFFAAGSVGTSKLLVSMKAQGHLP 304

Query: 525 NAN--IGKNL--HLHPVTMAWG 542
           N +  +G+     L+  T  +G
Sbjct: 305 NLSSQVGEGWGVLLNKATDNFG 326

PyMOL of d3coxa1

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391	Back information, alignment and structure

>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297	Back information, alignment and structure

>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251	Back information, alignment and structure

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223	Back information, alignment and structure

>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308	Back information, alignment and structure

>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356	Back information, alignment and structure

>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373	Back information, alignment and structure

>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370	Back information, alignment and structure

>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235	Back information, alignment and structure

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305	Back information, alignment and structure

>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		781
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	100.0
d1cf3a1		385	Glucose oxidase {Aspergillus niger [TaxId: 5061]}	100.0
d1gpea1		391	Glucose oxidase {Penicillium amagasakiense [TaxId:	100.0
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	100.0
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	100.0
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	100.0
d1ju2a1		351	Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI	100.0
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	99.71
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	99.68
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	99.62
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	99.55
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	99.54
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	99.53
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	99.48
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	99.43
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	99.41
d1chua2		305	L-aspartate oxidase {Escherichia coli [TaxId: 562]	99.4
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	99.3
d1jnra2		356	Adenylylsulfate reductase A subunit {Archaeon Arch	99.29
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	99.27
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	99.25
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	99.21
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.96
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	98.79
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	98.62
d1rp0a1		278	Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara	98.61
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	98.41
d1gesa1		217	Glutathione reductase {Escherichia coli [TaxId: 56	98.36
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	98.29
d3lada1		229	Dihydrolipoamide dehydrogenase {Azotobacter vinela	98.28
d1v59a1		233	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	98.26
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	98.25
d1lvla1		220	Dihydrolipoamide dehydrogenase {Pseudomonas putida	98.23
d1dxla1		221	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	98.23
d3grsa1		221	Glutathione reductase {Human (Homo sapiens) [TaxId	98.22
d1gpea2		196	Glucose oxidase {Penicillium amagasakiense [TaxId:	98.21
d1cf3a2		196	Glucose oxidase {Aspergillus niger [TaxId: 5061]}	98.21
d1onfa1		259	Glutathione reductase {Plasmodium falciparum [TaxI	98.21
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	98.18
d1ojta1		229	Dihydrolipoamide dehydrogenase {Neisseria meningit	98.18
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	98.18
d1i8ta1		298	UDP-galactopyranose mutase, N-terminal domain {Esc	98.17
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	98.14
d1ju2a2		170	Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI	98.13
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	98.09
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	98.05
d1fl2a1		184	Alkyl hydroperoxide reductase subunit F (AhpF), C-	98.03
d1c0pa1		268	D-aminoacid oxidase, N-terminal domain {Rhodotorul	98.0
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	97.94
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	97.93
d1feca1		240	Trypanothione reductase {Crithidia fasciculata [Ta	97.92
d1kdga2		181	Flavoprotein domain of flavocytochrome cellobiose	97.79
d1mo9a1		261	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	97.79
d1trba1		190	Thioredoxin reductase {Escherichia coli [TaxId: 56	97.76
d2bi7a1		314	UDP-galactopyranose mutase, N-terminal domain {Kle	97.75
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	97.74
d1vdca1		192	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	97.73
d1ps9a3		179	2,4-dienoyl-CoA reductase, middle domain {Escheric	97.72
d1aoga1		238	Trypanothione reductase {Trypanosoma cruzi [TaxId:	97.71
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	97.69
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	97.69
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	97.64
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	97.6
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	97.59
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	97.56
d1gtea4		196	Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su	97.48
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	97.47
d1djqa3		233	Trimethylamine dehydrogenase, middle domain {Methy	97.39
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	97.25
d1xdia1		233	Dihydrolipoamide dehydrogenase {Mycobacterium tube	97.2
d1lqta2		239	Ferredoxin:NADP reductase FprA {Mycobacterium tube	97.14
d1cjca2		230	Adrenodoxin reductase of mitochondrial p450 system	97.07
d1kifa1		246	D-aminoacid oxidase, N-terminal domain {Pig (Sus s	96.94
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	96.76
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	96.68
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	96.64
d1vg0a1		491	Rab escort protein 1 {Rat (Rattus norvegicus) [Tax	96.62
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	96.52
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	96.49
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	96.44
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	96.34
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	96.3
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	96.08
d1fcda1		186	Flavocytochrome c sulfide dehydrogenase, FCSD, fla	95.79
d2f5va2		198	Pyranose 2-oxidase {White-rot fungus (Peniophora s	95.6
d1q1ra1		185	Putidaredoxin reductase {Pseudomonas putida [TaxId	95.45
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	95.38
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	95.3
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	95.28
d1ks9a2		167	Ketopantoate reductase PanE {Escherichia coli [Tax	95.13
d1bg6a2		184	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A	94.96
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	94.79
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	94.2
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	94.12
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	94.1
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	94.06
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	93.99
d1f0ya2		192	Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum	93.44
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	93.33
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	93.31
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	93.11
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	93.07
d1wdka3		186	Fatty oxidation complex alpha subunit, middle doma	92.25
d1mv8a2		202	GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos	91.57
d1n1ea2		189	Glycerol-3- phosphate dehydrogenase {Trypanosome (	91.02
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	90.35
d1txga2		180	Glycerol-3- phosphate dehydrogenase {Archaeoglobus	89.99
d1nyta1		170	Shikimate 5-dehydrogenase AroE {Escherichia coli [	89.62
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	89.55
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	89.16
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	88.75
d1kyqa1		150	Bifunctional dehydrogenase/ferrochelatase Met8p, N	87.33
d1gtea3		153	Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su	87.24
d2gv8a2		107	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	86.79
d1pjca1		168	L-alanine dehydrogenase {Phormidium lapideum [TaxI	86.79
d1pjqa1		113	Siroheme synthase CysG, domain 1 {Salmonella typhi	86.65
d1l7da1		183	Nicotinamide nucleotide transhydrogenase dI compon	86.61
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	84.15
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	84.05
d1i0za1		160	Lactate dehydrogenase {Human (Homo sapiens), heart	83.82
d1id1a_		153	Rck domain from putative potassium channel Kch {Es	83.77
d1npya1		167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	83.5
d1vdca2		130	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	83.38
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	83.27
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	83.12
d3cuma2		162	Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru	82.87
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	81.78
d1dlja2		196	UDP-glucose dehydrogenase (UDPGDH) {Streptococcus	81.49
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	81.49
d1vpda2		161	Hydroxyisobutyrate dehydrogenase {Salmonella typhi	81.38
d1vdca2		130	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	81.0
d1jw9b_		247	Molybdenum cofactor biosynthesis protein MoeB {Esc	80.78
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	80.45
d1pzga1		154	Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5	80.01

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain
species: Fungus (Phanerochaete chrysosporium) [TaxId: 5306]

Probab=100.00  E-value=5.2e-44  Score=391.29  Aligned_cols=333  Identities=20%  Similarity=0.268  Sum_probs=251.8

Q ss_pred             cccEEEECCCchHHHHHHHHHhCCCeEEEEcCCCCCCCCCcccc-------------cCCchhhhhhhCCccccCCCcee
Q 003990          271 KCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLL-------------EGKTMDQMYLAGGMLATDDMGVI  337 (781)
Q Consensus       271 ~~DVIVVGsG~~G~vaA~~LA~~G~kVlVLEkG~~~~~~~~~~~-------------~~~~~~~~y~~~~~~~~~~~~~~  337 (781)
                      .|||||||||++|+++|.+||++|++|||||+|+..........             ..+...+.+...+.....++.+.
T Consensus         2 ~YD~IIVGsG~aG~v~A~rLae~g~~VlvLEaG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (360)
T d1kdga1           2 PYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDIT   81 (360)
T ss_dssp             CEEEEEECCSHHHHHHHHHHHHTTCCEEEECSSCCCSGGGTCCCCCGGGGGGTCCTTTCGGGGGGGGTCSCCTTBCTTBS
T ss_pred             cCCEEEECcCHHHHHHHHHHhhCCCeEEEEEccCCCCcccccccccchhhccCcccccCcccccccccCCCcccCCcccc
Confidence            59999999999999999999999999999999975433221110             11122233333333344566788


Q ss_pred             eeecceecCcchhcccccccCChhhHHHHHHHhcCCCcChhhhhHHHHhhhhhccccCCCcc-----CCccHHHHHHHHH
Q 003990          338 LLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDLYKEAMEVVCERMGVQSEVEE-----EGFNNAVLRRGCK  412 (781)
Q Consensus       338 ~~~G~~lGGgs~in~~~~~r~~~~~~~~W~~~~gl~~~~~~~~~~~~~~v~~~l~v~~~~~~-----~~~~~~~l~~~~~  412 (781)
                      +.+|+++||+|.+|++.++|+.+.+|+.|.   +++ +.++++.+++++++..++.......     .......+.+.++
T Consensus        82 ~~~G~~lGGsS~in~~~~~r~~~~D~~~~~---gwp-~~~~~l~py~~~~e~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  157 (360)
T d1kdga1          82 VFAGCLVGGGTSVNGALYWYPNDGDFSSSV---GWP-SSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLK  157 (360)
T ss_dssp             SCCBCSTTGGGGTSCCBCCCCCGGGGCGGG---TCC-GGGSCCHHHHHHHHHHSCCBSCCSTTSCCCSCHHHHHHHHHHH
T ss_pred             ccceeeecchhccccccccccchhhheecc---ccc-ccccchhhhhhhhhccccccceecCCCcccccchhHHHHHHHH
Confidence            899999999999999999999999998874   555 4667788999999888876543221     1122356777788


Q ss_pred             HcCCCCCCCCCC-CCCCCcceeccccCCCCcccchhhhchHHHhhCCCeEEecCcEEEEEEccCCCCcceEEEEEEEEee
Q 003990          413 ELGYPVNNIPRN-SPPDHYCGWCCLGCKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQY  491 (781)
Q Consensus       413 ~lG~~~~~~p~n-~~~~~~~g~~~~gc~~g~k~s~~~~~L~~a~~~gn~~i~~~~~V~~I~~~~gg~~~ra~GV~~~~~~  491 (781)
                      +.|+....++.+ ...+..||+|...|..|.|.++..+||.++.+++|++|++++.|+||+++++    +++||++.+..
T Consensus       158 ~~g~~~~~~~~~~~~~~~~~g~~~~~~~~G~R~s~~~~yl~~a~~r~nl~i~t~~~V~rI~~d~~----ra~GV~~~~~~  233 (360)
T d1kdga1         158 GQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGS----QILGVQTNDPT  233 (360)
T ss_dssp             TTTCEECCGGGSTTCCTTEEEECCBCEETTEECHHHHTHHHHHHTCTTEEEECSCCEEEEEEETT----EEEEEEESCTT
T ss_pred             HhhccCCCcccCCCccccccceeeeeccccccccccchhhhhhhcccccccccCcEEEEEEEeCC----EEEEEEEEecc
Confidence            888765444332 3356789999999999999999999999999999999999999999999865    99999997532


Q ss_pred             CCceeEEEEec-cEEEEeccCCCCHHHHHHcCCCCCcccccccccccceeeccccCCCCCCCCccccccCCCCCceeeec
Q 003990          492 MGAKDICVVES-KVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKTSYEGGIMTAMS  570 (781)
Q Consensus       492 ~g~g~~~~i~A-k~VVLAaGai~Tp~LLl~SGi~~p~VG~nL~dHp~~~~~~~~~~~~~~~~~~~~~~~~~~gg~~ts~~  570 (781)
                      .+.++..+++| |+||||||+|+||+|||+|||++...-+.+..||.+..                              
T Consensus       234 ~~~~~~~~v~a~~eVILsAGai~SP~LLl~SGIGp~~~L~~~gi~p~v~~------------------------------  283 (360)
T d1kdga1         234 LGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAA------------------------------  283 (360)
T ss_dssp             SSGGGEEEEEEEEEEEECSHHHHHHHHHHHTTBSCHHHHHHHHTSHHHHH------------------------------
T ss_pred             cCcceEEEEEECCEEEEechhHhChHHHHhcCCCchhhhHHhhcCccccc------------------------------
Confidence            23345667777 67999999999999999999987654333333322100                              


Q ss_pred             ccccCcCCCCCCceecCCCCCccchhccCCCCcchhHHHHHhhcCCceEEEEEeecCCCceEecCccccCCCChhhHHHH
Q 003990          571 TTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSISYQMEAMDEENL  650 (781)
Q Consensus       571 ~~~~~~~~~~~~~~le~~~~~p~~~~~~~p~~~g~~~~~~~~~~~~~~~~~~l~~d~s~G~V~~~p~i~y~~~~~D~~~l  650 (781)
                      +                           +|   +.                                             
T Consensus       284 ~---------------------------l~---~~---------------------------------------------  288 (360)
T d1kdga1         284 A---------------------------LP---PQ---------------------------------------------  288 (360)
T ss_dssp             H---------------------------SC---CG---------------------------------------------
T ss_pred             c---------------------------cc---cc---------------------------------------------
Confidence            0                           00   00                                             


Q ss_pred             HHHHHHHHHHHHHcCcccccccccCCccccccCCCHHHHHHHHHhhccCCCCCCCCCccccccccCccCCCCCCCccccC
Q 003990          651 KKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQ  730 (781)
Q Consensus       651 ~~~~~~~~~i~~~~ga~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~H~~GTcrMG~~~~~gVVD~  730 (781)
                                          .                                    ....|++|+|.|+..+.++|||+
T Consensus       289 --------------------~------------------------------------~~~~~p~g~~~~~~~~~~~v~~~  312 (360)
T d1kdga1         289 --------------------N------------------------------------QWINLPVGMTTIGSSPQSAVVDS  312 (360)
T ss_dssp             --------------------G------------------------------------GCBCCCTTTTCBCSCTTTCSBCT
T ss_pred             --------------------c------------------------------------ceecccceeeecCCCCcccEECc
Confidence                                0                                    11248999999999999999999


Q ss_pred             CCceeccCCcEEecCCcCCCCCCCCChhHHHHHHHHHHHHHH
Q 003990          731 MGETWGVEGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVL  772 (781)
Q Consensus       731 ~~rv~g~~nL~V~DaSvfPt~~g~NP~lTi~AlA~~iA~~ia  772 (781)
                      +.+++|+.||||+|+|+||..+..||+.++|.+|.+.|++|.
T Consensus       313 ~~~~~g~~~l~~~~a~~~p~~~~~~~~~~~~~~ae~aa~~il  354 (360)
T d1kdga1         313 NVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKIL  354 (360)
T ss_dssp             TCBBTTCSSEEECSGGGCSSCCSSCSHHHHHHHHHHHHHHHH
T ss_pred             cceeeccCCceEEeeecccccCCCCCCcchhHHHHHHHHHHh
Confidence            999999999999999999999999999888877665555543

PyMOL of d1kdga1

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}	Back information, alignment and structure

>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]}	Back information, alignment and structure

>d2f5va2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}	Back information, alignment and structure

>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}	Back information, alignment and structure

>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}	Back information, alignment and structure